F445798

General Info

Members Datasets Scaffolds Average Seq Length
446 273 892 157

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0094333|Ga0495609_0094333_149_682
Length 177
Sequence MAEAQCHPKYRQKKGFPVTKIPVVELAIGDKAPDFDLPRDGGGRIRLADYAGKPLVIFFYPKDNTSACTTESIAFTTLAADFEKAGTSIVGMSPDSVKSHDKFVKKYDLSVPLAADEEKTAAEAYGVWREKSMYGRTYMGVVRSTFLIAADGRIARIWDKVKVAGHAEEVLAAAKEL

Samples

Sample ID Description Type Environment
1 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
60 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
61 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
122 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
123 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
124 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
125 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
202 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
206 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
207 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
208 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
209 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
214 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
217 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
220 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
221 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
222 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
223 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
224 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
225 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
226 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
227 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
228 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
229 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
230 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
231 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
232 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
233 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
234 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
235 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
236 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
237 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
238 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
239 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
240 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
241 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
242 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
243 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
244 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
245 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
246 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
247 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
248 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
249 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
250 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
251 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
252 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
253 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
254 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
255 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
256 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
257 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
258 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
259 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
260 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
261 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
262 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
263 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
264 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
265 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
266 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
267 2996887358 Rhizobium sp. R711 Isolate Nodule
268 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
269 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
270 8005258706 Rhizobium sp. R693 Isolate Nodule
271 8005321885 Rhizobium sp. R72 Isolate Nodule
272 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
273 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.67
Metatranscriptomes 0
Isolates 12.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.3
Nodule 4.71
Rhizoplane 5.61
Rhizosphere 51.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495609_0094333 3300046538 Bacteria 1300
2 SwRhRL2b_contig_2381925 2162886007 Bacteria 45817
3 SwRhRL2b_contig_3552468 2162886007 Bacteria 4831
4 JGI24034J26672_10008683 3300002239 Bacteria 1487
5 JGI24751J29686_10013033 3300002459 Bacteria 1717
6 JGI25151J46595_10118927 3300003187 Bacteria 677
7 JGI25160J50197_1006993 3300003354 Bacteria 4474
8 Ga0055526_1019192 3300003771 Bacteria 2502
9 Ga0055524_1004417 3300003775 Bacteria 6487
10 Ga0055528_1044494 3300003790 Bacteria 955
11 Ga0055528_1078279 3300003790 Bacteria 585
12 Ga0055530_10032027 3300003791 Bacteria 1372
13 Ga0065165_1008282 3300005262 Bacteria 4905
14 Ga0065704_10070189 3300005289 Bacteria 114786
15 Ga0065704_10070386 3300005289 Bacteria 27813
16 Ga0065707_10162130 3300005295 Bacteria 1554
17 Ga0065707_10486321 3300005295 Bacteria 769
18 Ga0070658_10000416 3300005327 Bacteria 36945
19 Ga0070670_100022367 3300005331 Bacteria 5442
20 Ga0070670_100039868 3300005331 Bacteria 4039
21 Ga0070668_100003250 3300005347 Bacteria 11983
22 Ga0070668_100008247 3300005347 Bacteria 7732
23 Ga0070668_100499467 3300005347 Bacteria 1053
24 Ga0070669_100000149 3300005353 Bacteria 62788
25 Ga0070669_100000646 3300005353 Bacteria 25770
26 Ga0070669_100072410 3300005353 Bacteria 2551
27 Ga0070669_101211535 3300005353 Bacteria 652
28 Ga0070669_101310815 3300005353 Bacteria 627
29 Ga0070671_100001725 3300005355 Bacteria 16601
30 Ga0070671_100005996 3300005355 Bacteria 9686
31 Ga0070671_100029081 3300005355 Bacteria 4556
32 Ga0070667_100000715 3300005367 Bacteria 31974
33 Ga0070667_100467018 3300005367 Bacteria 1154
34 Ga0070667_100631679 3300005367 Bacteria 988
35 Ga0070709_10928814 3300005434 Bacteria 689
36 Ga0070705_101327548 3300005440 Bacteria 597
37 Ga0070663_100215374 3300005455 Bacteria 1506
38 Ga0070707_100330946 3300005468 Bacteria 1480
39 Ga0070665_100000079 3300005548 Bacteria 186925
40 Ga0070665_100351568 3300005548 Bacteria 1479
41 Ga0068855_100000459 3300005563 Bacteria 50028
42 Ga0068855_100015660 3300005563 Bacteria 9124
43 Ga0068854_100176949 3300005578 Bacteria 1664
44 Ga0068856_100013737 3300005614 Bacteria 7829
45 Ga0068852_100000113 3300005616 Bacteria 54686
46 Ga0068859_100931730 3300005617 Bacteria 953
47 Ga0068864_100001043 3300005618 Bacteria 23260
48 Ga0068864_100829263 3300005618 Bacteria 910
49 Ga0068863_100013608 3300005841 Bacteria 7848
50 Ga0068863_100087772 3300005841 Bacteria 2947
51 Ga0068863_100189721 3300005841 Bacteria 1975
52 Ga0068858_100000997 3300005842 Bacteria 29246
53 Ga0068858_100124871 3300005842 Bacteria 2409
54 Ga0068860_100011925 3300005843 Bacteria 8567
55 Ga0068860_100041246 3300005843 Bacteria 4409
56 Ga0068860_100050458 3300005843 Bacteria 3961
57 Ga0068860_100076475 3300005843 Bacteria 3184
58 Ga0068860_100110425 3300005843 Bacteria 2628
59 Ga0068862_100002804 3300005844 Bacteria 15271
60 Ga0068862_100010619 3300005844 Bacteria 7608
61 Ga0068862_100048031 3300005844 Bacteria 3643
62 Ga0081540_1043369 3300005983 Bacteria 2309
63 Ga0075365_10011778 3300006038 Bacteria 5159
64 Ga0075365_10173648 3300006038 Bacteria 1505
65 Ga0075368_10000064 3300006042 Bacteria 25622
66 Ga0075363_100000276 3300006048 Bacteria 14864
67 Ga0075363_100006250 3300006048 Bacteria 5391
68 Ga0075364_10005248 3300006051 Bacteria 7519
69 Ga0075364_10114471 3300006051 Bacteria 1802
70 Ga0075364_10226017 3300006051 Bacteria 1271
71 Ga0075364_10383427 3300006051 Bacteria 959
72 Ga0075362_10000006 3300006177 Bacteria 123313
73 Ga0075362_10015292 3300006177 Bacteria 3118
74 Ga0075362_10344399 3300006177 Bacteria 745
75 Ga0075367_10010744 3300006178 Bacteria 4821
76 Ga0075367_10189835 3300006178 Bacteria 1282
77 Ga0075369_10000161 3300006186 Bacteria 18992
78 Ga0075369_10001555 3300006186 Bacteria 7868
79 Ga0075369_10001674 3300006186 Bacteria 7642
80 Ga0075369_10024992 3300006186 Bacteria 2480
81 Ga0075366_10000277 3300006195 Bacteria 22800
82 Ga0075366_10015009 3300006195 Bacteria 4429
83 Ga0075366_10157223 3300006195 Bacteria 1377
84 Ga0075366_10491072 3300006195 Bacteria 759
85 Ga0075370_10000005 3300006353 Bacteria 112202
86 Ga0075370_10029473 3300006353 Bacteria 3058
87 Ga0075370_10065088 3300006353 Bacteria 2079
88 Ga0075370_10104286 3300006353 Bacteria 1643
89 Ga0075430_100064177 3300006846 Bacteria 3085
90 Ga0075431_100072639 3300006847 Bacteria 3550
91 Ga0097620_100931726 3300006931 Bacteria 953
92 Ga0079104_1082679 3300006946 Bacteria 659
93 Ga0105251_10019524 3300009011 Bacteria 3577
94 Ga0105251_10023231 3300009011 Bacteria 3204
95 Ga0105251_10060461 3300009011 Bacteria 1784
96 Ga0105250_10358350 3300009092 Bacteria 640
97 Ga0105240_10023078 3300009093 Bacteria 8240
98 Ga0111539_10966793 3300009094 Bacteria 990
99 Ga0105247_10045172 3300009101 Bacteria 2703
100 Ga0105247_10052587 3300009101 Bacteria 2512
101 Ga0105247_10295351 3300009101 Bacteria 1122
102 Ga0114129_10314330 3300009147 Bacteria 2084
103 Ga0105248_10011441 3300009177 Bacteria 9779
104 Ga0105248_10013763 3300009177 Bacteria 8905
105 Ga0105248_10803872 3300009177 Bacteria 1061
106 Ga0105248_11658980 3300009177 Bacteria 724
107 Ga0105237_10352323 3300009545 Bacteria 1476
108 Ga0105238_10065632 3300009551 Bacteria 3631
109 Ga0105238_10763169 3300009551 Bacteria 981
110 Ga0105249_10248153 3300009553 Bacteria 1763
111 Ga0105249_10845220 3300009553 Bacteria 981
112 Ga0105249_11233176 3300009553 Bacteria 819
113 Ga0123340_1085289 3300009763 Bacteria 593
114 Ga0123340_1085949 3300009763 Bacteria 585
115 Ga0123341_1104123 3300009765 Bacteria 920
116 Ga0123342_1008981 3300009766 Bacteria 12232
117 Ga0157373_10359889 3300013100 Bacteria 1039
118 Ga0163162_10040426 3300013306 Bacteria 4663
119 Ga0163162_10456084 3300013306 Bacteria 1410
120 Ga0163162_10873131 3300013306 Bacteria 1014
121 Ga0163162_10974372 3300013306 Bacteria 958
122 Ga0163161_10001166 3300017792 Bacteria 19753
123 Ga0209129_1002406 3300025258 Bacteria 9191
124 Ga0209673_1010143 3300025273 Bacteria 4000
125 Ga0209673_1038769 3300025273 Bacteria 1383
126 Ga0209130_1018238 3300025284 Bacteria 1652
127 Ga0209025_1020784 3300025294 Bacteria 3567
128 Ga0209025_1021088 3300025294 Bacteria 3527
129 Ga0209564_1008790 3300025295 Bacteria 4923
130 Ga0209564_1012098 3300025295 Bacteria 3795
131 Ga0209758_1043891 3300025297 Bacteria 1641
132 Ga0209050_1002953 3300025298 Bacteria 13289
133 Ga0209256_1004849 3300025299 Bacteria 8131
134 Ga0209256_1028997 3300025299 Bacteria 1550
135 Ga0207426_1001225 3300025302 Bacteria 22624
136 Ga0207426_1087726 3300025302 Bacteria 830
137 Ga0209051_1003735 3300025303 Bacteria 9792
138 Ga0207696_1010898 3300025711 Bacteria 3308
139 Ga0207696_1042816 3300025711 Bacteria 1319
140 Ga0207713_1005215 3300025735 Bacteria 8196
141 Ga0207713_1036251 3300025735 Bacteria 2118
142 Ga0207713_1228068 3300025735 Bacteria 558
143 Ga0207710_10166471 3300025900 Bacteria 1076
144 Ga0207680_10150644 3300025903 Bacteria 1550
145 Ga0207647_10007723 3300025904 Bacteria 7742
146 Ga0207705_10000007 3300025909 Bacteria 597387
147 Ga0207695_10050052 3300025913 Bacteria 4398
148 Ga0207681_10000081 3300025923 Bacteria 85588
149 Ga0207681_10000274 3300025923 Bacteria 38677
150 Ga0207681_11069137 3300025923 Bacteria 677
151 Ga0207694_10187724 3300025924 Bacteria 1678
152 Ga0207694_10836054 3300025924 Bacteria 778
153 Ga0207694_11179845 3300025924 Bacteria 648
154 Ga0207650_10014316 3300025925 Bacteria 5512
155 Ga0207644_10000505 3300025931 Bacteria 25122
156 Ga0207644_10003826 3300025931 Bacteria 9747
157 Ga0207644_10158465 3300025931 Bacteria 1757
158 Ga0207691_10925081 3300025940 Bacteria 729
159 Ga0207711_10004144 3300025941 Bacteria 12419
160 Ga0207711_10684943 3300025941 Bacteria 956
161 Ga0207711_11514609 3300025941 Bacteria 614
162 Ga0207667_10093975 3300025949 Bacteria 3096
163 Ga0207712_10088843 3300025961 Bacteria 2270
164 Ga0207712_10600378 3300025961 Bacteria 952
165 Ga0207668_10003418 3300025972 Bacteria 9311
166 Ga0207668_10062109 3300025972 Bacteria 2630
167 Ga0207668_10214172 3300025972 Bacteria 1542
168 Ga0207640_10000661 3300025981 Bacteria 20176
169 Ga0207658_10000274 3300025986 Bacteria 54007
170 Ga0207658_10012960 3300025986 Bacteria 5694
171 Ga0207658_10206473 3300025986 Bacteria 1643
172 Ga0207658_10420805 3300025986 Bacteria 1178
173 Ga0207658_10549261 3300025986 Bacteria 1033
174 Ga0207703_10000797 3300026035 Bacteria 31085
175 Ga0207703_10448208 3300026035 Bacteria 1205
176 Ga0207702_10005286 3300026078 Bacteria 11325
177 Ga0207641_10013512 3300026088 Bacteria 6697
178 Ga0207641_10450288 3300026088 Bacteria 1244
179 Ga0207676_10024436 3300026095 Bacteria 4470
180 Ga0207676_11032240 3300026095 Bacteria 811
181 Ga0207698_10000036 3300026142 Bacteria 105391
182 Ga0209371_1016976 3300027312 Bacteria 1901
183 Ga0268266_10000175 3300028379 Bacteria 115897
184 Ga0268266_10001903 3300028379 Bacteria 23494
185 Ga0268266_10089631 3300028379 Bacteria 2694
186 Ga0268265_10796903 3300028380 Bacteria 920
187 Ga0268264_10002514 3300028381 Bacteria 16125
188 Ga0268264_10008184 3300028381 Bacteria 8681
189 Ga0268264_10031070 3300028381 Bacteria 4379
190 Ga0268264_10046516 3300028381 Bacteria 3604
191 Ga0268264_10391076 3300028381 Bacteria 1334
192 Ga0268256_1018883 3300030500 Bacteria 1902
193 Ga0265320_10052736 3300031240 Bacteria 1968
194 Ga0265320_10106896 3300031240 Bacteria 1285
195 Ga0265325_10003207 3300031241 Bacteria 10756
196 Ga0265325_10085707 3300031241 Bacteria 1560
197 Ga0265340_10008072 3300031247 Bacteria 5699
198 Ga0265340_10024808 3300031247 Bacteria 3042
199 Ga0265339_10079434 3300031249 Bacteria 1736
200 Ga0265339_10083964 3300031249 Bacteria 1679
201 Ga0265327_10086178 3300031251 Bacteria 1541
202 Ga0265316_10014663 3300031344 Bacteria 6887
203 Ga0265316_10282753 3300031344 Bacteria 1212
204 Ga0307513_10388176 3300031456 Bacteria 1134
205 Ga0265313_10009082 3300031595 Bacteria 6503
206 Ga0265313_10016847 3300031595 Bacteria 4186
207 Ga0265313_10059911 3300031595 Bacteria 1788
208 Ga0265314_10041391 3300031711 Bacteria 3298
209 Ga0265342_10112116 3300031712 Bacteria 1543
210 Ga0307516_10612699 3300031730 Bacteria 743
211 Ga0307405_10058784 3300031731 Bacteria 2421
212 Ga0307413_10253460 3300031824 Bacteria 1307
213 Ga0307407_10288436 3300031903 Bacteria 1140
214 Ga0307412_10028432 3300031911 Bacteria 3497
215 Ga0307414_12012134 3300032004 Bacteria 539
216 Ga0373961_0111212 3300035241 Bacteria 898
217 Ga0373931_0057605 3300035691 Bacteria 2084
218 Ga0439465_0007905 3300041413 Bacteria 3370
219 Ga0451837_0420099 3300041494 Bacteria 548
220 Ga0451841_0428880 3300041498 Bacteria 795
221 Ga0451847_0318935 3300041503 Bacteria 956
222 Ga0451843_0410612 3300041509 Bacteria 697
223 Ga0451843_0463287 3300041509 Bacteria 615
224 Ga0451843_0757207 3300041509 Bacteria 1205
225 Ga0439449_0030798 3300042007 Bacteria 2000
226 Ga0451577_0353679 3300042876 Bacteria 1333
227 Ga0451576_0047407 3300045051 Bacteria 4518
228 Ga0495592_0034018 3300046454 Bacteria 3844
229 Ga0495638_0000689 3300046460 Bacteria 36627
230 Ga0495638_0153509 3300046460 Bacteria 1334
231 Ga0495650_0000940 3300046471 Bacteria 33781
232 Ga0495662_0063759 3300046476 Bacteria 1780
233 Ga0495596_0010460 3300046500 Bacteria 4040
234 Ga0495606_0002051 3300046507 Bacteria 24670
235 Ga0495610_0003757 3300046512 Bacteria 11619
236 Ga0495610_0080666 3300046512 Bacteria 1495
237 Ga0495618_0182039 3300046514 Bacteria 1335
238 Ga0495620_0013468 3300046515 Bacteria 4185
239 Ga0495620_0045741 3300046515 Bacteria 1893
240 Ga0495643_0022188 3300046522 Bacteria 3626
241 Ga0495648_0068725 3300046524 Bacteria 2065
242 Ga0495663_0006231 3300046525 Bacteria 3293
243 Ga0495652_0972384 3300046529 Bacteria 557
244 Ga0495587_0128055 3300046536 Bacteria 1452
245 Ga0495622_0007522 3300046557 Bacteria 5054
246 Ga0495622_0057828 3300046557 Bacteria 1797
247 Ga0495656_0169940 3300046615 Bacteria 1065
248 Ga0495634_0267236 3300046642 Bacteria 1042
249 Ga0495625_0036682 3300046660 Bacteria 3601
250 Ga0495625_0066597 3300046660 Bacteria 2537
251 Ga0495625_0206985 3300046660 Bacteria 1291
252 Ga0495661_0284590 3300046665 Bacteria 832
253 Ga0495588_0104355 3300046674 Bacteria 1491
254 Ga0495658_0103822 3300046683 Bacteria 1700
255 Ga0495671_0562483 3300046692 Bacteria 543
256 Ga0495589_0072219 3300046794 Bacteria 1686
257 Ga0495604_0035539 3300047317 Bacteria 3935
258 Ga0495674_0431247 3300047319 Bacteria 1061
259 Ga0495687_025702 3300047443 Bacteria 2779
260 Ga0495681_0000065 3300047470 Bacteria 97979
261 Ga0495686_0000278 3300047472 Bacteria 90520
262 Ga0495686_0000647 3300047472 Bacteria 47618
263 Ga0495686_0521529 3300047472 Bacteria 623
264 Ga0495615_0000413 3300048090 Bacteria 6394
265 Ga0495626_0005764 3300048091 Bacteria 7145
266 Ga0496100_0195638 3300048903 Bacteria 1470
267 Ga0496100_0641783 3300048903 Bacteria 826
268 Ga0496100_1116503 3300048903 Bacteria 621
269 Ga0496101_0583881 3300048904 Bacteria 883
270 Ga0496102_0000366 3300048905 Bacteria 54318
271 Ga0496102_0859035 3300048905 Bacteria 829
272 Ga0496102_0912597 3300048905 Bacteria 800
273 Ga0496103_0000327 3300048906 Bacteria 43493
274 Ga0496103_0107728 3300048906 Bacteria 1768
275 Ga0496104_0000165 3300048907 Bacteria 58816
276 Ga0496104_0031550 3300048907 Bacteria 4928
277 Ga0496104_1001145 3300048907 Bacteria 740
278 Ga0496105_0000367 3300048908 Bacteria 29969
279 Ga0496105_0030703 3300048908 Bacteria 4403
280 Ga0496106_1238842 3300048909 Bacteria 581
281 Ga0496107_0069857 3300048910 Bacteria 2550
282 Ga0496107_0415734 3300048910 Bacteria 1000
283 Ga0496110_0153324 3300048913 Bacteria 2087
284 Ga0496110_0179441 3300048913 Bacteria 1922
285 Ga0496111_0499228 3300048914 Bacteria 896
286 Ga0496111_1219818 3300048914 Bacteria 532
287 Ga0496113_0009051 3300048916 Bacteria 6522
288 Ga0496115_0224502 3300048918 Bacteria 1550
289 Ga0496116_0000279 3300048919 Bacteria 88014
290 Ga0496116_0040934 3300048919 Bacteria 3185
291 Ga0496116_0130523 3300048919 Bacteria 1433
292 Ga0496117_0002194 3300048920 Bacteria 25418
293 Ga0496117_0030343 3300048920 Bacteria 4151
294 Ga0496117_0266031 3300048920 Bacteria 926
295 Ga0496118_0020227 3300048921 Bacteria 5910
296 Ga0496118_0066658 3300048921 Bacteria 2627
297 Ga0496118_0083737 3300048921 Bacteria 2228
298 Ga0496119_0000121 3300048922 Bacteria 109164
299 Ga0496119_0104656 3300048922 Bacteria 1582
300 Ga0496119_0284825 3300048922 Bacteria 820
301 Ga0496120_0001531 3300048923 Bacteria 27170
302 Ga0496120_0072050 3300048923 Bacteria 1895
303 Ga0496121_0005909 3300048924 Bacteria 15486
304 Ga0496121_0010537 3300048924 Bacteria 10402
305 Ga0496121_0032097 3300048924 Bacteria 4781
306 Ga0496121_0092362 3300048924 Bacteria 2359
307 Ga0496122_0000025 3300048925 Bacteria 362915
308 Ga0496122_0011368 3300048925 Bacteria 9023
309 Ga0496122_0012285 3300048925 Bacteria 8555
310 Ga0496122_0063360 3300048925 Bacteria 2698
311 Ga0496123_0000032 3300048926 Bacteria 285282
312 Ga0496123_0001685 3300048926 Bacteria 29584
313 Ga0496123_0004882 3300048926 Bacteria 13782
314 Ga0496123_0028428 3300048926 Bacteria 4139
315 Ga0496123_0392034 3300048926 Bacteria 634
316 Ga0496124_0002309 3300048927 Bacteria 25181
317 Ga0496124_0009128 3300048927 Bacteria 10244
318 Ga0496124_0036318 3300048927 Bacteria 4299
319 Ga0496124_0045605 3300048927 Bacteria 3757
320 Ga0496124_0068504 3300048927 Bacteria 2949
321 Ga0496124_0431422 3300048927 Bacteria 905
322 Ga0496124_0438535 3300048927 Bacteria 894
323 Ga0496124_0465683 3300048927 Bacteria 857
324 Ga0496125_0009752 3300048928 Bacteria 9802
325 Ga0496125_0043484 3300048928 Bacteria 3811
326 Ga0496125_0043949 3300048928 Bacteria 3785
327 Ga0496125_0051049 3300048928 Bacteria 3415
328 Ga0496125_0090944 3300048928 Bacteria 2288
329 Ga0496125_0332640 3300048928 Bacteria 915
330 Ga0496126_0000045 3300048929 Bacteria 331225
331 Ga0496126_0004185 3300048929 Bacteria 17394
332 Ga0496126_0035948 3300048929 Bacteria 4637
333 Ga0496126_0080052 3300048929 Bacteria 2891
334 Ga0496126_0101856 3300048929 Bacteria 2511
335 Ga0501074_1059056 3300049590 Bacteria 570
336 Ga0501249_064626 3300049679 Bacteria 850
337 Ga0501083_0147462 3300049744 Bacteria 1541
338 Ga0501035_0781153 3300049822 Bacteria 764
339 Ga0501035_0987178 3300049822 Bacteria 663
340 Ga0501044_1216701 3300049823 Bacteria 621
341 nmdc:mga03683_19013_c1 3300050489 Bacteria 2619
342 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
343 nmdc:mga03n38_39246_c1 3300050490 Bacteria 2053
344 nmdc:mga03n38_492_c1 3300050490 Bacteria 9914
345 nmdc:mga00v17_4737_c1 3300050491 Bacteria 7113
346 nmdc:mga00v17_507263_c1 3300050491 Bacteria 782
347 nmdc:mga00v17_520_c1 3300050491 Bacteria 3326
348 nmdc:mga00v17_648598_c1 3300050491 Bacteria 679
349 nmdc:mga0yw44_61554_c1 3300050492 Bacteria 2304
350 nmdc:mga0k408_20_c1 3300050493 Bacteria 109563
351 nmdc:mga0k408_26764_c1 3300050493 Bacteria 3272
352 nmdc:mga0k408_276969_c1 3300050493 Bacteria 1001
353 nmdc:mga06z11_4365_c1 3300050494 Bacteria 5563
354 nmdc:mga04h51_668_c1 3300050495 Bacteria 7969
355 nmdc:mga07m45_1320_c1 3300050496 Bacteria 11302
356 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
357 nmdc:mga07m45_231255_c1 3300050496 Bacteria 1076
358 nmdc:mga07m45_3430_c2 3300050496 Bacteria 6304
359 nmdc:mga05p37_1130407_c1 3300050507 Bacteria 817
360 nmdc:mga0qj67_230129_c1 3300050509 Bacteria 1504
361 nmdc:mga06r32_477016_c1 3300050510 Bacteria 1226
362 nmdc:mga08y16_1376029_c1 3300050511 Bacteria 670
363 nmdc:mga0rr50_925726_c1 3300050513 Bacteria 743
364 nmdc:mga0sz30_24125_c1 3300050516 Bacteria 2480
365 nmdc:mga0sz30_345_c1 3300050516 Bacteria 17739
366 nmdc:mga0sz30_55_c1 3300050516 Bacteria 42452
367 Ga0500643_020099 3300053087 Bacteria 2189
368 Ga0500643_048101 3300053087 Bacteria 1227
369 Ga0500651_0058818 3300053093 Bacteria 2404
370 Ga0500566_0029914 3300053094 Bacteria 3179
371 Ga0500562_092714 3300053108 Bacteria 820
372 Ga0500592_027365 3300053116 Bacteria 920
373 Ga0500595_026765 3300053119 Bacteria 1984
374 Ga0500607_000001 3300053121 Bacteria 185408
375 Ga0500607_000791 3300053121 Bacteria 30544
376 Ga0500608_067584 3300053122 Bacteria 1703
377 Ga0500618_002002 3300053125 Bacteria 8293
378 Ga0500658_0003753 3300053134 Bacteria 5721
379 Ga0500559_0001383 3300053136 Bacteria 13830
380 Ga0500559_0002439 3300053136 Bacteria 9628
381 Ga0500559_0009522 3300053136 Bacteria 4198
382 Ga0500568_0042719 3300053139 Bacteria 1815
383 Ga0500577_0055418 3300053142 Bacteria 1505
384 Ga0500590_053857 3300053148 Bacteria 2038
385 Ga0500616_0074651 3300053153 Bacteria 1719
386 Ga0500616_0218838 3300053153 Bacteria 832
387 Ga0500636_0062572 3300053177 Bacteria 2170
388 Ga0500636_0103145 3300053177 Bacteria 1619
389 Ga0500637_0003151 3300053178 Bacteria 7540
390 Ga0500645_003318 3300053730 Bacteria 6607
391 Ga0500645_005693 3300053730 Bacteria 4548
392 2511135051 2510917022 Bacteria 6504556
393 2511182335 2510917028 Bacteria 6185411
394 2511388339 2511231027 Bacteria 5013807
395 2513594523 2513237088 Bacteria 6927906
396 2513864581 2513237138 Bacteria 7368160
397 2513913089 2513237144 Bacteria 7530820
398 2513926308 2513237146 Bacteria 7166346
399 2524460339 2524023209 Bacteria 6679728
400 2535516436 2534681796 Bacteria 7146037
401 2585200102 2582581294 Bacteria 6626667
402 2585270791 2582581307 Bacteria 6597605
403 2585401949 2582581867 Bacteria 7184437
404 2585558514 2585427531 Bacteria 6992870
405 2585821734 2585427590 Bacteria 6824633
406 2585897880 2585427608 Bacteria 6544331
407 2585904516 2585427609 Bacteria 6667127
408 2587980368 2585428125 Bacteria 6662905
409 2599417786 2599185170 Bacteria 7295545
410 2617385109 2617270742 Bacteria 6808054
411 2644000344 2643221598 Bacteria 4578346
412 2644192835 2643221634 Bacteria 6705461
413 2644239520 2643221643 Bacteria 5749658
414 2738711985 2738541275 Bacteria 4830863
415 2738850410 2738541301 Bacteria 4834102
416 2738866139 2738541304 Bacteria 4833665
417 2739298657 2738543022 Bacteria 4835059
418 2739360335 2738543033 Bacteria 4833336
419 2753763346 2751185897 Bacteria 5322941
420 2765465475 2765235802 Bacteria 5618596
421 2770199433 2767802442 Bacteria 5747986
422 2776271626 2775506902 Bacteria 6208009
423 2776279861 2775506904 Bacteria 5954060
424 2819554937 2818991438 Bacteria 5793701
425 2838037997 2838035591 Bacteria 7166484
426 2838667292 2838661181 Bacteria 7385261
427 2840767966 2840764183 Bacteria 6358399
428 2842302105 2842298080 Bacteria 6123127
429 2842357428 2842357229 Bacteria 6485165
430 2842872960 2842871566 Bacteria 4827117
431 2861693499 2861691609 Bacteria 5628931
432 2894656517 2894652903 Bacteria 4587256
433 2904581613 2904578770 Bacteria 5302906
434 2919122849 2919119836 Bacteria 5208557
435 2919138969 2919138771 Bacteria 5281312
436 2923557867 2923556063 Bacteria 6793593
437 2928103530 2928100450 Bacteria 4837635
438 2928962927 2928959182 Bacteria 4725774
439 2954015315 2954011201 Bacteria 4762601
440 2996891638 2996887358 Bacteria 5795980
441 3002144070 3002141150 Bacteria 5254435
442 3005454157 3005452660 Bacteria 5889319
443 8005262968 8005258706 Bacteria 6184835
444 8005326165 8005321885 Bacteria 5795980
445 8005545084 8005542996 Bacteria 7077758
446 8024492319 8024486573 Bacteria 6540512
447 Ga0495609_0094333
448 SwRhRL2b_contig_2381925
449 SwRhRL2b_contig_3552468
450 JGI24034J26672_10008683
451 JGI24751J29686_10013033
452 JGI25151J46595_10118927
453 JGI25160J50197_1006993
454 Ga0055526_1019192
455 Ga0055524_1004417
456 Ga0055528_1044494
457 Ga0055528_1078279
458 Ga0055530_10032027
459 Ga0065165_1008282
460 Ga0065704_10070189
461 Ga0065704_10070386
462 Ga0065707_10162130
463 Ga0065707_10486321
464 Ga0070658_10000416
465 Ga0070670_100022367
466 Ga0070670_100039868
467 Ga0070668_100003250
468 Ga0070668_100008247
469 Ga0070668_100499467
470 Ga0070669_100000149
471 Ga0070669_100000646
472 Ga0070669_100072410
473 Ga0070669_101211535
474 Ga0070669_101310815
475 Ga0070671_100001725
476 Ga0070671_100005996
477 Ga0070671_100029081
478 Ga0070667_100000715
479 Ga0070667_100467018
480 Ga0070667_100631679
481 Ga0070709_10928814
482 Ga0070705_101327548
483 Ga0070663_100215374
484 Ga0070707_100330946
485 Ga0070665_100000079
486 Ga0070665_100351568
487 Ga0068855_100000459
488 Ga0068855_100015660
489 Ga0068854_100176949
490 Ga0068856_100013737
491 Ga0068852_100000113
492 Ga0068859_100931730
493 Ga0068864_100001043
494 Ga0068864_100829263
495 Ga0068863_100013608
496 Ga0068863_100087772
497 Ga0068863_100189721
498 Ga0068858_100000997
499 Ga0068858_100124871
500 Ga0068860_100011925
501 Ga0068860_100041246
502 Ga0068860_100050458
503 Ga0068860_100076475
504 Ga0068860_100110425
505 Ga0068862_100002804
506 Ga0068862_100010619
507 Ga0068862_100048031
508 Ga0081540_1043369
509 Ga0075365_10011778
510 Ga0075365_10173648
511 Ga0075368_10000064
512 Ga0075363_100000276
513 Ga0075363_100006250
514 Ga0075364_10005248
515 Ga0075364_10114471
516 Ga0075364_10226017
517 Ga0075364_10383427
518 Ga0075362_10000006
519 Ga0075362_10015292
520 Ga0075362_10344399
521 Ga0075367_10010744
522 Ga0075367_10189835
523 Ga0075369_10000161
524 Ga0075369_10001555
525 Ga0075369_10001674
526 Ga0075369_10024992
527 Ga0075366_10000277
528 Ga0075366_10015009
529 Ga0075366_10157223
530 Ga0075366_10491072
531 Ga0075370_10000005
532 Ga0075370_10029473
533 Ga0075370_10065088
534 Ga0075370_10104286
535 Ga0075430_100064177
536 Ga0075431_100072639
537 Ga0097620_100931726
538 Ga0079104_1082679
539 Ga0105251_10019524
540 Ga0105251_10023231
541 Ga0105251_10060461
542 Ga0105250_10358350
543 Ga0105240_10023078
544 Ga0111539_10966793
545 Ga0105247_10045172
546 Ga0105247_10052587
547 Ga0105247_10295351
548 Ga0114129_10314330
549 Ga0105248_10011441
550 Ga0105248_10013763
551 Ga0105248_10803872
552 Ga0105248_11658980
553 Ga0105237_10352323
554 Ga0105238_10065632
555 Ga0105238_10763169
556 Ga0105249_10248153
557 Ga0105249_10845220
558 Ga0105249_11233176
559 Ga0123340_1085289
560 Ga0123340_1085949
561 Ga0123341_1104123
562 Ga0123342_1008981
563 Ga0157373_10359889
564 Ga0163162_10040426
565 Ga0163162_10456084
566 Ga0163162_10873131
567 Ga0163162_10974372
568 Ga0163161_10001166
569 Ga0209129_1002406
570 Ga0209673_1010143
571 Ga0209673_1038769
572 Ga0209130_1018238
573 Ga0209025_1020784
574 Ga0209025_1021088
575 Ga0209564_1008790
576 Ga0209564_1012098
577 Ga0209758_1043891
578 Ga0209050_1002953
579 Ga0209256_1004849
580 Ga0209256_1028997
581 Ga0207426_1001225
582 Ga0207426_1087726
583 Ga0209051_1003735
584 Ga0207696_1010898
585 Ga0207696_1042816
586 Ga0207713_1005215
587 Ga0207713_1036251
588 Ga0207713_1228068
589 Ga0207710_10166471
590 Ga0207680_10150644
591 Ga0207647_10007723
592 Ga0207705_10000007
593 Ga0207695_10050052
594 Ga0207681_10000081
595 Ga0207681_10000274
596 Ga0207681_11069137
597 Ga0207694_10187724
598 Ga0207694_10836054
599 Ga0207694_11179845
600 Ga0207650_10014316
601 Ga0207644_10000505
602 Ga0207644_10003826
603 Ga0207644_10158465
604 Ga0207691_10925081
605 Ga0207711_10004144
606 Ga0207711_10684943
607 Ga0207711_11514609
608 Ga0207667_10093975
609 Ga0207712_10088843
610 Ga0207712_10600378
611 Ga0207668_10003418
612 Ga0207668_10062109
613 Ga0207668_10214172
614 Ga0207640_10000661
615 Ga0207658_10000274
616 Ga0207658_10012960
617 Ga0207658_10206473
618 Ga0207658_10420805
619 Ga0207658_10549261
620 Ga0207703_10000797
621 Ga0207703_10448208
622 Ga0207702_10005286
623 Ga0207641_10013512
624 Ga0207641_10450288
625 Ga0207676_10024436
626 Ga0207676_11032240
627 Ga0207698_10000036
628 Ga0209371_1016976
629 Ga0268266_10000175
630 Ga0268266_10001903
631 Ga0268266_10089631
632 Ga0268265_10796903
633 Ga0268264_10002514
634 Ga0268264_10008184
635 Ga0268264_10031070
636 Ga0268264_10046516
637 Ga0268264_10391076
638 Ga0268256_1018883
639 Ga0265320_10052736
640 Ga0265320_10106896
641 Ga0265325_10003207
642 Ga0265325_10085707
643 Ga0265340_10008072
644 Ga0265340_10024808
645 Ga0265339_10079434
646 Ga0265339_10083964
647 Ga0265327_10086178
648 Ga0265316_10014663
649 Ga0265316_10282753
650 Ga0307513_10388176
651 Ga0265313_10009082
652 Ga0265313_10016847
653 Ga0265313_10059911
654 Ga0265314_10041391
655 Ga0265342_10112116
656 Ga0307516_10612699
657 Ga0307405_10058784
658 Ga0307413_10253460
659 Ga0307407_10288436
660 Ga0307412_10028432
661 Ga0307414_12012134
662 Ga0373961_0111212
663 Ga0373931_0057605
664 Ga0439465_0007905
665 Ga0451837_0420099
666 Ga0451841_0428880
667 Ga0451847_0318935
668 Ga0451843_0410612
669 Ga0451843_0463287
670 Ga0451843_0757207
671 Ga0439449_0030798
672 Ga0451577_0353679
673 Ga0451576_0047407
674 Ga0495592_0034018
675 Ga0495638_0000689
676 Ga0495638_0153509
677 Ga0495650_0000940
678 Ga0495662_0063759
679 Ga0495596_0010460
680 Ga0495606_0002051
681 Ga0495610_0003757
682 Ga0495610_0080666
683 Ga0495618_0182039
684 Ga0495620_0013468
685 Ga0495620_0045741
686 Ga0495643_0022188
687 Ga0495648_0068725
688 Ga0495663_0006231
689 Ga0495652_0972384
690 Ga0495587_0128055
691 Ga0495622_0007522
692 Ga0495622_0057828
693 Ga0495656_0169940
694 Ga0495634_0267236
695 Ga0495625_0036682
696 Ga0495625_0066597
697 Ga0495625_0206985
698 Ga0495661_0284590
699 Ga0495588_0104355
700 Ga0495658_0103822
701 Ga0495671_0562483
702 Ga0495589_0072219
703 Ga0495604_0035539
704 Ga0495674_0431247
705 Ga0495687_025702
706 Ga0495681_0000065
707 Ga0495686_0000278
708 Ga0495686_0000647
709 Ga0495686_0521529
710 Ga0495615_0000413
711 Ga0495626_0005764
712 Ga0496100_0195638
713 Ga0496100_0641783
714 Ga0496100_1116503
715 Ga0496101_0583881
716 Ga0496102_0000366
717 Ga0496102_0859035
718 Ga0496102_0912597
719 Ga0496103_0000327
720 Ga0496103_0107728
721 Ga0496104_0000165
722 Ga0496104_0031550
723 Ga0496104_1001145
724 Ga0496105_0000367
725 Ga0496105_0030703
726 Ga0496106_1238842
727 Ga0496107_0069857
728 Ga0496107_0415734
729 Ga0496110_0153324
730 Ga0496110_0179441
731 Ga0496111_0499228
732 Ga0496111_1219818
733 Ga0496113_0009051
734 Ga0496115_0224502
735 Ga0496116_0000279
736 Ga0496116_0040934
737 Ga0496116_0130523
738 Ga0496117_0002194
739 Ga0496117_0030343
740 Ga0496117_0266031
741 Ga0496118_0020227
742 Ga0496118_0066658
743 Ga0496118_0083737
744 Ga0496119_0000121
745 Ga0496119_0104656
746 Ga0496119_0284825
747 Ga0496120_0001531
748 Ga0496120_0072050
749 Ga0496121_0005909
750 Ga0496121_0010537
751 Ga0496121_0032097
752 Ga0496121_0092362
753 Ga0496122_0000025
754 Ga0496122_0011368
755 Ga0496122_0012285
756 Ga0496122_0063360
757 Ga0496123_0000032
758 Ga0496123_0001685
759 Ga0496123_0004882
760 Ga0496123_0028428
761 Ga0496123_0392034
762 Ga0496124_0002309
763 Ga0496124_0009128
764 Ga0496124_0036318
765 Ga0496124_0045605
766 Ga0496124_0068504
767 Ga0496124_0431422
768 Ga0496124_0438535
769 Ga0496124_0465683
770 Ga0496125_0009752
771 Ga0496125_0043484
772 Ga0496125_0043949
773 Ga0496125_0051049
774 Ga0496125_0090944
775 Ga0496125_0332640
776 Ga0496126_0000045
777 Ga0496126_0004185
778 Ga0496126_0035948
779 Ga0496126_0080052
780 Ga0496126_0101856
781 Ga0501074_1059056
782 Ga0501249_064626
783 Ga0501083_0147462
784 Ga0501035_0781153
785 Ga0501035_0987178
786 Ga0501044_1216701
787 nmdc:mga03683_19013_c1
788 nmdc:mga03683_3_c1
789 nmdc:mga03n38_39246_c1
790 nmdc:mga03n38_492_c1
791 nmdc:mga00v17_4737_c1
792 nmdc:mga00v17_507263_c1
793 nmdc:mga00v17_520_c1
794 nmdc:mga00v17_648598_c1
795 nmdc:mga0yw44_61554_c1
796 nmdc:mga0k408_20_c1
797 nmdc:mga0k408_26764_c1
798 nmdc:mga0k408_276969_c1
799 nmdc:mga06z11_4365_c1
800 nmdc:mga04h51_668_c1
801 nmdc:mga07m45_1320_c1
802 nmdc:mga07m45_1_c1
803 nmdc:mga07m45_231255_c1
804 nmdc:mga07m45_3430_c2
805 nmdc:mga05p37_1130407_c1
806 nmdc:mga0qj67_230129_c1
807 nmdc:mga06r32_477016_c1
808 nmdc:mga08y16_1376029_c1
809 nmdc:mga0rr50_925726_c1
810 nmdc:mga0sz30_24125_c1
811 nmdc:mga0sz30_345_c1
812 nmdc:mga0sz30_55_c1
813 Ga0500643_020099
814 Ga0500643_048101
815 Ga0500651_0058818
816 Ga0500566_0029914
817 Ga0500562_092714
818 Ga0500592_027365
819 Ga0500595_026765
820 Ga0500607_000001
821 Ga0500607_000791
822 Ga0500608_067584
823 Ga0500618_002002
824 Ga0500658_0003753
825 Ga0500559_0001383
826 Ga0500559_0002439
827 Ga0500559_0009522
828 Ga0500568_0042719
829 Ga0500577_0055418
830 Ga0500590_053857
831 Ga0500616_0074651
832 Ga0500616_0218838
833 Ga0500636_0062572
834 Ga0500636_0103145
835 Ga0500637_0003151
836 Ga0500645_003318
837 Ga0500645_005693
838 2511135051
839 2511182335
840 2511388339
841 2513594523
842 2513864581
843 2513913089
844 2513926308
845 2524460339
846 2535516436
847 2585200102
848 2585270791
849 2585401949
850 2585558514
851 2585821734
852 2585897880
853 2585904516
854 2587980368
855 2599417786
856 2617385109
857 2644000344
858 2644192835
859 2644239520
860 2738711985
861 2738850410
862 2738866139
863 2739298657
864 2739360335
865 2753763346
866 2765465475
867 2770199433
868 2776271626
869 2776279861
870 2819554937
871 2838037997
872 2838667292
873 2840767966
874 2842302105
875 2842357428
876 2842872960
877 2861693499
878 2894656517
879 2904581613
880 2919122849
881 2919138969
882 2923557867
883 2928103530
884 2928962927
885 2954015315
886 2996891638
887 3002144070
888 3005454157
889 8005262968
890 8005326165
891 8005545084
892 8024492319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

28

157

0.99

PF08534

Redoxin

Redoxin

27

172

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9404 3 157
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9345 3 157
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9331 5 156
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9271 7 156
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9249 7 156
ID Description Score Start End Superfamily
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9657 6 154 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9532 6 154 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9487 7 156 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9299 7 156 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9289 6 153 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6I4TE79-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 1 3 157 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A6I4TE79-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9873 3 157 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A0D5LXN2-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9849 5 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A520D8T8-F1-model_v4 deleted 0.9846 34 156
AF-A0A0Q8R128-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9835 6 157 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map