F445800

General Info

Members Datasets Scaffolds Average Seq Length
446 292 438 240

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0185484|Ga0495680_0185484_168_965
Length 265
Sequence MRWTISFARKEQVFDQTNYLKGEIDVSLPNVKAFVFDVFGTVVDWRGGVAREAAPFLQRFGAAGAQPEAFADAWRRRYVPAMRKIISGERPFVRLDVLHRENLIDALPEFGIDPNPVPPEVLDELNLAWHRLDPWPDSIPGLQRLKARHIIAPLSNGNIRLMVDMAKRAGLPWDAILGAEIAQIYKPDPQAYLRTADVLMLAPEEVCLVAAHNDDLAAARKCGLRTAFVARPYERGPAQTVDLKAASDWDISARDMIELADAVGA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
3 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
4 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
5 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
7 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
8 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
9 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
268 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 1.12
Nodule 0.9
Rhizoplane 6.95
Rhizosphere 85.43
Stem 0
Stem Tuber 0
Unclassified 5.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12358085 2162886012 Bacteria 1080
2 JGI24735J21928_10001088 3300002067 Bacteria 9713
3 Ga0065707_10098321 3300005295 Unclassified 3093
4 Ga0065707_10116884 3300005295 Bacteria 2225
5 Ga0070676_10271681 3300005328 Bacteria 1139
6 Ga0070683_100004329 3300005329 Bacteria 11672
7 Ga0070690_100002610 3300005330 Bacteria 9708
8 Ga0070690_100238039 3300005330 Bacteria 1283
9 Ga0068869_100156818 3300005334 Bacteria 1769
10 Ga0070666_10002429 3300005335 Bacteria 11261
11 Ga0070680_100012000 3300005336 Bacteria 6722
12 Ga0070680_100052022 3300005336 Bacteria 3343
13 Ga0068868_100002556 3300005338 Bacteria 12651
14 Ga0068868_100353627 3300005338 Bacteria 1259
15 Ga0070689_100052709 3300005340 Bacteria 3147
16 Ga0070661_100013622 3300005344 Bacteria 5710
17 Ga0070692_10005697 3300005345 Bacteria 5346
18 Ga0070675_100944462 3300005354 Bacteria 791
19 Ga0070671_100355638 3300005355 Bacteria 1250
20 Ga0070674_100022508 3300005356 Bacteria 4066
21 Ga0070674_100281005 3300005356 Bacteria 1319
22 Ga0070673_100000088 3300005364 Bacteria 39833
23 Ga0070688_100001429 3300005365 Bacteria 11887
24 Ga0070659_100018703 3300005366 Bacteria 5230
25 Ga0070667_100013844 3300005367 Bacteria 6668
26 Ga0070667_100184531 3300005367 Bacteria 1846
27 Ga0070709_10016610 3300005434 Bacteria 4205
28 Ga0070709_10076461 3300005434 Bacteria 2174
29 Ga0070714_100002535 3300005435 Bacteria 13462
30 Ga0070713_100000296 3300005436 Bacteria 32917
31 Ga0070713_100001145 3300005436 Bacteria 16990
32 Ga0070713_100029776 3300005436 Bacteria 4327
33 Ga0070701_10230548 3300005438 Bacteria 1109
34 Ga0070711_100149700 3300005439 Bacteria 1759
35 Ga0070705_100077836 3300005440 Bacteria 2026
36 Ga0070694_100010716 3300005444 Bacteria 5667
37 Ga0070708_100028996 3300005445 Bacteria 4768
38 Ga0070663_100070742 3300005455 Bacteria 2538
39 Ga0070678_100005633 3300005456 Bacteria 7269
40 Ga0070678_100168342 3300005456 Bacteria 1782
41 Ga0070662_100014312 3300005457 Bacteria 5297
42 Ga0070662_100117578 3300005457 Bacteria 2033
43 Ga0068867_100173374 3300005459 Bacteria 1710
44 Ga0070685_10001545 3300005466 Bacteria 12142
45 Ga0070706_100010400 3300005467 Bacteria 8641
46 Ga0070698_100268472 3300005471 Bacteria 1638
47 Ga0070698_100481390 3300005471 Bacteria 1178
48 Ga0070679_100071741 3300005530 Bacteria 3454
49 Ga0070679_100168886 3300005530 Bacteria 2160
50 Ga0070697_100497082 3300005536 Bacteria 1066
51 Ga0068853_100474291 3300005539 Bacteria 1179
52 Ga0070672_100150964 3300005543 Bacteria 1922
53 Ga0070686_100203610 3300005544 Bacteria 1420
54 Ga0070695_100058718 3300005545 Bacteria 2488
55 Ga0070695_100194327 3300005545 Bacteria 1446
56 Ga0070696_100021368 3300005546 Bacteria 4387
57 Ga0070696_100318600 3300005546 Bacteria 1196
58 Ga0070693_100005035 3300005547 Bacteria 6312
59 Ga0070665_100031078 3300005548 Bacteria 5374
60 Ga0070704_100014733 3300005549 Bacteria 4889
61 Ga0070664_100031992 3300005564 Bacteria 4400
62 Ga0070664_100289349 3300005564 Bacteria 1479
63 Ga0068854_100006640 3300005578 Bacteria 7371
64 Ga0068854_100023193 3300005578 Bacteria 4237
65 Ga0068856_100398105 3300005614 Bacteria 1397
66 Ga0070702_100030390 3300005615 Bacteria 2945
67 Ga0070702_100193666 3300005615 Bacteria 1340
68 Ga0068852_100025599 3300005616 Bacteria 4783
69 Ga0068852_100114952 3300005616 Bacteria 2453
70 Ga0068859_100005369 3300005617 Bacteria 13040
71 Ga0068864_100001261 3300005618 Bacteria 21054
72 Ga0068851_10021445 3300005834 Bacteria 3137
73 Ga0068870_10219295 3300005840 Bacteria 1163
74 Ga0068863_100001485 3300005841 Bacteria 23250
75 Ga0068858_100363611 3300005842 Bacteria 1387
76 Ga0068860_100388978 3300005843 Bacteria 1378
77 Ga0081455_10000513 3300005937 Bacteria 50176
78 Ga0081455_10007726 3300005937 Bacteria 11281
79 Ga0081455_10049799 3300005937 Bacteria 3609
80 Ga0081540_1039781 3300005983 Bacteria 2461
81 Ga0070717_10050589 3300006028 Unclassified 3416
82 Ga0070717_10367160 3300006028 Bacteria 1289
83 Ga0070717_10579891 3300006028 Bacteria 1017
84 Ga0075365_10052005 3300006038 Bacteria 2707
85 Ga0070715_10007390 3300006163 Bacteria 3782
86 Ga0070712_100274489 3300006175 Unclassified 1356
87 Ga0097621_100050630 3300006237 Bacteria 3378
88 Ga0097621_100317805 3300006237 Bacteria 1378
89 Ga0068871_100018012 3300006358 Bacteria 5359
90 Ga0068871_100314008 3300006358 Bacteria 1378
91 Ga0075428_100122259 3300006844 Bacteria 2834
92 Ga0075428_100196170 3300006844 Unclassified 2183
93 Ga0075430_100231847 3300006846 Bacteria 1531
94 Ga0075431_100178136 3300006847 Bacteria 2182
95 Ga0075431_100360897 3300006847 Bacteria 1459
96 Ga0075433_10009627 3300006852 Bacteria 7734
97 Ga0075433_10048795 3300006852 Bacteria 3682
98 Ga0075434_100046468 3300006871 Bacteria 4308
99 Ga0075429_100394104 3300006880 Bacteria 1212
100 Ga0075436_100017751 3300006914 Bacteria 4872
101 Ga0075436_100130107 3300006914 Bacteria 1765
102 Ga0075436_100443921 3300006914 Bacteria 944
103 Ga0097620_100005369 3300006931 Bacteria 13040
104 Ga0075435_100002040 3300007076 Bacteria 13228
105 Ga0099794_10007154 3300007265 Bacteria 4565
106 Ga0105251_10000195 3300009011 Bacteria 61183
107 Ga0105244_10012952 3300009036 Bacteria 4906
108 Ga0105240_10001449 3300009093 Bacteria 40535
109 Ga0105240_10056095 3300009093 Bacteria 4930
110 Ga0105240_10420218 3300009093 Bacteria 1502
111 Ga0105245_10006192 3300009098 Bacteria 10530
112 Ga0105245_10012365 3300009098 Bacteria 7427
113 Ga0105245_10204482 3300009098 Bacteria 1898
114 Ga0105247_10594149 3300009101 Bacteria 820
115 Ga0114129_10007096 3300009147 Bacteria 15943
116 Ga0114129_10032104 3300009147 Bacteria 7423
117 Ga0114129_10036806 3300009147 Bacteria 6910
118 Ga0114129_10401733 3300009147 Unclassified 1806
119 Ga0114129_10682360 3300009147 Bacteria 1322
120 Ga0105241_10046734 3300009174 Bacteria 3288
121 Ga0105241_10479615 3300009174 Bacteria 1105
122 Ga0105242_10005171 3300009176 Bacteria 10070
123 Ga0105242_10882565 3300009176 Unclassified 893
124 Ga0105248_10018063 3300009177 Bacteria 7785
125 Ga0105248_10129851 3300009177 Bacteria 2843
126 Ga0105237_10000882 3300009545 Bacteria 40534
127 Ga0105238_10007420 3300009551 Bacteria 10984
128 Ga0105238_10013701 3300009551 Bacteria 8190
129 Ga0105238_10030805 3300009551 Bacteria 5459
130 Ga0105238_10281629 3300009551 Bacteria 1644
131 Ga0099796_10005442 3300010159 Bacteria 3178
132 Ga0105239_10003438 3300010375 Bacteria 19385
133 Ga0105239_10387834 3300010375 Bacteria 1580
134 Ga0105246_10021584 3300011119 Bacteria 4145
135 Ga0157373_10288060 3300013100 Bacteria 1165
136 Ga0157371_10067275 3300013102 Bacteria 2536
137 Ga0157370_10018954 3300013104 Bacteria 6919
138 Ga0157370_10094304 3300013104 Bacteria 2808
139 Ga0157369_10133421 3300013105 Bacteria 2630
140 Ga0157369_10165855 3300013105 Bacteria 2330
141 Ga0157374_10000383 3300013296 Bacteria 40730
142 Ga0157374_10004873 3300013296 Bacteria 11257
143 Ga0157378_10010494 3300013297 Bacteria 8092
144 Ga0157378_10013081 3300013297 Bacteria 7260
145 Ga0157378_10137716 3300013297 Bacteria 2264
146 Ga0163162_10009180 3300013306 Bacteria 9623
147 Ga0163162_10033562 3300013306 Bacteria 5101
148 Ga0163162_10261895 3300013306 Bacteria 1861
149 Ga0163162_10423504 3300013306 Bacteria 1463
150 Ga0157375_10002420 3300013308 Bacteria 16164
151 Ga0157375_10124986 3300013308 Bacteria 2686
152 Ga0163163_10000750 3300014325 Bacteria 27660
153 Ga0163163_10032450 3300014325 Bacteria 5043
154 Ga0157380_10917116 3300014326 Bacteria 903
155 Ga0157377_10022459 3300014745 Bacteria 3331
156 Ga0157379_10002542 3300014968 Bacteria 15302
157 Ga0157376_10003872 3300014969 Bacteria 10345
158 Ga0157376_10048694 3300014969 Bacteria 3507
159 Ga0182005_1000484 3300015265 Bacteria 20497
160 Ga0163161_10122616 3300017792 Bacteria 1954
161 Ga0163161_10204013 3300017792 Bacteria 1525
162 Ga0213874_10001175 3300021377 Bacteria 5376
163 Ga0207426_1002601 3300025302 Bacteria 11206
164 Ga0207680_10059121 3300025903 Bacteria 2327
165 Ga0207647_10012614 3300025904 Bacteria 5876
166 Ga0207643_10092306 3300025908 Bacteria 1766
167 Ga0207684_10220392 3300025910 Bacteria 1637
168 Ga0207654_10024105 3300025911 Bacteria 3267
169 Ga0207707_10044668 3300025912 Bacteria 3862
170 Ga0207695_10066620 3300025913 Bacteria 3697
171 Ga0207695_10687590 3300025913 Bacteria 904
172 Ga0207671_10005638 3300025914 Bacteria 11472
173 Ga0207693_10000254 3300025915 Bacteria 49362
174 Ga0207693_10236957 3300025915 Unclassified 1432
175 Ga0207663_10042304 3300025916 Bacteria 2783
176 Ga0207660_10043990 3300025917 Bacteria 3140
177 Ga0207662_10040983 3300025918 Bacteria 2725
178 Ga0207657_10002586 3300025919 Bacteria 19581
179 Ga0207652_10053829 3300025921 Bacteria 3457
180 Ga0207652_10073540 3300025921 Bacteria 2974
181 Ga0207694_10004425 3300025924 Bacteria 10984
182 Ga0207694_10027743 3300025924 Bacteria 4313
183 Ga0207687_10002262 3300025927 Bacteria 13120
184 Ga0207687_10002498 3300025927 Bacteria 12485
185 Ga0207687_10309304 3300025927 Bacteria 1275
186 Ga0207700_10001192 3300025928 Bacteria 14939
187 Ga0207700_10001526 3300025928 Bacteria 13117
188 Ga0207700_10116815 3300025928 Bacteria 2156
189 Ga0207664_10003410 3300025929 Bacteria 10590
190 Ga0207644_10002966 3300025931 Bacteria 10931
191 Ga0207644_10090462 3300025931 Bacteria 2280
192 Ga0207706_10025205 3300025933 Bacteria 5332
193 Ga0207706_10123508 3300025933 Bacteria 2277
194 Ga0207686_10000302 3300025934 Bacteria 35955
195 Ga0207686_10002361 3300025934 Bacteria 10319
196 Ga0207670_10038932 3300025936 Bacteria 3109
197 Ga0207669_10043859 3300025937 Bacteria 2622
198 Ga0207704_10655900 3300025938 Bacteria 865
199 Ga0207711_10002349 3300025941 Bacteria 16953
200 Ga0207689_10053900 3300025942 Bacteria 3313
201 Ga0207689_10178613 3300025942 Bacteria 1751
202 Ga0207679_10253655 3300025945 Bacteria 1497
203 Ga0207640_10008119 3300025981 Bacteria 5811
204 Ga0207640_10349025 3300025981 Bacteria 1188
205 Ga0207658_10115363 3300025986 Bacteria 2131
206 Ga0207658_10148203 3300025986 Bacteria 1908
207 Ga0207677_10000739 3300026023 Bacteria 18996
208 Ga0207677_10022852 3300026023 Bacteria 3851
209 Ga0207639_10005487 3300026041 Bacteria 8576
210 Ga0207641_10003409 3300026088 Bacteria 14084
211 Ga0207648_10240126 3300026089 Bacteria 1613
212 Ga0207676_10000470 3300026095 Bacteria 33856
213 Ga0207674_10003107 3300026116 Bacteria 20492
214 Ga0207683_10000227 3300026121 Bacteria 49549
215 Ga0207683_10320370 3300026121 Bacteria 1420
216 Ga0207698_10237124 3300026142 Bacteria 1660
217 Ga0209973_1016615 3300027252 Bacteria 939
218 Ga0209967_1003650 3300027364 Bacteria 2029
219 Ga0209984_1003805 3300027424 Bacteria 1747
220 Ga0209968_1015596 3300027526 Bacteria 1203
221 Ga0209982_1012268 3300027552 Bacteria 1284
222 Ga0210002_1003160 3300027617 Bacteria 2420
223 Ga0209971_1008420 3300027682 Bacteria 2446
224 Ga0209966_1008081 3300027695 Bacteria 1859
225 Ga0209998_10010077 3300027717 Bacteria 1957
226 Ga0209974_10017549 3300027876 Bacteria 2373
227 Ga0207428_10252980 3300027907 Bacteria 1313
228 Ga0268264_10020791 3300028381 Bacteria 5364
229 Ga0268264_10148449 3300028381 Bacteria 2099
230 Ga0307408_100072346 3300031548 Bacteria 2552
231 Ga0307405_10024030 3300031731 Bacteria 3475
232 Ga0307406_10034449 3300031901 Bacteria 3106
233 Ga0307416_100032419 3300032002 Bacteria 3947
234 Ga0307510_10027744 3300033180 Bacteria 6480
235 Ga0373926_0056333 3300035083 Bacteria 1426
236 Ga0373934_0003740 3300035086 Bacteria 5600
237 Ga0373944_0083707 3300035089 Bacteria 1057
238 Ga0373923_0001240 3300035111 Bacteria 7157
239 Ga0373936_0121289 3300035113 Bacteria 1117
240 Ga0373945_0011518 3300035116 Bacteria 2926
241 Ga0373954_0015323 3300035118 Bacteria 3426
242 Ga0373954_0055698 3300035118 Bacteria 1860
243 Ga0373956_0002064 3300035119 Bacteria 8323
244 Ga0373956_0035659 3300035119 Bacteria 2194
245 Ga0373956_0066932 3300035119 Bacteria 1634
246 Ga0373957_0008533 3300035120 Bacteria 3323
247 Ga0373943_0101720 3300035170 Bacteria 1504
248 Ga0373943_0217962 3300035170 Bacteria 1062
249 Ga0373946_0123996 3300035171 Bacteria 1182
250 Ga0373955_0001065 3300035172 Bacteria 11686
251 Ga0373924_0050230 3300035410 Bacteria 1727
252 Ga0373935_0024496 3300035692 Bacteria 3715
253 Ga0373935_0083934 3300035692 Unclassified 2074
254 Ga0373935_0321844 3300035692 Bacteria 1097
255 Ga0373927_0020704 3300035695 Bacteria 4313
256 Ga0373927_0032573 3300035695 Unclassified 3395
257 Ga0373927_0074349 3300035695 Bacteria 2200
258 Ga0373947_0013857 3300035725 Bacteria 4622
259 Ga0373947_0018315 3300035725 Bacteria 4031
260 Ga0373947_0068995 3300035725 Bacteria 2163
261 Ga0373947_0181758 3300035725 Bacteria 1369
262 Ga0373937_0007447 3300036401 Bacteria 9471
263 Ga0373937_0045252 3300036401 Bacteria 4021
264 Ga0373937_0201550 3300036401 Bacteria 1870
265 Ga0316582_0088412 3300036647 Bacteria 2035
266 Ga0316584_0141172 3300036712 Bacteria 1796
267 Ga0373925_0040900 3300037068 Bacteria 3433
268 Ga0373925_0098631 3300037068 Bacteria 2242
269 Ga0373925_0257800 3300037068 Unclassified 1400
270 Ga0395905_0015022 3300037471 Bacteria 7379
271 Ga0436364_0367883 3300037853 Bacteria 1969
272 Ga0436365_0844446 3300039437 Bacteria 1106
273 Ga0436360_0192133 3300039438 Bacteria 4046
274 Ga0436361_0789256 3300039447 Bacteria 1022
275 Ga0436361_0889076 3300039447 Bacteria 3755
276 Ga0436363_1278482 3300039450 Bacteria 6434
277 Ga0439446_0013396 3300042156 Bacteria 2250
278 Ga0439446_0043448 3300042156 Bacteria 1328
279 Ga0450909_007625 3300042185 Bacteria 1567
280 Ga0451577_0230044 3300042876 Bacteria 1676
281 Ga0451576_0060791 3300045051 Unclassified 3940
282 Ga0451576_0616776 3300045051 Unclassified 1140
283 Ga0466958_0176990 3300045836 Bacteria 1353
284 Ga0466967_0102083 3300045976 Bacteria 2623
285 Ga0495603_0120053 3300046455 Bacteria 1532
286 Ga0495629_0033611 3300046459 Bacteria 3627
287 Ga0495629_0048099 3300046459 Bacteria 2990
288 Ga0495629_0058596 3300046459 Unclassified 2693
289 Ga0495651_0018413 3300046462 Bacteria 5410
290 Ga0495653_0001677 3300046463 Bacteria 17419
291 Ga0495653_0030050 3300046463 Bacteria 4332
292 Ga0495653_0039118 3300046463 Bacteria 3718
293 Ga0495650_0000015 3300046471 Bacteria 557595
294 Ga0495580_0038330 3300046472 Bacteria 3433
295 Ga0495580_0174811 3300046472 Bacteria 1483
296 Ga0495582_0014890 3300046473 Bacteria 4273
297 Ga0495639_0008512 3300046475 Bacteria 4400
298 Ga0495662_0044439 3300046476 Bacteria 2145
299 Ga0495662_0075278 3300046476 Unclassified 1638
300 Ga0495664_0011315 3300046477 Bacteria 5028
301 Ga0495664_0039313 3300046477 Bacteria 2795
302 Ga0495585_0000087 3300046492 Bacteria 97091
303 Ga0495594_0017060 3300046499 Bacteria 3832
304 Ga0495606_0191121 3300046507 Bacteria 1173
305 Ga0495620_0025912 3300046515 Bacteria 2766
306 Ga0495628_0061515 3300046516 Bacteria 2944
307 Ga0495630_0015707 3300046517 Bacteria 5532
308 Ga0495630_0170939 3300046517 Unclassified 1656
309 Ga0495652_0003193 3300046529 Bacteria 16331
310 Ga0495665_0000006 3300046531 Bacteria 84294
311 Ga0495665_0004644 3300046531 Bacteria 7409
312 Ga0495640_0026919 3300046533 Unclassified 4150
313 Ga0495586_0188410 3300046535 Bacteria 1168
314 Ga0495586_0279552 3300046535 Unclassified 955
315 Ga0495621_0015400 3300046539 Bacteria 2438
316 Ga0495645_0017141 3300046543 Bacteria 5189
317 Ga0495645_0018325 3300046543 Bacteria 5027
318 Ga0495634_0109411 3300046642 Unclassified 1778
319 Ga0495635_0007180 3300046663 Bacteria 7780
320 Ga0495635_0026736 3300046663 Bacteria 4013
321 Ga0495635_0265939 3300046663 Bacteria 1154
322 Ga0495659_0232871 3300046664 Bacteria 763
323 Ga0495588_0035488 3300046674 Bacteria 2527
324 Ga0495657_0219870 3300046675 Bacteria 1152
325 Ga0495599_0041702 3300046678 Bacteria 2881
326 Ga0495623_0000443 3300046679 Bacteria 27202
327 Ga0495623_0026360 3300046679 Bacteria 3742
328 Ga0495647_0008562 3300046681 Bacteria 3440
329 Ga0495658_0056619 3300046683 Unclassified 2237
330 Ga0495669_0053621 3300046684 Bacteria 1814
331 Ga0495669_0075456 3300046684 Bacteria 1543
332 Ga0495613_0021121 3300046689 Bacteria 4854
333 Ga0495624_0009813 3300046690 Bacteria 6623
334 Ga0495600_0010372 3300046809 Bacteria 5782
335 Ga0495600_0049555 3300046809 Bacteria 2740
336 Ga0495581_0002927 3300047315 Bacteria 9762
337 Ga0495581_0404986 3300047315 Bacteria 796
338 Ga0495604_0109018 3300047317 Bacteria 2021
339 Ga0495604_0205636 3300047317 Bacteria 1363
340 Ga0495604_0389529 3300047317 Bacteria 919
341 Ga0495674_0002569 3300047319 Bacteria 17693
342 Ga0495680_0001268 3300047322 Bacteria 27528
343 Ga0495680_0012341 3300047322 Bacteria 7521
344 Ga0495680_0185484 3300047322 Bacteria 1499
345 Ga0495683_0000638 3300047323 Bacteria 26071
346 Ga0495675_0113775 3300047444 Bacteria 1688
347 Ga0495675_0152954 3300047444 Bacteria 1425
348 Ga0495684_0020175 3300047471 Bacteria 5133
349 Ga0495684_0046440 3300047471 Bacteria 3322
350 Ga0495684_0369306 3300047471 Bacteria 1014
351 Ga0495686_0034620 3300047472 Bacteria 3251
352 Ga0495686_0069937 3300047472 Bacteria 2163
353 Ga0495593_0000674 3300047673 Bacteria 19679
354 Ga0495593_0015253 3300047673 Bacteria 4358
355 Ga0495602_0001634 3300048088 Bacteria 22290
356 Ga0495614_0005738 3300048089 Bacteria 5590
357 Ga0496100_0003450 3300048903 Bacteria 8245
358 Ga0496100_0094334 3300048903 Bacteria 2049
359 Ga0496101_0006191 3300048904 Bacteria 7692
360 Ga0496102_0002734 3300048905 Bacteria 15035
361 Ga0496102_0050681 3300048905 Bacteria 3781
362 Ga0496102_0063455 3300048905 Bacteria 3383
363 Ga0496102_0256950 3300048905 Bacteria 1647
364 Ga0496102_0593871 3300048905 Bacteria 1030
365 Ga0496103_0194409 3300048906 Bacteria 1304
366 Ga0496104_0002357 3300048907 Bacteria 16326
367 Ga0496104_0016488 3300048907 Bacteria 6713
368 Ga0496105_0019067 3300048908 Bacteria 5529
369 Ga0496106_0004840 3300048909 Bacteria 9964
370 Ga0496106_0044516 3300048909 Bacteria 3332
371 Ga0496106_0099083 3300048909 Bacteria 2259
372 Ga0496107_0394152 3300048910 Unclassified 1030
373 Ga0496109_0042698 3300048912 Bacteria 4109
374 Ga0496110_0289206 3300048913 Bacteria 1492
375 Ga0496111_0006300 3300048914 Bacteria 7695
376 Ga0496111_0105998 3300048914 Bacteria 2069
377 Ga0496112_0000755 3300048915 Bacteria 22673
378 Ga0496112_0022064 3300048915 Bacteria 6063
379 Ga0496112_0066539 3300048915 Bacteria 3556
380 Ga0496112_0072528 3300048915 Bacteria 3404
381 Ga0496113_0001869 3300048916 Bacteria 11996
382 Ga0496114_0007967 3300048917 Bacteria 8385
383 Ga0496114_0133320 3300048917 Bacteria 2147
384 Ga0496114_0368209 3300048917 Bacteria 1272
385 Ga0496115_0046634 3300048918 Bacteria 3465
386 Ga0496115_0094115 3300048918 Bacteria 2451
387 Ga0496115_0431079 3300048918 Unclassified 1067
388 Ga0496116_0007751 3300048919 Bacteria 9442
389 Ga0496116_0077711 3300048919 Bacteria 2073
390 Ga0496117_0005745 3300048920 Bacteria 12888
391 Ga0496118_0006375 3300048921 Bacteria 12997
392 Ga0496118_0009421 3300048921 Bacteria 9862
393 Ga0496118_0178576 3300048921 Bacteria 1286
394 Ga0496119_0052548 3300048922 Bacteria 2495
395 Ga0496119_0106878 3300048922 Bacteria 1561
396 Ga0496121_0006373 3300048924 Bacteria 14695
397 Ga0496121_0130078 3300048924 Bacteria 1886
398 Ga0496121_0148620 3300048924 Bacteria 1728
399 Ga0496121_0162963 3300048924 Bacteria 1628
400 Ga0496122_0004493 3300048925 Bacteria 17244
401 Ga0496122_0222041 3300048925 Bacteria 1083
402 Ga0496123_0025303 3300048926 Bacteria 4479
403 Ga0496126_0000082 3300048929 Bacteria 218571
404 Ga0495678_004919 3300049459 Bacteria 7549
405 Ga0501034_0008650 3300049571 Bacteria 10737
406 Ga0501068_0000034 3300049584 Bacteria 50744
407 Ga0501072_0001183 3300049588 Bacteria 19429
408 Ga0501073_0000917 3300049589 Bacteria 21211
409 Ga0501074_0298240 3300049590 Bacteria 1145
410 Ga0501077_0050364 3300049593 Unclassified 2647
411 Ga0501080_0001918 3300049742 Bacteria 17932
412 Ga0501044_0607747 3300049823 Bacteria 986
413 nmdc:mga0yw44_83237_c1 3300050492 Bacteria 2009
414 nmdc:mga05p37_19730_c1 3300050507 Bacteria 8156
415 nmdc:mga05p37_216236_c1 3300050507 Bacteria 2315
416 nmdc:mga05p37_250665_c1 3300050507 Bacteria 2124
417 nmdc:mga05p37_4034_c1 3300050507 Bacteria 17155
418 nmdc:mga05p37_50639_c1 3300050507 Bacteria 5108
419 nmdc:mga09592_424870_c1 3300050508 Bacteria 1148
420 nmdc:mga0qj67_206611_c1 3300050509 Bacteria 1595
421 nmdc:mga06r32_234945_c1 3300050510 Unclassified 1821
422 nmdc:mga06r32_28215_c1 3300050510 Bacteria 5249
423 nmdc:mga08y16_184766_c1 3300050511 Unclassified 2164
424 nmdc:mga0n895_75809_c1 3300050512 Bacteria 3344
425 nmdc:mga0rr50_176142_c1 3300050513 Bacteria 1746
426 nmdc:mga0rr50_199243_c1 3300050513 Bacteria 1644
427 nmdc:mga0rr50_6341_c1 3300050513 Bacteria 7191
428 nmdc:mga08x19_117056_c1 3300050514 Bacteria 1782
429 nmdc:mga08x19_14770_c1 3300050514 Bacteria 4742
430 nmdc:mga08x19_77208_c1 3300050514 Bacteria 2181
431 nmdc:mga0a205_107909_c1 3300050515 Bacteria 2682
432 nmdc:mga0a205_14012_c2 3300050515 Bacteria 4021
433 nmdc:mga0a205_218871_c1 3300050515 Unclassified 1790
434 nmdc:mga0a205_31686_c1 3300050515 Bacteria 5067
435 Ga0495612_0009187 3300053078 Bacteria 4010
436 Ga0495619_0007830 3300053085 Bacteria 6762
437 Ga0500651_0241892 3300053093 Bacteria 1052
438 Ga0500642_0001864 3300053130 Bacteria 6089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0222041 Ga0496122_0222041_390_1031 208
2 3300048905 Ga0496102_0256950 Ga0496102_0256950_982_1620 210
3 3300031548 Ga0307408_100072346 Ga0307408_1000723463 213
4 3300031731 Ga0307405_10024030 Ga0307405_100240302 213
5 3300031901 Ga0307406_10034449 Ga0307406_100344493 213
6 3300032002 Ga0307416_100032419 Ga0307416_1000324192 213
7 3300050513 nmdc:mga0rr50_199243_c1 nmdc:mga0rr50_199243_c1_899_1612 214
8 3300005354 Ga0070675_100944462 Ga0070675_1009444621 217
9 3300048917 Ga0496114_0368209 Ga0496114_0368209_580_1251 220
10 3300005471 Ga0070698_100268472 Ga0070698_1002684722 223
11 3300035086 Ga0373934_0003740 Ga0373934_0003740_2103_2783 226
12 3300046664 Ga0495659_0232871 Ga0495659_0232871_49_729 226
13 3300048903 Ga0496100_0094334 Ga0496100_0094334_1072_1752 226
14 3300048909 Ga0496106_0099083 Ga0496106_0099083_144_824 226
15 3300048914 Ga0496111_0105998 Ga0496111_0105998_630_1310 226
16 3300048917 Ga0496114_0007967 Ga0496114_0007967_1430_2110 226
17 3300047317 Ga0495604_0205636 Ga0495604_0205636_428_1171 227
18 3300049593 Ga0501077_0050364 Ga0501077_0050364_889_1611 227
19 iso_pu_bacteria 2974315732 2974318000 227
20 iso_pu_bacteria 2984523437 2984526219 227
21 3300045051 Ga0451576_0060791 Ga0451576_0060791_3044_3763 231
22 3300005436 Ga0070713_100000296 Ga0070713_1000002962 233
23 3300005937 Ga0081455_10049799 Ga0081455_100497992 233
24 3300025928 Ga0207700_10001526 Ga0207700_1000152613 233
25 3300033180 Ga0307510_10027744 Ga0307510_100277444 233
26 3300049823 Ga0501044_0607747 Ga0501044_0607747_162_872 233
27 3300005983 Ga0081540_1039781 Ga0081540_10397812 234
28 3300006028 Ga0070717_10050589 Ga0070717_100505894 234
29 3300006175 Ga0070712_100274489 Ga0070712_1002744891 234
30 3300006871 Ga0075434_100046468 Ga0075434_1000464683 234
31 3300006914 Ga0075436_100443921 Ga0075436_1004439212 234
32 3300007076 Ga0075435_100002040 Ga0075435_1000020407 234
33 3300007265 Ga0099794_10007154 Ga0099794_100071542 234
34 3300009098 Ga0105245_10204482 Ga0105245_102044822 234
35 3300010159 Ga0099796_10005442 Ga0099796_100054423 234
36 3300021377 Ga0213874_10001175 Ga0213874_100011753 234
37 3300025915 Ga0207693_10236957 Ga0207693_102369571 234
38 3300025927 Ga0207687_10309304 Ga0207687_103093041 234
39 3300035119 Ga0373956_0035659 Ga0373956_0035659_504_1358 234
40 3300035170 Ga0373943_0217962 Ga0373943_0217962_312_1016 234
41 3300035692 Ga0373935_0083934 Ga0373935_0083934_794_1498 234
42 3300035695 Ga0373927_0032573 Ga0373927_0032573_1845_2549 234
43 3300035725 Ga0373947_0068995 Ga0373947_0068995_1359_2063 234
44 3300037068 Ga0373925_0257800 Ga0373925_0257800_450_1154 234
45 3300037853 Ga0436364_0367883 Ga0436364_0367883_1194_1898 234
46 3300039447 Ga0436361_0789256 Ga0436361_0789256_210_914 234
47 3300039450 Ga0436363_1278482 Ga0436363_1278482_2820_3650 234
48 3300046459 Ga0495629_0058596 Ga0495629_0058596_1098_1802 234
49 3300046476 Ga0495662_0075278 Ga0495662_0075278_494_1198 234
50 3300046517 Ga0495630_0170939 Ga0495630_0170939_866_1570 234
51 3300046533 Ga0495640_0026919 Ga0495640_0026919_1020_1724 234
52 3300046535 Ga0495586_0279552 Ga0495586_0279552_186_890 234
53 3300046642 Ga0495634_0109411 Ga0495634_0109411_386_1090 234
54 3300046663 Ga0495635_0265939 Ga0495635_0265939_423_1127 234
55 3300047317 Ga0495604_0389529 Ga0495604_0389529_32_814 234
56 3300047471 Ga0495684_0369306 Ga0495684_0369306_230_934 234
57 3300048910 Ga0496107_0394152 Ga0496107_0394152_49_849 234
58 3300048918 Ga0496115_0431079 Ga0496115_0431079_86_886 234
59 3300049571 Ga0501034_0008650 Ga0501034_0008650_441_1265 234
60 3300049584 Ga0501068_0000034 Ga0501068_0000034_13855_14679 234
61 3300049588 Ga0501072_0001183 Ga0501072_0001183_12912_13736 234
62 3300049589 Ga0501073_0000917 Ga0501073_0000917_16522_17346 234
63 3300049590 Ga0501074_0298240 Ga0501074_0298240_422_1126 234
64 3300049742 Ga0501080_0001918 Ga0501080_0001918_6330_7154 234
65 3300050512 nmdc:mga0n895_75809_c1 nmdc:mga0n895_75809_c1_1419_2126 234
66 3300050513 nmdc:mga0rr50_6341_c1 nmdc:mga0rr50_6341_c1_3987_4694 234
67 3300050514 nmdc:mga08x19_77208_c1 nmdc:mga08x19_77208_c1_91_798 234
68 3300050515 nmdc:mga0a205_107909_c1 nmdc:mga0a205_107909_c1_1885_2592 234
69 3300002067 JGI24735J21928_10001088 JGI24735J21928_1000108811 235
70 3300005456 Ga0070678_100168342 Ga0070678_1001683422 235
71 3300005544 Ga0070686_100203610 Ga0070686_1002036102 235
72 3300005842 Ga0068858_100363611 Ga0068858_1003636112 235
73 3300006028 Ga0070717_10579891 Ga0070717_105798911 235
74 3300009011 Ga0105251_10000195 Ga0105251_1000019513 235
75 3300009036 Ga0105244_10012952 Ga0105244_100129525 235
76 3300009093 Ga0105240_10420218 Ga0105240_104202181 235
77 3300009101 Ga0105247_10594149 Ga0105247_105941491 235
78 3300009551 Ga0105238_10013701 Ga0105238_100137015 235
79 3300013105 Ga0157369_10165855 Ga0157369_101658552 235
80 3300013296 Ga0157374_10004873 Ga0157374_100048738 235
81 3300013306 Ga0163162_10261895 Ga0163162_102618952 235
82 3300013308 Ga0157375_10124986 Ga0157375_101249862 235
83 3300014325 Ga0163163_10032450 Ga0163163_100324506 235
84 3300025302 Ga0207426_1002601 Ga0207426_10026014 235
85 3300025904 Ga0207647_10012614 Ga0207647_100126144 235
86 3300025916 Ga0207663_10042304 Ga0207663_100423041 235
87 3300025924 Ga0207694_10027743 Ga0207694_100277434 235
88 3300026121 Ga0207683_10320370 Ga0207683_103203702 235
89 3300035170 Ga0373943_0101720 Ga0373943_0101720_279_995 235
90 3300035692 Ga0373935_0321844 Ga0373935_0321844_85_801 235
91 3300035725 Ga0373947_0181758 Ga0373947_0181758_383_1099 235
92 3300036647 Ga0316582_0088412 Ga0316582_0088412_1268_1984 235
93 3300036712 Ga0316584_0141172 Ga0316584_0141172_752_1468 235
94 3300037471 Ga0395905_0015022 Ga0395905_0015022_336_1058 235
95 3300039438 Ga0436360_0192133 Ga0436360_0192133_2069_2782 235
96 3300042876 Ga0451577_0230044 Ga0451577_0230044_123_839 235
97 3300045976 Ga0466967_0102083 Ga0466967_0102083_944_1666 235
98 3300046459 Ga0495629_0033611 Ga0495629_0033611_897_1619 235
99 3300046463 Ga0495653_0001677 Ga0495653_0001677_2160_2882 235
100 3300046463 Ga0495653_0030050 Ga0495653_0030050_3040_3762 235
101 3300046472 Ga0495580_0174811 Ga0495580_0174811_681_1403 235
102 3300046476 Ga0495662_0044439 Ga0495662_0044439_465_1187 235
103 3300046477 Ga0495664_0011315 Ga0495664_0011315_2171_2893 235
104 3300046507 Ga0495606_0191121 Ga0495606_0191121_316_1032 235
105 3300046515 Ga0495620_0025912 Ga0495620_0025912_20_742 235
106 3300046516 Ga0495628_0061515 Ga0495628_0061515_1996_2718 235
107 3300046529 Ga0495652_0003193 Ga0495652_0003193_3033_3755 235
108 3300046531 Ga0495665_0000006 Ga0495665_0000006_42286_43008 235
109 3300046543 Ga0495645_0017141 Ga0495645_0017141_3522_4244 235
110 3300046663 Ga0495635_0026736 Ga0495635_0026736_851_1573 235
111 3300046678 Ga0495599_0041702 Ga0495599_0041702_956_1678 235
112 3300046679 Ga0495623_0000443 Ga0495623_0000443_24971_25693 235
113 3300046684 Ga0495669_0075456 Ga0495669_0075456_520_1242 235
114 3300046690 Ga0495624_0009813 Ga0495624_0009813_3064_3786 235
115 3300046809 Ga0495600_0010372 Ga0495600_0010372_1611_2333 235
116 3300047315 Ga0495581_0404986 Ga0495581_0404986_18_740 235
117 3300047319 Ga0495674_0002569 Ga0495674_0002569_15782_16504 235
118 3300047322 Ga0495680_0001268 Ga0495680_0001268_24470_25192 235
119 3300047322 Ga0495680_0185484 Ga0495680_0185484_168_965 235
120 3300047323 Ga0495683_0000638 Ga0495683_0000638_15667_16389 235
121 3300047444 Ga0495675_0113775 Ga0495675_0113775_710_1432 235
122 3300047673 Ga0495593_0000674 Ga0495593_0000674_600_1322 235
123 3300047673 Ga0495593_0015253 Ga0495593_0015253_2109_2831 235
124 3300048088 Ga0495602_0001634 Ga0495602_0001634_18719_19441 235
125 3300048903 Ga0496100_0003450 Ga0496100_0003450_2685_3407 235
126 3300048904 Ga0496101_0006191 Ga0496101_0006191_4165_4887 235
127 3300048905 Ga0496102_0002734 Ga0496102_0002734_9498_10220 235
128 3300048905 Ga0496102_0063455 Ga0496102_0063455_2260_2982 235
129 3300048906 Ga0496103_0194409 Ga0496103_0194409_496_1218 235
130 3300048907 Ga0496104_0016488 Ga0496104_0016488_1543_2256 235
131 3300048909 Ga0496106_0004840 Ga0496106_0004840_52_774 235
132 3300048909 Ga0496106_0044516 Ga0496106_0044516_201_914 235
133 3300048912 Ga0496109_0042698 Ga0496109_0042698_684_1397 235
134 3300048913 Ga0496110_0289206 Ga0496110_0289206_162_884 235
135 3300048914 Ga0496111_0006300 Ga0496111_0006300_6561_7283 235
136 3300048915 Ga0496112_0022064 Ga0496112_0022064_3163_3885 235
137 3300048915 Ga0496112_0072528 Ga0496112_0072528_2068_2781 235
138 3300048916 Ga0496113_0001869 Ga0496113_0001869_10563_11285 235
139 3300048918 Ga0496115_0046634 Ga0496115_0046634_2231_2944 235
140 3300048919 Ga0496116_0007751 Ga0496116_0007751_2390_3112 235
141 3300048921 Ga0496118_0009421 Ga0496118_0009421_496_1218 235
142 3300048921 Ga0496118_0178576 Ga0496118_0178576_470_1192 235
143 3300048922 Ga0496119_0052548 Ga0496119_0052548_1491_2213 235
144 3300048922 Ga0496119_0106878 Ga0496119_0106878_668_1390 235
145 3300048924 Ga0496121_0006373 Ga0496121_0006373_12942_13664 235
146 3300048924 Ga0496121_0130078 Ga0496121_0130078_113_823 235
147 3300048924 Ga0496121_0148620 Ga0496121_0148620_539_1252 235
148 3300048925 Ga0496122_0004493 Ga0496122_0004493_9193_9915 235
149 3300048926 Ga0496123_0025303 Ga0496123_0025303_2796_3518 235
150 iso_pu_bacteria 2510065045 2510247328 235
151 iso_pu_bacteria 2512047030 2512351156 235
152 iso_pu_bacteria 2515154122 2515685413 235
153 iso_pu_bacteria 2718217991 2719638498 235
154 iso_pu_bacteria 2885270888 2885280244 235
155 iso_pu_bacteria 2904615490 2904618833 235
156 3300005328 Ga0070676_10271681 Ga0070676_102716812 236
157 3300005329 Ga0070683_100004329 Ga0070683_1000043296 236
158 3300005330 Ga0070690_100002610 Ga0070690_1000026107 236
159 3300005330 Ga0070690_100238039 Ga0070690_1002380392 236
160 3300005334 Ga0068869_100156818 Ga0068869_1001568182 236
161 3300005335 Ga0070666_10002429 Ga0070666_100024297 236
162 3300005336 Ga0070680_100052022 Ga0070680_1000520223 236
163 3300005338 Ga0068868_100002556 Ga0068868_1000025566 236
164 3300005338 Ga0068868_100353627 Ga0068868_1003536272 236
165 3300005340 Ga0070689_100052709 Ga0070689_1000527094 236
166 3300005344 Ga0070661_100013622 Ga0070661_1000136225 236
167 3300005345 Ga0070692_10005697 Ga0070692_100056972 236
168 3300005355 Ga0070671_100355638 Ga0070671_1003556381 236
169 3300005356 Ga0070674_100022508 Ga0070674_1000225083 236
170 3300005356 Ga0070674_100281005 Ga0070674_1002810052 236
171 3300005364 Ga0070673_100000088 Ga0070673_10000008810 236
172 3300005365 Ga0070688_100001429 Ga0070688_1000014298 236
173 3300005366 Ga0070659_100018703 Ga0070659_1000187034 236
174 3300005367 Ga0070667_100013844 Ga0070667_1000138442 236
175 3300005367 Ga0070667_100184531 Ga0070667_1001845313 236
176 3300005434 Ga0070709_10016610 Ga0070709_100166104 236
177 3300005434 Ga0070709_10076461 Ga0070709_100764613 236
178 3300005435 Ga0070714_100002535 Ga0070714_10000253513 236
179 3300005436 Ga0070713_100001145 Ga0070713_1000011459 236
180 3300005436 Ga0070713_100029776 Ga0070713_1000297764 236
181 3300005438 Ga0070701_10230548 Ga0070701_102305481 236
182 3300005439 Ga0070711_100149700 Ga0070711_1001497002 236
183 3300005440 Ga0070705_100077836 Ga0070705_1000778363 236
184 3300005444 Ga0070694_100010716 Ga0070694_1000107167 236
185 3300005445 Ga0070708_100028996 Ga0070708_1000289966 236
186 3300005455 Ga0070663_100070742 Ga0070663_1000707423 236
187 3300005456 Ga0070678_100005633 Ga0070678_1000056337 236
188 3300005457 Ga0070662_100014312 Ga0070662_1000143124 236
189 3300005457 Ga0070662_100117578 Ga0070662_1001175782 236
190 3300005459 Ga0068867_100173374 Ga0068867_1001733743 236
191 3300005466 Ga0070685_10001545 Ga0070685_100015454 236
192 3300005467 Ga0070706_100010400 Ga0070706_1000104006 236
193 3300005530 Ga0070679_100168886 Ga0070679_1001688862 236
194 3300005539 Ga0068853_100474291 Ga0068853_1004742912 236
195 3300005543 Ga0070672_100150964 Ga0070672_1001509643 236
196 3300005545 Ga0070695_100058718 Ga0070695_1000587182 236
197 3300005546 Ga0070696_100021368 Ga0070696_1000213684 236
198 3300005547 Ga0070693_100005035 Ga0070693_1000050357 236
199 3300005548 Ga0070665_100031078 Ga0070665_1000310786 236
200 3300005564 Ga0070664_100031992 Ga0070664_1000319925 236
201 3300005564 Ga0070664_100289349 Ga0070664_1002893492 236
202 3300005578 Ga0068854_100006640 Ga0068854_1000066407 236
203 3300005578 Ga0068854_100023193 Ga0068854_1000231932 236
204 3300005614 Ga0068856_100398105 Ga0068856_1003981052 236
205 3300005615 Ga0070702_100030390 Ga0070702_1000303903 236
206 3300005615 Ga0070702_100193666 Ga0070702_1001936662 236
207 3300005616 Ga0068852_100025599 Ga0068852_1000255994 236
208 3300005616 Ga0068852_100114952 Ga0068852_1001149522 236
209 3300005617 Ga0068859_100005369 Ga0068859_1000053699 236
210 3300005618 Ga0068864_100001261 Ga0068864_1000012611 236
211 3300005834 Ga0068851_10021445 Ga0068851_100214453 236
212 3300005841 Ga0068863_100001485 Ga0068863_1000014852 236
213 3300005843 Ga0068860_100388978 Ga0068860_1003889782 236
214 3300006028 Ga0070717_10367160 Ga0070717_103671602 236
215 3300006163 Ga0070715_10007390 Ga0070715_100073903 236
216 3300006237 Ga0097621_100050630 Ga0097621_1000506303 236
217 3300006237 Ga0097621_100317805 Ga0097621_1003178052 236
218 3300006358 Ga0068871_100018012 Ga0068871_1000180122 236
219 3300006358 Ga0068871_100314008 Ga0068871_1003140082 236
220 3300006931 Ga0097620_100005369 Ga0097620_1000053699 236
221 3300009093 Ga0105240_10056095 Ga0105240_100560955 236
222 3300009098 Ga0105245_10006192 Ga0105245_100061927 236
223 3300009098 Ga0105245_10012365 Ga0105245_100123657 236
224 3300009174 Ga0105241_10046734 Ga0105241_100467344 236
225 3300009174 Ga0105241_10479615 Ga0105241_104796151 236
226 3300009176 Ga0105242_10005171 Ga0105242_100051717 236
227 3300009176 Ga0105242_10882565 Ga0105242_108825651 236
228 3300009177 Ga0105248_10018063 Ga0105248_100180637 236
229 3300009551 Ga0105238_10030805 Ga0105238_100308057 236
230 3300009551 Ga0105238_10281629 Ga0105238_102816292 236
231 3300010375 Ga0105239_10387834 Ga0105239_103878342 236
232 3300011119 Ga0105246_10021584 Ga0105246_100215842 236
233 3300013100 Ga0157373_10288060 Ga0157373_102880602 236
234 3300013102 Ga0157371_10067275 Ga0157371_100672753 236
235 3300013104 Ga0157370_10018954 Ga0157370_100189548 236
236 3300013104 Ga0157370_10094304 Ga0157370_100943043 236
237 3300013105 Ga0157369_10133421 Ga0157369_101334213 236
238 3300013296 Ga0157374_10000383 Ga0157374_1000038323 236
239 3300013297 Ga0157378_10013081 Ga0157378_100130816 236
240 3300013297 Ga0157378_10137716 Ga0157378_101377163 236
241 3300013306 Ga0163162_10009180 Ga0163162_100091807 236
242 3300013306 Ga0163162_10033562 Ga0163162_100335627 236
243 3300013308 Ga0157375_10002420 Ga0157375_100024209 236
244 3300014325 Ga0163163_10000750 Ga0163163_1000075030 236
245 3300014745 Ga0157377_10022459 Ga0157377_100224591 236
246 3300014968 Ga0157379_10002542 Ga0157379_100025429 236
247 3300014969 Ga0157376_10003872 Ga0157376_100038727 236
248 3300014969 Ga0157376_10048694 Ga0157376_100486943 236
249 3300015265 Ga0182005_1000484 Ga0182005_100048423 236
250 3300017792 Ga0163161_10122616 Ga0163161_101226162 236
251 3300025903 Ga0207680_10059121 Ga0207680_100591213 236
252 3300025908 Ga0207643_10092306 Ga0207643_100923062 236
253 3300025910 Ga0207684_10220392 Ga0207684_102203923 236
254 3300025911 Ga0207654_10024105 Ga0207654_100241053 236
255 3300025913 Ga0207695_10687590 Ga0207695_106875902 236
256 3300025915 Ga0207693_10000254 Ga0207693_1000025416 236
257 3300025918 Ga0207662_10040983 Ga0207662_100409833 236
258 3300025919 Ga0207657_10002586 Ga0207657_1000258619 236
259 3300025921 Ga0207652_10073540 Ga0207652_100735403 236
260 3300025927 Ga0207687_10002262 Ga0207687_100022628 236
261 3300025927 Ga0207687_10002498 Ga0207687_100024987 236
262 3300025928 Ga0207700_10001192 Ga0207700_1000119210 236
263 3300025928 Ga0207700_10116815 Ga0207700_101168152 236
264 3300025929 Ga0207664_10003410 Ga0207664_1000341010 236
265 3300025931 Ga0207644_10002966 Ga0207644_100029666 236
266 3300025931 Ga0207644_10090462 Ga0207644_100904623 236
267 3300025933 Ga0207706_10025205 Ga0207706_100252054 236
268 3300025933 Ga0207706_10123508 Ga0207706_101235082 236
269 3300025934 Ga0207686_10000302 Ga0207686_100003029 236
270 3300025934 Ga0207686_10002361 Ga0207686_1000236121 236
271 3300025936 Ga0207670_10038932 Ga0207670_100389324 236
272 3300025937 Ga0207669_10043859 Ga0207669_100438593 236
273 3300025941 Ga0207711_10002349 Ga0207711_1000234910 236
274 3300025942 Ga0207689_10053900 Ga0207689_100539002 236
275 3300025942 Ga0207689_10178613 Ga0207689_101786132 236
276 3300025945 Ga0207679_10253655 Ga0207679_102536552 236
277 3300025981 Ga0207640_10008119 Ga0207640_100081196 236
278 3300025981 Ga0207640_10349025 Ga0207640_103490252 236
279 3300025986 Ga0207658_10115363 Ga0207658_101153632 236
280 3300025986 Ga0207658_10148203 Ga0207658_101482032 236
281 3300026023 Ga0207677_10000739 Ga0207677_1000073921 236
282 3300026023 Ga0207677_10022852 Ga0207677_100228523 236
283 3300026088 Ga0207641_10003409 Ga0207641_100034095 236
284 3300026089 Ga0207648_10240126 Ga0207648_102401262 236
285 3300026095 Ga0207676_10000470 Ga0207676_1000047018 236
286 3300026116 Ga0207674_10003107 Ga0207674_1000310723 236
287 3300026121 Ga0207683_10000227 Ga0207683_1000022744 236
288 3300026142 Ga0207698_10237124 Ga0207698_102371242 236
289 3300028381 Ga0268264_10020791 Ga0268264_100207917 236
290 3300028381 Ga0268264_10148449 Ga0268264_101484493 236
291 3300035083 Ga0373926_0056333 Ga0373926_0056333_582_1301 236
292 3300035089 Ga0373944_0083707 Ga0373944_0083707_110_829 236
293 3300035111 Ga0373923_0001240 Ga0373923_0001240_1716_2435 236
294 3300035113 Ga0373936_0121289 Ga0373936_0121289_357_1076 236
295 3300035116 Ga0373945_0011518 Ga0373945_0011518_702_1421 236
296 3300035118 Ga0373954_0015323 Ga0373954_0015323_56_775 236
297 3300035118 Ga0373954_0055698 Ga0373954_0055698_615_1334 236
298 3300035119 Ga0373956_0002064 Ga0373956_0002064_5283_6002 236
299 3300035119 Ga0373956_0066932 Ga0373956_0066932_376_1095 236
300 3300035120 Ga0373957_0008533 Ga0373957_0008533_331_1050 236
301 3300035171 Ga0373946_0123996 Ga0373946_0123996_430_1149 236
302 3300035172 Ga0373955_0001065 Ga0373955_0001065_4085_4804 236
303 3300035410 Ga0373924_0050230 Ga0373924_0050230_510_1229 236
304 3300035692 Ga0373935_0024496 Ga0373935_0024496_1571_2290 236
305 3300035695 Ga0373927_0020704 Ga0373927_0020704_3062_3781 236
306 3300035695 Ga0373927_0074349 Ga0373927_0074349_808_1527 236
307 3300035725 Ga0373947_0013857 Ga0373947_0013857_841_1560 236
308 3300035725 Ga0373947_0018315 Ga0373947_0018315_250_969 236
309 3300036401 Ga0373937_0007447 Ga0373937_0007447_1748_2467 236
310 3300036401 Ga0373937_0045252 Ga0373937_0045252_2201_2920 236
311 3300036401 Ga0373937_0201550 Ga0373937_0201550_554_1273 236
312 3300037068 Ga0373925_0040900 Ga0373925_0040900_700_1419 236
313 3300037068 Ga0373925_0098631 Ga0373925_0098631_530_1249 236
314 3300045051 Ga0451576_0616776 Ga0451576_0616776_406_1119 236
315 3300046455 Ga0495603_0120053 Ga0495603_0120053_161_880 236
316 3300046459 Ga0495629_0048099 Ga0495629_0048099_1939_2658 236
317 3300046462 Ga0495651_0018413 Ga0495651_0018413_3011_3730 236
318 3300046463 Ga0495653_0039118 Ga0495653_0039118_1443_2162 236
319 3300046472 Ga0495580_0038330 Ga0495580_0038330_2327_3046 236
320 3300046473 Ga0495582_0014890 Ga0495582_0014890_1707_2426 236
321 3300046475 Ga0495639_0008512 Ga0495639_0008512_1975_2694 236
322 3300046477 Ga0495664_0039313 Ga0495664_0039313_966_1685 236
323 3300046499 Ga0495594_0017060 Ga0495594_0017060_908_1627 236
324 3300046517 Ga0495630_0015707 Ga0495630_0015707_3464_4183 236
325 3300046531 Ga0495665_0004644 Ga0495665_0004644_123_842 236
326 3300046535 Ga0495586_0188410 Ga0495586_0188410_199_918 236
327 3300046539 Ga0495621_0015400 Ga0495621_0015400_481_1200 236
328 3300046543 Ga0495645_0018325 Ga0495645_0018325_2713_3432 236
329 3300046663 Ga0495635_0007180 Ga0495635_0007180_1789_2508 236
330 3300046674 Ga0495588_0035488 Ga0495588_0035488_917_1636 236
331 3300046675 Ga0495657_0219870 Ga0495657_0219870_223_942 236
332 3300046679 Ga0495623_0026360 Ga0495623_0026360_1265_1984 236
333 3300046681 Ga0495647_0008562 Ga0495647_0008562_2599_3318 236
334 3300046689 Ga0495613_0021121 Ga0495613_0021121_2095_2814 236
335 3300046809 Ga0495600_0049555 Ga0495600_0049555_182_901 236
336 3300047315 Ga0495581_0002927 Ga0495581_0002927_129_848 236
337 3300047317 Ga0495604_0109018 Ga0495604_0109018_517_1236 236
338 3300047322 Ga0495680_0012341 Ga0495680_0012341_2176_2895 236
339 3300047444 Ga0495675_0152954 Ga0495675_0152954_499_1218 236
340 3300047471 Ga0495684_0020175 Ga0495684_0020175_375_1094 236
341 3300047471 Ga0495684_0046440 Ga0495684_0046440_283_1002 236
342 3300048089 Ga0495614_0005738 Ga0495614_0005738_3285_4004 236
343 3300048905 Ga0496102_0050681 Ga0496102_0050681_2854_3576 236
344 3300048905 Ga0496102_0593871 Ga0496102_0593871_255_974 236
345 3300048907 Ga0496104_0002357 Ga0496104_0002357_787_1506 236
346 3300048908 Ga0496105_0019067 Ga0496105_0019067_2455_3174 236
347 3300048915 Ga0496112_0000755 Ga0496112_0000755_13516_14235 236
348 3300048915 Ga0496112_0066539 Ga0496112_0066539_241_960 236
349 3300048917 Ga0496114_0133320 Ga0496114_0133320_487_1209 236
350 3300048918 Ga0496115_0094115 Ga0496115_0094115_1273_1992 236
351 3300048920 Ga0496117_0005745 Ga0496117_0005745_8553_9275 236
352 3300048921 Ga0496118_0006375 Ga0496118_0006375_8556_9278 236
353 3300048929 Ga0496126_0000082 Ga0496126_0000082_135817_136539 236
354 3300050510 nmdc:mga06r32_28215_c1 nmdc:mga06r32_28215_c1_4018_4728 236
355 3300050514 nmdc:mga08x19_117056_c1 nmdc:mga08x19_117056_c1_583_1302 236
356 3300053078 Ga0495612_0009187 Ga0495612_0009187_2027_2746 236
357 3300053085 Ga0495619_0007830 Ga0495619_0007830_3911_4630 236
358 3300006852 Ga0075433_10009627 Ga0075433_1000962710 237
359 3300009093 Ga0105240_10001449 Ga0105240_1000144921 237
360 3300009147 Ga0114129_10032104 Ga0114129_100321049 237
361 3300009545 Ga0105237_10000882 Ga0105237_1000088221 237
362 3300009551 Ga0105238_10007420 Ga0105238_100074209 237
363 3300010375 Ga0105239_10003438 Ga0105239_100034385 237
364 3300025913 Ga0207695_10066620 Ga0207695_100666203 237
365 3300025914 Ga0207671_10005638 Ga0207671_1000563810 237
366 3300025924 Ga0207694_10004425 Ga0207694_100044252 237
367 3300026041 Ga0207639_10005487 Ga0207639_100054873 237
368 3300039437 Ga0436365_0844446 Ga0436365_0844446_145_870 237
369 3300039447 Ga0436361_0889076 Ga0436361_0889076_2955_3668 237
370 3300042156 Ga0439446_0013396 Ga0439446_0013396_406_1125 237
371 3300042156 Ga0439446_0043448 Ga0439446_0043448_589_1308 237
372 3300042185 Ga0450909_007625 Ga0450909_007625_119_838 237
373 3300045836 Ga0466958_0176990 Ga0466958_0176990_31_753 237
374 3300047472 Ga0495686_0069937 Ga0495686_0069937_611_1336 237
375 3300050507 nmdc:mga05p37_216236_c1 nmdc:mga05p37_216236_c1_736_1452 237
376 3300050515 nmdc:mga0a205_14012_c2 nmdc:mga0a205_14012_c2_2087_2803 237
377 3300053093 Ga0500651_0241892 Ga0500651_0241892_199_993 237
378 3300053130 Ga0500642_0001864 Ga0500642_0001864_5143_5859 237
379 2162886012 MBSR1b_contig_12358085 MBSR1b_0606.00002280 238
380 3300005295 Ga0065707_10098321 Ga0065707_100983211 238
381 3300005295 Ga0065707_10116884 Ga0065707_101168842 238
382 3300005336 Ga0070680_100012000 Ga0070680_1000120006 238
383 3300005471 Ga0070698_100481390 Ga0070698_1004813902 238
384 3300005530 Ga0070679_100071741 Ga0070679_1000717413 238
385 3300005536 Ga0070697_100497082 Ga0070697_1004970822 238
386 3300005545 Ga0070695_100194327 Ga0070695_1001943272 238
387 3300005546 Ga0070696_100318600 Ga0070696_1003186002 238
388 3300005549 Ga0070704_100014733 Ga0070704_1000147336 238
389 3300005840 Ga0068870_10219295 Ga0068870_102192952 238
390 3300005937 Ga0081455_10000513 Ga0081455_1000051314 238
391 3300005937 Ga0081455_10007726 Ga0081455_100077262 238
392 3300006038 Ga0075365_10052005 Ga0075365_100520052 238
393 3300006844 Ga0075428_100122259 Ga0075428_1001222593 238
394 3300006844 Ga0075428_100196170 Ga0075428_1001961702 238
395 3300006846 Ga0075430_100231847 Ga0075430_1002318472 238
396 3300006847 Ga0075431_100178136 Ga0075431_1001781363 238
397 3300006847 Ga0075431_100360897 Ga0075431_1003608972 238
398 3300006852 Ga0075433_10048795 Ga0075433_100487953 238
399 3300006880 Ga0075429_100394104 Ga0075429_1003941042 238
400 3300006914 Ga0075436_100017751 Ga0075436_1000177513 238
401 3300006914 Ga0075436_100130107 Ga0075436_1001301073 238
402 3300009147 Ga0114129_10007096 Ga0114129_1000709612 238
403 3300009147 Ga0114129_10036806 Ga0114129_100368067 238
404 3300009147 Ga0114129_10401733 Ga0114129_104017332 238
405 3300009147 Ga0114129_10682360 Ga0114129_106823602 238
406 3300009177 Ga0105248_10129851 Ga0105248_101298511 238
407 3300013297 Ga0157378_10010494 Ga0157378_100104943 238
408 3300013306 Ga0163162_10423504 Ga0163162_104235042 238
409 3300014326 Ga0157380_10917116 Ga0157380_109171161 238
410 3300017792 Ga0163161_10204013 Ga0163161_102040131 238
411 3300025912 Ga0207707_10044668 Ga0207707_100446682 238
412 3300025917 Ga0207660_10043990 Ga0207660_100439903 238
413 3300025921 Ga0207652_10053829 Ga0207652_100538293 238
414 3300025938 Ga0207704_10655900 Ga0207704_106559002 238
415 3300027252 Ga0209973_1016615 Ga0209973_10166151 238
416 3300027364 Ga0209967_1003650 Ga0209967_10036501 238
417 3300027424 Ga0209984_1003805 Ga0209984_10038053 238
418 3300027526 Ga0209968_1015596 Ga0209968_10155962 238
419 3300027552 Ga0209982_1012268 Ga0209982_10122681 238
420 3300027617 Ga0210002_1003160 Ga0210002_10031603 238
421 3300027682 Ga0209971_1008420 Ga0209971_10084202 238
422 3300027695 Ga0209966_1008081 Ga0209966_10080813 238
423 3300027717 Ga0209998_10010077 Ga0209998_100100772 238
424 3300027876 Ga0209974_10017549 Ga0209974_100175492 238
425 3300027907 Ga0207428_10252980 Ga0207428_102529802 238
426 3300046471 Ga0495650_0000015 Ga0495650_0000015_376108_376845 238
427 3300046492 Ga0495585_0000087 Ga0495585_0000087_82706_83467 238
428 3300046683 Ga0495658_0056619 Ga0495658_0056619_1065_1784 238
429 3300046684 Ga0495669_0053621 Ga0495669_0053621_1088_1804 238
430 3300047472 Ga0495686_0034620 Ga0495686_0034620_1873_2595 238
431 3300048919 Ga0496116_0077711 Ga0496116_0077711_399_1121 238
432 3300048924 Ga0496121_0162963 Ga0496121_0162963_142_864 238
433 3300049459 Ga0495678_004919 Ga0495678_004919_1187_1918 238
434 3300050492 nmdc:mga0yw44_83237_c1 nmdc:mga0yw44_83237_c1_443_1177 238
435 3300050507 nmdc:mga05p37_19730_c1 nmdc:mga05p37_19730_c1_6987_7709 238
436 3300050507 nmdc:mga05p37_250665_c1 nmdc:mga05p37_250665_c1_1097_1819 238
437 3300050507 nmdc:mga05p37_4034_c1 nmdc:mga05p37_4034_c1_8385_9107 238
438 3300050507 nmdc:mga05p37_50639_c1 nmdc:mga05p37_50639_c1_391_1122 238
439 3300050508 nmdc:mga09592_424870_c1 nmdc:mga09592_424870_c1_219_941 238
440 3300050509 nmdc:mga0qj67_206611_c1 nmdc:mga0qj67_206611_c1_308_1039 238
441 3300050510 nmdc:mga06r32_234945_c1 nmdc:mga06r32_234945_c1_423_1154 238
442 3300050511 nmdc:mga08y16_184766_c1 nmdc:mga08y16_184766_c1_732_1463 238
443 3300050513 nmdc:mga0rr50_176142_c1 nmdc:mga0rr50_176142_c1_221_943 238
444 3300050514 nmdc:mga08x19_14770_c1 nmdc:mga08x19_14770_c1_2489_3208 238
445 3300050515 nmdc:mga0a205_218871_c1 nmdc:mga0a205_218871_c1_961_1680 238
446 3300050515 nmdc:mga0a205_31686_c1 nmdc:mga0a205_31686_c1_2710_3432 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

31

223

0.87

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

95

229

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3umc-assembly1.cif.gz_C crystal structure of the l-2-haloacid dehalogenase pa0810 0.9649 7 236
3umg-assembly2.cif.gz_C crystal structure of the defluorinating l-2-haloacid dehalogenase rha0230 0.9631 7 238
3umc-assembly2.cif.gz_D crystal structure of the l-2-haloacid dehalogenase pa0810 0.9583 7 236
3umc-assembly2.cif.gz_D crystal structure of the l-2-haloacid dehalogenase pa0810 0.946 7 236
3umc-assembly1.cif.gz_C crystal structure of the l-2-haloacid dehalogenase pa0810 0.9447 7 236
ID Description Score Start End Superfamily
3umgH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9568 38 103 1.10.150.240
3umgE02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9543 38 103 1.10.150.240
3umgG02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9519 38 103 1.10.150.240
3umgF02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9511 38 103 1.10.150.240
3umgB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9491 38 103 1.10.150.240
ID Description Score Start End GO Terms
AF-A0A6J4UL76-F1-model_v4 Haloacid dehalogenase, type II (EC 3.8.1.2) 0.9926 11 152 GO:0018784
AF-A0A383CGX3-F1-model_v4 Haloacid dehalogenase, type II 0.9894 6 207 GO:0019120
AF-A0A651D9C2-F1-model_v4 Haloacid dehalogenase type II 0.989 7 210 GO:0019120
AF-A0A2D9DSW0-F1-model_v4 (S)-2-haloacid dehalogenase (EC 3.8.1.2) (2-haloalkanoic acid dehalogenase) (Halocarboxylic acid halidohydrolase) (L-2-haloacid dehalogenase) 0.9888 6 238 GO:0018784
AF-A0A5Q5BDM8-F1-model_v4 Haloacid dehalogenase, type II 0.9886 10 212 GO:0019120

Feature Viewer

pLDDT pTM Quality
95.77 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map