F445812

General Info

Members Datasets Scaffolds Average Seq Length
446 293 892 153

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0115874|Ga0496122_0115874_606_1148
Length 180
Sequence MCFALRLKTGSAWYKTSTKLEVNTMTEKCPNGAMSRELSVGEVAERSGVAVSTLHFYEEKGLIRSQRNRGNQRRYPRGILRRVAVIKVAQRTGIPLAEIAEALAVLPHDRPLTVKDWSALSGTWRRTLDERIERLTRLRDQLDGCIGCGCLSMQECPLRNPLDTLGAEGPGPRLLEPDAV

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
203 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
204 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
255 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
256 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
257 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
258 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
261 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
265 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
266 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
267 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
268 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
271 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
272 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
273 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
274 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
275 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
276 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
277 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
278 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
279 2643221583 Caulobacter sp. Root655 Isolate Unclassified
280 2643221584 Caulobacter sp. Root656 Isolate Unclassified
281 2643221640 Caulobacter sp. Root342 Isolate Unclassified
282 2643221642 Caulobacter sp. Root343 Isolate Unclassified
283 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
284 2818991435 Caulobacter henricii 536 Isolate Unclassified
285 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
286 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
287 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
288 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
289 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
290 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
291 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
292 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
293 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.62
Metatranscriptomes 0
Isolates 5.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.25
Nodule 0.67
Rhizoplane 4.04
Rhizosphere 70.4
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0115874 3300048925 Bacteria 1744
2 SwRhRL3b_contig_3460672 2162886006 Bacteria 1463
3 JGI24743J22301_10031817 3300001991 Bacteria 1040
4 JGI24735J21928_10013193 3300002067 Unclassified 2602
5 JGI24735J21928_10032008 3300002067 Bacteria 1558
6 JGI25165J46597_1000145 3300003214 Bacteria 116948
7 JGI25153J46596_10031878 3300003215 Bacteria 1767
8 rootH1_10037169 3300003316 Bacteria 3208
9 rootH2_10172638 3300003320 Bacteria 1509
10 rootH2_10256412 3300003320 Bacteria 1052
11 rootL2_10014745 3300003322 Bacteria 2880
12 Ga0055542_1003580 3300003762 Bacteria 4120
13 Ga0055536_1007336 3300003781 Bacteria 4956
14 Ga0055528_1003513 3300003790 Bacteria 7817
15 Ga0055530_10000949 3300003791 Bacteria 23707
16 Ga0055530_10049697 3300003791 Bacteria 980
17 Ga0055540_1007165 3300003792 Bacteria 4263
18 Ga0055531_10001263 3300003794 Bacteria 19144
19 Ga0055531_10001582 3300003794 Bacteria 16605
20 Ga0065165_1000911 3300005262 Bacteria 38161
21 Ga0065165_1001262 3300005262 Bacteria 28613
22 Ga0065704_10139290 3300005289 Bacteria 1535
23 Ga0065712_10000768 3300005290 Bacteria 10591
24 Ga0065715_10000251 3300005293 Bacteria 29530
25 Ga0065707_10081745 3300005295 Bacteria 52004
26 Ga0070658_10967547 3300005327 Bacteria 740
27 Ga0070676_10000066 3300005328 Bacteria 34931
28 Ga0070676_10282701 3300005328 Bacteria 1119
29 Ga0070676_10286262 3300005328 Bacteria 1112
30 Ga0068869_100035610 3300005334 Bacteria 3529
31 Ga0070666_10060423 3300005335 Bacteria 2565
32 Ga0070666_11133121 3300005335 Bacteria 582
33 Ga0068868_100014194 3300005338 Bacteria 5866
34 Ga0070660_100000641 3300005339 Bacteria 23186
35 Ga0070660_100166405 3300005339 Bacteria 1779
36 Ga0070660_100215980 3300005339 Bacteria 1558
37 Ga0070687_100688802 3300005343 Bacteria 712
38 Ga0070669_100081659 3300005353 Bacteria 2409
39 Ga0070675_100024509 3300005354 Bacteria 4832
40 Ga0070675_100387677 3300005354 Bacteria 1245
41 Ga0070671_100020827 3300005355 Bacteria 5349
42 Ga0070671_100169089 3300005355 Bacteria 1849
43 Ga0070673_100000003 3300005364 Bacteria 216759
44 Ga0070688_100072591 3300005365 Bacteria 2205
45 Ga0070659_100019622 3300005366 Bacteria 5127
46 Ga0070659_100208824 3300005366 Bacteria 1609
47 Ga0070713_100060189 3300005436 Bacteria 3174
48 Ga0070711_100030642 3300005439 Bacteria 3563
49 Ga0070700_100287553 3300005441 Bacteria 1194
50 Ga0070663_101255584 3300005455 Bacteria 652
51 Ga0070663_101712987 3300005455 Bacteria 562
52 Ga0070678_100027906 3300005456 Bacteria 3841
53 Ga0070678_100221897 3300005456 Bacteria 1571
54 Ga0070662_100409098 3300005457 Bacteria 1121
55 Ga0068867_100000001 3300005459 Bacteria 427563
56 Ga0070685_10824171 3300005466 Bacteria 686
57 Ga0070672_100008178 3300005543 Bacteria 7148
58 Ga0070672_101712106 3300005543 Bacteria 565
59 Ga0070686_101098691 3300005544 Bacteria 657
60 Ga0070693_100071029 3300005547 Bacteria 2050
61 Ga0070665_100038785 3300005548 Bacteria 4789
62 Ga0070665_101031448 3300005548 Bacteria 835
63 Ga0068855_100000273 3300005563 Bacteria 63616
64 Ga0068855_100065245 3300005563 Bacteria 4245
65 Ga0068854_100058832 3300005578 Bacteria 2776
66 Ga0068856_100010659 3300005614 Bacteria 8931
67 Ga0068852_100006648 3300005616 Bacteria 8378
68 Ga0068852_100152108 3300005616 Bacteria 2153
69 Ga0068864_100056117 3300005618 Bacteria 3403
70 Ga0068866_10249328 3300005718 Bacteria 1085
71 Ga0068866_10646264 3300005718 Bacteria 720
72 Ga0068861_100126735 3300005719 Bacteria 2067
73 Ga0068870_10743249 3300005840 Bacteria 680
74 Ga0068863_100004374 3300005841 Bacteria 13927
75 Ga0068863_100324997 3300005841 Bacteria 1495
76 Ga0068858_100043450 3300005842 Bacteria 4167
77 Ga0070716_100504269 3300006173 Bacteria 893
78 Ga0075366_10212430 3300006195 Bacteria 1178
79 Ga0075366_10367420 3300006195 Bacteria 884
80 Ga0075366_10410168 3300006195 Bacteria 834
81 Ga0097621_100110734 3300006237 Bacteria 2320
82 Ga0097621_100283483 3300006237 Bacteria 1459
83 Ga0097621_100551536 3300006237 Bacteria 1049
84 Ga0075370_10127039 3300006353 Bacteria 1486
85 Ga0068871_101032206 3300006358 Bacteria 767
86 Ga0068871_101098018 3300006358 Bacteria 744
87 Ga0068865_100000306 3300006881 Bacteria 27093
88 Ga0068865_100247436 3300006881 Bacteria 1406
89 Ga0105240_10057409 3300009093 Bacteria 4864
90 Ga0105245_10002192 3300009098 Bacteria 17700
91 Ga0105243_10000042 3300009148 Bacteria 159276
92 Ga0105243_11836002 3300009148 Bacteria 638
93 Ga0105243_11950604 3300009148 Bacteria 621
94 Ga0105241_10495836 3300009174 Bacteria 1088
95 Ga0105242_10001755 3300009176 Bacteria 17133
96 Ga0105242_10140111 3300009176 Bacteria 2098
97 Ga0105248_10011239 3300009177 Bacteria 9873
98 Ga0105248_10137549 3300009177 Bacteria 2756
99 Ga0105237_10116720 3300009545 Bacteria 2663
100 Ga0105237_10186715 3300009545 Bacteria 2073
101 Ga0105249_10008595 3300009553 Bacteria 8899
102 Ga0105249_10140187 3300009553 Bacteria 2318
103 Ga0105249_11530565 3300009553 Bacteria 739
104 Ga0105239_10069077 3300010375 Bacteria 3882
105 Ga0105239_11624430 3300010375 Bacteria 748
106 Ga0105246_10010296 3300011119 Bacteria 5779
107 Ga0157371_10739793 3300013102 Bacteria 738
108 Ga0157369_10034658 3300013105 Bacteria 5537
109 Ga0157369_10280824 3300013105 Bacteria 1734
110 Ga0157374_10000506 3300013296 Bacteria 35171
111 Ga0157378_10022370 3300013297 Bacteria 5566
112 Ga0157372_10325195 3300013307 Bacteria 1790
113 Ga0157372_10565330 3300013307 Bacteria 1325
114 Ga0157375_10002346 3300013308 Bacteria 16346
115 Ga0157375_10234980 3300013308 Bacteria 1992
116 Ga0163163_10337846 3300014325 Bacteria 1561
117 Ga0157380_11789193 3300014326 Bacteria 673
118 Ga0157377_10008554 3300014745 Bacteria 4995
119 Ga0157376_10000072 3300014969 Bacteria 77631
120 Ga0213875_10222978 3300021388 Bacteria 888
121 Ga0207427_101983 3300025231 Bacteria 6232
122 Ga0209437_122695 3300025233 Bacteria 732
123 Ga0209026_1001291 3300025250 Bacteria 11366
124 Ga0209148_1000338 3300025254 Bacteria 62960
125 Ga0209233_1000207 3300025261 Bacteria 117152
126 Ga0209565_1000717 3300025263 Bacteria 20121
127 Ga0209673_1000676 3300025273 Bacteria 49256
128 Ga0209675_1015305 3300025291 Bacteria 2287
129 Ga0209676_1022450 3300025292 Bacteria 2090
130 Ga0209025_1000171 3300025294 Bacteria 160478
131 Ga0209564_1005645 3300025295 Bacteria 7031
132 Ga0209564_1045296 3300025295 Bacteria 1133
133 Ga0209564_1067454 3300025295 Bacteria 762
134 Ga0209758_1000058 3300025297 Bacteria 331603
135 Ga0209758_1002273 3300025297 Bacteria 19899
136 Ga0209758_1004678 3300025297 Bacteria 11191
137 Ga0209758_1142058 3300025297 Bacteria 621
138 Ga0209050_1000173 3300025298 Bacteria 149800
139 Ga0209050_1033545 3300025298 Bacteria 1554
140 Ga0209256_1000983 3300025299 Bacteria 34138
141 Ga0209256_1015136 3300025299 Bacteria 2719
142 Ga0209051_1003949 3300025303 Bacteria 9443
143 Ga0209257_1000196 3300025304 Bacteria 149656
144 Ga0209257_1000264 3300025304 Bacteria 120518
145 Ga0209257_1000750 3300025304 Bacteria 49020
146 Ga0209257_1011471 3300025304 Bacteria 4263
147 Ga0207642_10177857 3300025899 Bacteria 1157
148 Ga0207680_10049653 3300025903 Bacteria 2498
149 Ga0207647_10000594 3300025904 Bacteria 28160
150 Ga0207647_10007714 3300025904 Bacteria 7748
151 Ga0207647_10019147 3300025904 Bacteria 4608
152 Ga0207645_10000454 3300025907 Bacteria 34064
153 Ga0207645_10767395 3300025907 Bacteria 656
154 Ga0207645_10827150 3300025907 Bacteria 630
155 Ga0207695_10068496 3300025913 Bacteria 3636
156 Ga0207671_10084240 3300025914 Bacteria 2388
157 Ga0207671_10095572 3300025914 Bacteria 2244
158 Ga0207663_10032361 3300025916 Bacteria 3104
159 Ga0207657_10000949 3300025919 Bacteria 30720
160 Ga0207657_10072149 3300025919 Bacteria 2921
161 Ga0207657_10107440 3300025919 Bacteria 2308
162 Ga0207681_10055585 3300025923 Bacteria 2697
163 Ga0207694_10062555 3300025924 Bacteria 2898
164 Ga0207650_10596763 3300025925 Bacteria 928
165 Ga0207687_10058613 3300025927 Bacteria 2710
166 Ga0207700_10062587 3300025928 Bacteria 2827
167 Ga0207700_10299856 3300025928 Bacteria 1387
168 Ga0207644_10013880 3300025931 Bacteria 5381
169 Ga0207690_10054678 3300025932 Bacteria 2685
170 Ga0207690_10060745 3300025932 Unclassified 2567
171 Ga0207690_10061238 3300025932 Bacteria 2558
172 Ga0207706_10043022 3300025933 Bacteria 4003
173 Ga0207686_10001150 3300025934 Bacteria 15284
174 Ga0207686_10398341 3300025934 Bacteria 1048
175 Ga0207709_10000547 3300025935 Bacteria 32231
176 Ga0207704_10000001 3300025938 Bacteria 716296
177 Ga0207704_10884286 3300025938 Bacteria 750
178 Ga0207691_10019302 3300025940 Bacteria 6452
179 Ga0207711_10021650 3300025941 Bacteria 5370
180 Ga0207711_10062511 3300025941 Bacteria 3211
181 Ga0207689_10018368 3300025942 Bacteria 5899
182 Ga0207667_10000109 3300025949 Bacteria 132054
183 Ga0207667_10046867 3300025949 Bacteria 4577
184 Ga0207651_10000002 3300025960 Bacteria 427663
185 Ga0207712_10002959 3300025961 Bacteria 10842
186 Ga0207712_10281289 3300025961 Bacteria 1358
187 Ga0207712_10985962 3300025961 Bacteria 747
188 Ga0207640_10012605 3300025981 Bacteria 4821
189 Ga0207658_10119644 3300025986 Bacteria 2097
190 Ga0207677_10004082 3300026023 Bacteria 7806
191 Ga0207703_10067238 3300026035 Bacteria 2949
192 Ga0207639_10164763 3300026041 Bacteria 1871
193 Ga0207708_10314121 3300026075 Bacteria 1277
194 Ga0207702_10004889 3300026078 Bacteria 11793
195 Ga0207702_10474878 3300026078 Bacteria 1216
196 Ga0207641_10944706 3300026088 Bacteria 857
197 Ga0207648_10000001 3300026089 Bacteria 427499
198 Ga0207676_10046834 3300026095 Bacteria 3348
199 Ga0207675_100115165 3300026118 Bacteria 2540
200 Ga0207675_101646173 3300026118 Bacteria 662
201 Ga0207683_10025114 3300026121 Bacteria 5137
202 Ga0207683_10145710 3300026121 Bacteria 2135
203 Ga0207698_10000077 3300026142 Bacteria 65551
204 Ga0268266_10190635 3300028379 Bacteria 1871
205 Ga0268264_11007406 3300028381 Bacteria 840
206 Ga0307515_10000198 3300028794 Bacteria 147738
207 Ga0307515_10048037 3300028794 Bacteria 6465
208 Ga0307513_10696318 3300031456 Unclassified 722
209 Ga0307412_10187107 3300031911 Bacteria 1563
210 Ga0307416_100165618 3300032002 Bacteria 2050
211 Ga0307415_100081697 3300032126 Bacteria 2310
212 Ga0307415_101273628 3300032126 Bacteria 695
213 Ga0307510_10191751 3300033180 Bacteria 1591
214 Ga0307510_10617559 3300033180 Bacteria 538
215 Ga0373934_0108483 3300035086 Bacteria 1125
216 Ga0373954_0152774 3300035118 Bacteria 1128
217 Ga0373955_0252659 3300035172 Bacteria 1057
218 Ga0373955_0511438 3300035172 Bacteria 734
219 Ga0373927_0263359 3300035695 Bacteria 1134
220 Ga0395899_0001983 3300037312 Bacteria 16840
221 Ga0395900_0070599 3300037418 Bacteria 3591
222 Ga0395900_0283632 3300037418 Bacteria 1647
223 Ga0395905_0064195 3300037471 Bacteria 3436
224 Ga0395905_0120982 3300037471 Bacteria 2461
225 Ga0436364_0952660 3300037853 Bacteria 7560
226 Ga0436364_1527035 3300037853 Bacteria 1651
227 Ga0436362_0940346 3300039453 Bacteria 632
228 Ga0439465_0115328 3300041413 Bacteria 938
229 Ga0451847_0032250 3300041503 Bacteria 941
230 Ga0451853_3520005 3300041512 Bacteria 1218
231 Ga0439441_028708 3300042001 Bacteria 1068
232 Ga0439445_0053791 3300042004 Bacteria 1091
233 Ga0439448_0003464 3300042005 Bacteria 4371
234 Ga0439448_0010739 3300042005 Bacteria 2720
235 Ga0439448_0039150 3300042005 Bacteria 1528
236 Ga0439450_008449 3300042008 Bacteria 1922
237 Ga0439455_0008639 3300042012 Bacteria 2188
238 Ga0439446_0051470 3300042156 Bacteria 1230
239 Ga0439458_0002530 3300042157 Bacteria 4427
240 Ga0439458_0005901 3300042157 Bacteria 2743
241 Ga0466972_0000855 3300044658 Bacteria 14603
242 Ga0466972_0001457 3300044658 Bacteria 11503
243 Ga0466965_0175864 3300044683 Bacteria 1128
244 Ga0466961_0019325 3300044693 Bacteria 4383
245 Ga0466961_0414775 3300044693 Bacteria 816
246 Ga0466963_0009451 3300044694 Bacteria 5872
247 Ga0466964_0005988 3300044706 Bacteria 4533
248 Ga0466964_0088516 3300044706 Bacteria 1343
249 Ga0466971_0388705 3300044719 Bacteria 679
250 Ga0466968_0052631 3300044735 Bacteria 1742
251 Ga0466968_0156036 3300044735 Bacteria 1051
252 Ga0466970_0310049 3300044765 Bacteria 891
253 Ga0466957_0008385 3300044842 Bacteria 5877
254 Ga0466957_0038093 3300044842 Bacteria 2896
255 Ga0466960_0006901 3300044901 Bacteria 4578
256 Ga0466959_0003043 3300045049 Bacteria 10842
257 Ga0466958_0002489 3300045836 Bacteria 9279
258 Ga0466958_0011366 3300045836 Bacteria 5015
259 Ga0466967_0026749 3300045976 Bacteria 4786
260 Ga0495627_001205 3300046453 Bacteria 16253
261 Ga0495638_0003278 3300046460 Bacteria 12761
262 Ga0495638_0016832 3300046460 Bacteria 4889
263 Ga0495638_0017708 3300046460 Bacteria 4743
264 Ga0495638_0051505 3300046460 Bacteria 2567
265 Ga0495638_0079056 3300046460 Bacteria 2001
266 Ga0495650_0000020 3300046471 Bacteria 533839
267 Ga0495584_0500285 3300046491 Bacteria 619
268 Ga0495583_0006189 3300046506 Bacteria 7879
269 Ga0495606_0073570 3300046507 Bacteria 2144
270 Ga0495606_0128414 3300046507 Bacteria 1509
271 Ga0495610_0000105 3300046512 Bacteria 98157
272 Ga0495610_0008655 3300046512 Bacteria 6555
273 Ga0495610_0137442 3300046512 Bacteria 1055
274 Ga0495616_0354665 3300046513 Bacteria 610
275 Ga0495620_0026830 3300046515 Bacteria 2704
276 Ga0495632_0009646 3300046519 Bacteria 5795
277 Ga0495637_0041665 3300046520 Bacteria 1968
278 Ga0495637_0063487 3300046520 Bacteria 1509
279 Ga0495643_0126383 3300046522 Bacteria 1287
280 Ga0495643_0214986 3300046522 Bacteria 915
281 Ga0495648_0014568 3300046524 Bacteria 5747
282 Ga0495648_0232313 3300046524 Bacteria 902
283 Ga0495666_0519351 3300046526 Unclassified 532
284 Ga0495654_0000109 3300046530 Bacteria 93356
285 Ga0495587_0490443 3300046536 Bacteria 680
286 Ga0495597_0005106 3300046542 Bacteria 7004
287 Ga0495597_0136548 3300046542 Bacteria 1014
288 Ga0495645_0834098 3300046543 Bacteria 551
289 Ga0495668_0048749 3300046616 Bacteria 2349
290 Ga0495668_0052808 3300046616 Bacteria 2248
291 Ga0495668_0097332 3300046616 Bacteria 1610
292 Ga0495668_0158045 3300046616 Bacteria 1241
293 Ga0495668_0158053 3300046616 Bacteria 1241
294 Ga0495625_0000025 3300046660 Bacteria 267383
295 Ga0495625_0005028 3300046660 Bacteria 12270
296 Ga0495625_0032857 3300046660 Bacteria 3842
297 Ga0495625_0041946 3300046660 Bacteria 3327
298 Ga0495625_0067695 3300046660 Bacteria 2512
299 Ga0495625_0090218 3300046660 Bacteria 2120
300 Ga0495625_0095993 3300046660 Bacteria 2043
301 Ga0495625_0122580 3300046660 Bacteria 1767
302 Ga0495625_0163896 3300046660 Bacteria 1487
303 Ga0495625_0790689 3300046660 Bacteria 552
304 Ga0495649_0289474 3300046694 Bacteria 836
305 Ga0495589_0005890 3300046794 Bacteria 6472
306 Ga0495660_0009631 3300046810 Bacteria 5632
307 Ga0495672_0007028 3300047320 Bacteria 8546
308 Ga0495687_055960 3300047443 Bacteria 1647
309 Ga0495685_140076 3300047447 Bacteria 788
310 Ga0495673_0000189 3300047469 Bacteria 99018
311 Ga0495681_0077512 3300047470 Bacteria 1491
312 Ga0495686_0002855 3300047472 Bacteria 15568
313 Ga0495686_0168708 3300047472 Bacteria 1274
314 Ga0496100_0245286 3300048903 Bacteria 1323
315 Ga0496101_0149946 3300048904 Bacteria 1783
316 Ga0496102_0257063 3300048905 Bacteria 1647
317 Ga0496102_0515486 3300048905 Bacteria 1118
318 Ga0496104_0025997 3300048907 Bacteria 5399
319 Ga0496104_0038655 3300048907 Bacteria 4466
320 Ga0496105_0006768 3300048908 Bacteria 8812
321 Ga0496106_0084407 3300048909 Bacteria 2444
322 Ga0496106_0311819 3300048909 Bacteria 1262
323 Ga0496107_0000019 3300048910 Bacteria 150224
324 Ga0496108_0003624 3300048911 Bacteria 12375
325 Ga0496109_0015221 3300048912 Bacteria 6697
326 Ga0496112_0028434 3300048915 Bacteria 5396
327 Ga0496113_0115240 3300048916 Bacteria 2096
328 Ga0496114_0043949 3300048917 Bacteria 3705
329 Ga0496115_0006021 3300048918 Bacteria 8856
330 Ga0496115_0037676 3300048918 Bacteria 3832
331 Ga0496115_0144603 3300048918 Bacteria 1962
332 Ga0496117_0005838 3300048920 Bacteria 12746
333 Ga0496121_0000637 3300048924 Bacteria 65479
334 Ga0496122_0000464 3300048925 Bacteria 84473
335 Ga0496123_0000147 3300048926 Bacteria 143834
336 Ga0496124_0001440 3300048927 Bacteria 35173
337 Ga0496125_0000848 3300048928 Bacteria 49020
338 Ga0496125_0002199 3300048928 Bacteria 26028
339 Ga0496125_0644829 3300048928 Bacteria 571
340 Ga0496126_0000601 3300048929 Bacteria 67983
341 Ga0496126_0020743 3300048929 Bacteria 6433
342 Ga0496126_0192195 3300048929 Bacteria 1728
343 Ga0496126_0197084 3300048929 Bacteria 1703
344 Ga0496126_0349412 3300048929 Bacteria 1210
345 Ga0496126_0797052 3300048929 Bacteria 725
346 Ga0501031_0188884 3300049568 Bacteria 1345
347 Ga0501031_0328422 3300049568 Bacteria 990
348 Ga0501031_0868932 3300049568 Bacteria 577
349 Ga0501032_0120234 3300049569 Bacteria 1736
350 Ga0501032_0472254 3300049569 Bacteria 802
351 Ga0501033_0032109 3300049570 Bacteria 3942
352 Ga0501033_0041439 3300049570 Bacteria 3435
353 Ga0501033_0233251 3300049570 Bacteria 1307
354 Ga0501034_0037381 3300049571 Bacteria 4915
355 Ga0501034_0123527 3300049571 Bacteria 2574
356 Ga0501034_0619393 3300049571 Bacteria 986
357 Ga0501034_0850280 3300049571 Bacteria 802
358 Ga0501036_0085948 3300049572 Bacteria 2659
359 Ga0501036_0615118 3300049572 Bacteria 900
360 Ga0501036_0615120 3300049572 Bacteria 900
361 Ga0501037_0026665 3300049573 Bacteria 4270
362 Ga0501037_0276960 3300049573 Bacteria 1169
363 Ga0501037_0276961 3300049573 Bacteria 1169
364 Ga0501038_0082970 3300049574 Bacteria 2698
365 Ga0501038_0093475 3300049574 Bacteria 2515
366 Ga0501038_0220946 3300049574 Bacteria 1511
367 Ga0501039_0057902 3300049575 Bacteria 3000
368 Ga0501039_0476868 3300049575 Bacteria 980
369 Ga0501040_0183522 3300049576 Bacteria 1483
370 Ga0501042_0030762 3300049578 Bacteria 3795
371 Ga0501043_0127592 3300049579 Bacteria 1994
372 Ga0501043_0183947 3300049579 Bacteria 1627
373 Ga0501046_0302196 3300049580 Bacteria 1168
374 Ga0501046_0922293 3300049580 Bacteria 608
375 Ga0501047_0419581 3300049581 Bacteria 1169
376 Ga0501047_0419586 3300049581 Bacteria 1169
377 Ga0501047_0693823 3300049581 Bacteria 836
378 Ga0501070_0234968 3300049586 Bacteria 1501
379 Ga0501070_0420472 3300049586 Bacteria 1079
380 Ga0501072_0027929 3300049588 Bacteria 4404
381 Ga0501073_0137206 3300049589 Bacteria 1695
382 Ga0501074_0253503 3300049590 Bacteria 1251
383 Ga0501238_002114 3300049671 Bacteria 2342
384 Ga0501079_0104098 3300049741 Bacteria 2202
385 Ga0501083_0228151 3300049744 Bacteria 1213
386 Ga0501241_036025 3300049758 Bacteria 947
387 Ga0501035_0035957 3300049822 Bacteria 4492
388 Ga0501035_0384770 3300049822 Bacteria 1169
389 Ga0501035_0384771 3300049822 Bacteria 1169
390 Ga0501044_0664966 3300049823 Bacteria 929
391 Ga0501044_1074826 3300049823 Bacteria 674
392 Ga0501045_0129653 3300049824 Bacteria 1874
393 nmdc:mga0k408_210015_c1 3300050493 Bacteria 1162
394 nmdc:mga0k408_230395_c1 3300050493 Bacteria 1106
395 nmdc:mga07m45_201265_c1 3300050496 Bacteria 1158
396 Ga0495619_0423172 3300053085 Bacteria 919
397 Ga0500643_013607 3300053087 Bacteria 2867
398 Ga0500651_0323019 3300053093 Bacteria 881
399 Ga0500554_002438 3300053102 Bacteria 3659
400 Ga0500556_0000111 3300053104 Bacteria 72589
401 Ga0500556_0001018 3300053104 Bacteria 14667
402 Ga0500597_227737 3300053120 Bacteria 772
403 Ga0500608_000162 3300053122 Bacteria 27771
404 Ga0500614_009446 3300053123 Bacteria 2081
405 Ga0500658_0003442 3300053134 Bacteria 5973
406 Ga0500559_0016615 3300053136 Bacteria 3108
407 Ga0500577_0000938 3300053142 Bacteria 7564
408 Ga0500616_0001634 3300053153 Bacteria 20765
409 Ga0500616_0160422 3300053153 Bacteria 1032
410 Ga0500616_0195049 3300053153 Bacteria 901
411 Ga0500622_0004239 3300053156 Bacteria 9123
412 Ga0500622_0008932 3300053156 Bacteria 5572
413 Ga0500622_0013975 3300053156 Bacteria 4318
414 Ga0500622_0071998 3300053156 Bacteria 1746
415 Ga0500627_0042230 3300053158 Bacteria 1962
416 Ga0500634_0135591 3300053161 Bacteria 1175
417 Ga0500611_001738 3300053727 Bacteria 2470
418 Ga0500645_001289 3300053730 Bacteria 13079
419 Ga0500645_008346 3300053730 Bacteria 3544
420 Ga0500609_000113 3300053731 Bacteria 10669
421 Ga0466962_0000985 3300061719 Bacteria 12977
422 Ga0466962_0131043 3300061719 Bacteria 1212
423 2511122149 2510917020 Bacteria 5657507
424 2511172097 2510917026 Bacteria 7046020
425 2585155083 2582581280 Bacteria 5994497
426 2585199089 2582581293 Bacteria 5907401
427 2585996633 2585427633 Bacteria 6413184
428 2586001158 2585427634 Bacteria 6455027
429 2587916876 2585428106 Bacteria 5179711
430 2643750666 2643221545 Bacteria 5083237
431 2643782060 2643221552 Bacteria 5708754
432 2643926247 2643221583 Bacteria 5218014
433 2643927859 2643221584 Bacteria 5511711
434 2644225597 2643221640 Bacteria 5258820
435 2644234988 2643221642 Bacteria 5357871
436 2644509740 2643221691 Bacteria 5093099
437 2819535949 2818991435 Bacteria 5433759
438 2819646181 2818991454 Bacteria 5563326
439 2854901300 2854896431 Bacteria 5869725
440 2854918677 2854916844 Bacteria 5725939
441 2891373547 2891373044 Bacteria 5202277
442 2919172918 2919171160 Bacteria 6499771
443 2928535503 2928531327 Bacteria 5101314
444 2989350019 2989349275 Bacteria 6349068
445 3002145525 3002141150 Bacteria 5254435
446 8054561028 8054558443 Bacteria 5204801
447 Ga0496122_0115874
448 SwRhRL3b_contig_3460672
449 JGI24743J22301_10031817
450 JGI24735J21928_10013193
451 JGI24735J21928_10032008
452 JGI25165J46597_1000145
453 JGI25153J46596_10031878
454 rootH1_10037169
455 rootH2_10172638
456 rootH2_10256412
457 rootL2_10014745
458 Ga0055542_1003580
459 Ga0055536_1007336
460 Ga0055528_1003513
461 Ga0055530_10000949
462 Ga0055530_10049697
463 Ga0055540_1007165
464 Ga0055531_10001263
465 Ga0055531_10001582
466 Ga0065165_1000911
467 Ga0065165_1001262
468 Ga0065704_10139290
469 Ga0065712_10000768
470 Ga0065715_10000251
471 Ga0065707_10081745
472 Ga0070658_10967547
473 Ga0070676_10000066
474 Ga0070676_10282701
475 Ga0070676_10286262
476 Ga0068869_100035610
477 Ga0070666_10060423
478 Ga0070666_11133121
479 Ga0068868_100014194
480 Ga0070660_100000641
481 Ga0070660_100166405
482 Ga0070660_100215980
483 Ga0070687_100688802
484 Ga0070669_100081659
485 Ga0070675_100024509
486 Ga0070675_100387677
487 Ga0070671_100020827
488 Ga0070671_100169089
489 Ga0070673_100000003
490 Ga0070688_100072591
491 Ga0070659_100019622
492 Ga0070659_100208824
493 Ga0070713_100060189
494 Ga0070711_100030642
495 Ga0070700_100287553
496 Ga0070663_101255584
497 Ga0070663_101712987
498 Ga0070678_100027906
499 Ga0070678_100221897
500 Ga0070662_100409098
501 Ga0068867_100000001
502 Ga0070685_10824171
503 Ga0070672_100008178
504 Ga0070672_101712106
505 Ga0070686_101098691
506 Ga0070693_100071029
507 Ga0070665_100038785
508 Ga0070665_101031448
509 Ga0068855_100000273
510 Ga0068855_100065245
511 Ga0068854_100058832
512 Ga0068856_100010659
513 Ga0068852_100006648
514 Ga0068852_100152108
515 Ga0068864_100056117
516 Ga0068866_10249328
517 Ga0068866_10646264
518 Ga0068861_100126735
519 Ga0068870_10743249
520 Ga0068863_100004374
521 Ga0068863_100324997
522 Ga0068858_100043450
523 Ga0070716_100504269
524 Ga0075366_10212430
525 Ga0075366_10367420
526 Ga0075366_10410168
527 Ga0097621_100110734
528 Ga0097621_100283483
529 Ga0097621_100551536
530 Ga0075370_10127039
531 Ga0068871_101032206
532 Ga0068871_101098018
533 Ga0068865_100000306
534 Ga0068865_100247436
535 Ga0105240_10057409
536 Ga0105245_10002192
537 Ga0105243_10000042
538 Ga0105243_11836002
539 Ga0105243_11950604
540 Ga0105241_10495836
541 Ga0105242_10001755
542 Ga0105242_10140111
543 Ga0105248_10011239
544 Ga0105248_10137549
545 Ga0105237_10116720
546 Ga0105237_10186715
547 Ga0105249_10008595
548 Ga0105249_10140187
549 Ga0105249_11530565
550 Ga0105239_10069077
551 Ga0105239_11624430
552 Ga0105246_10010296
553 Ga0157371_10739793
554 Ga0157369_10034658
555 Ga0157369_10280824
556 Ga0157374_10000506
557 Ga0157378_10022370
558 Ga0157372_10325195
559 Ga0157372_10565330
560 Ga0157375_10002346
561 Ga0157375_10234980
562 Ga0163163_10337846
563 Ga0157380_11789193
564 Ga0157377_10008554
565 Ga0157376_10000072
566 Ga0213875_10222978
567 Ga0207427_101983
568 Ga0209437_122695
569 Ga0209026_1001291
570 Ga0209148_1000338
571 Ga0209233_1000207
572 Ga0209565_1000717
573 Ga0209673_1000676
574 Ga0209675_1015305
575 Ga0209676_1022450
576 Ga0209025_1000171
577 Ga0209564_1005645
578 Ga0209564_1045296
579 Ga0209564_1067454
580 Ga0209758_1000058
581 Ga0209758_1002273
582 Ga0209758_1004678
583 Ga0209758_1142058
584 Ga0209050_1000173
585 Ga0209050_1033545
586 Ga0209256_1000983
587 Ga0209256_1015136
588 Ga0209051_1003949
589 Ga0209257_1000196
590 Ga0209257_1000264
591 Ga0209257_1000750
592 Ga0209257_1011471
593 Ga0207642_10177857
594 Ga0207680_10049653
595 Ga0207647_10000594
596 Ga0207647_10007714
597 Ga0207647_10019147
598 Ga0207645_10000454
599 Ga0207645_10767395
600 Ga0207645_10827150
601 Ga0207695_10068496
602 Ga0207671_10084240
603 Ga0207671_10095572
604 Ga0207663_10032361
605 Ga0207657_10000949
606 Ga0207657_10072149
607 Ga0207657_10107440
608 Ga0207681_10055585
609 Ga0207694_10062555
610 Ga0207650_10596763
611 Ga0207687_10058613
612 Ga0207700_10062587
613 Ga0207700_10299856
614 Ga0207644_10013880
615 Ga0207690_10054678
616 Ga0207690_10060745
617 Ga0207690_10061238
618 Ga0207706_10043022
619 Ga0207686_10001150
620 Ga0207686_10398341
621 Ga0207709_10000547
622 Ga0207704_10000001
623 Ga0207704_10884286
624 Ga0207691_10019302
625 Ga0207711_10021650
626 Ga0207711_10062511
627 Ga0207689_10018368
628 Ga0207667_10000109
629 Ga0207667_10046867
630 Ga0207651_10000002
631 Ga0207712_10002959
632 Ga0207712_10281289
633 Ga0207712_10985962
634 Ga0207640_10012605
635 Ga0207658_10119644
636 Ga0207677_10004082
637 Ga0207703_10067238
638 Ga0207639_10164763
639 Ga0207708_10314121
640 Ga0207702_10004889
641 Ga0207702_10474878
642 Ga0207641_10944706
643 Ga0207648_10000001
644 Ga0207676_10046834
645 Ga0207675_100115165
646 Ga0207675_101646173
647 Ga0207683_10025114
648 Ga0207683_10145710
649 Ga0207698_10000077
650 Ga0268266_10190635
651 Ga0268264_11007406
652 Ga0307515_10000198
653 Ga0307515_10048037
654 Ga0307513_10696318
655 Ga0307412_10187107
656 Ga0307416_100165618
657 Ga0307415_100081697
658 Ga0307415_101273628
659 Ga0307510_10191751
660 Ga0307510_10617559
661 Ga0373934_0108483
662 Ga0373954_0152774
663 Ga0373955_0252659
664 Ga0373955_0511438
665 Ga0373927_0263359
666 Ga0395899_0001983
667 Ga0395900_0070599
668 Ga0395900_0283632
669 Ga0395905_0064195
670 Ga0395905_0120982
671 Ga0436364_0952660
672 Ga0436364_1527035
673 Ga0436362_0940346
674 Ga0439465_0115328
675 Ga0451847_0032250
676 Ga0451853_3520005
677 Ga0439441_028708
678 Ga0439445_0053791
679 Ga0439448_0003464
680 Ga0439448_0010739
681 Ga0439448_0039150
682 Ga0439450_008449
683 Ga0439455_0008639
684 Ga0439446_0051470
685 Ga0439458_0002530
686 Ga0439458_0005901
687 Ga0466972_0000855
688 Ga0466972_0001457
689 Ga0466965_0175864
690 Ga0466961_0019325
691 Ga0466961_0414775
692 Ga0466963_0009451
693 Ga0466964_0005988
694 Ga0466964_0088516
695 Ga0466971_0388705
696 Ga0466968_0052631
697 Ga0466968_0156036
698 Ga0466970_0310049
699 Ga0466957_0008385
700 Ga0466957_0038093
701 Ga0466960_0006901
702 Ga0466959_0003043
703 Ga0466958_0002489
704 Ga0466958_0011366
705 Ga0466967_0026749
706 Ga0495627_001205
707 Ga0495638_0003278
708 Ga0495638_0016832
709 Ga0495638_0017708
710 Ga0495638_0051505
711 Ga0495638_0079056
712 Ga0495650_0000020
713 Ga0495584_0500285
714 Ga0495583_0006189
715 Ga0495606_0073570
716 Ga0495606_0128414
717 Ga0495610_0000105
718 Ga0495610_0008655
719 Ga0495610_0137442
720 Ga0495616_0354665
721 Ga0495620_0026830
722 Ga0495632_0009646
723 Ga0495637_0041665
724 Ga0495637_0063487
725 Ga0495643_0126383
726 Ga0495643_0214986
727 Ga0495648_0014568
728 Ga0495648_0232313
729 Ga0495666_0519351
730 Ga0495654_0000109
731 Ga0495587_0490443
732 Ga0495597_0005106
733 Ga0495597_0136548
734 Ga0495645_0834098
735 Ga0495668_0048749
736 Ga0495668_0052808
737 Ga0495668_0097332
738 Ga0495668_0158045
739 Ga0495668_0158053
740 Ga0495625_0000025
741 Ga0495625_0005028
742 Ga0495625_0032857
743 Ga0495625_0041946
744 Ga0495625_0067695
745 Ga0495625_0090218
746 Ga0495625_0095993
747 Ga0495625_0122580
748 Ga0495625_0163896
749 Ga0495625_0790689
750 Ga0495649_0289474
751 Ga0495589_0005890
752 Ga0495660_0009631
753 Ga0495672_0007028
754 Ga0495687_055960
755 Ga0495685_140076
756 Ga0495673_0000189
757 Ga0495681_0077512
758 Ga0495686_0002855
759 Ga0495686_0168708
760 Ga0496100_0245286
761 Ga0496101_0149946
762 Ga0496102_0257063
763 Ga0496102_0515486
764 Ga0496104_0025997
765 Ga0496104_0038655
766 Ga0496105_0006768
767 Ga0496106_0084407
768 Ga0496106_0311819
769 Ga0496107_0000019
770 Ga0496108_0003624
771 Ga0496109_0015221
772 Ga0496112_0028434
773 Ga0496113_0115240
774 Ga0496114_0043949
775 Ga0496115_0006021
776 Ga0496115_0037676
777 Ga0496115_0144603
778 Ga0496117_0005838
779 Ga0496121_0000637
780 Ga0496122_0000464
781 Ga0496123_0000147
782 Ga0496124_0001440
783 Ga0496125_0000848
784 Ga0496125_0002199
785 Ga0496125_0644829
786 Ga0496126_0000601
787 Ga0496126_0020743
788 Ga0496126_0192195
789 Ga0496126_0197084
790 Ga0496126_0349412
791 Ga0496126_0797052
792 Ga0501031_0188884
793 Ga0501031_0328422
794 Ga0501031_0868932
795 Ga0501032_0120234
796 Ga0501032_0472254
797 Ga0501033_0032109
798 Ga0501033_0041439
799 Ga0501033_0233251
800 Ga0501034_0037381
801 Ga0501034_0123527
802 Ga0501034_0619393
803 Ga0501034_0850280
804 Ga0501036_0085948
805 Ga0501036_0615118
806 Ga0501036_0615120
807 Ga0501037_0026665
808 Ga0501037_0276960
809 Ga0501037_0276961
810 Ga0501038_0082970
811 Ga0501038_0093475
812 Ga0501038_0220946
813 Ga0501039_0057902
814 Ga0501039_0476868
815 Ga0501040_0183522
816 Ga0501042_0030762
817 Ga0501043_0127592
818 Ga0501043_0183947
819 Ga0501046_0302196
820 Ga0501046_0922293
821 Ga0501047_0419581
822 Ga0501047_0419586
823 Ga0501047_0693823
824 Ga0501070_0234968
825 Ga0501070_0420472
826 Ga0501072_0027929
827 Ga0501073_0137206
828 Ga0501074_0253503
829 Ga0501238_002114
830 Ga0501079_0104098
831 Ga0501083_0228151
832 Ga0501241_036025
833 Ga0501035_0035957
834 Ga0501035_0384770
835 Ga0501035_0384771
836 Ga0501044_0664966
837 Ga0501044_1074826
838 Ga0501045_0129653
839 nmdc:mga0k408_210015_c1
840 nmdc:mga0k408_230395_c1
841 nmdc:mga07m45_201265_c1
842 Ga0495619_0423172
843 Ga0500643_013607
844 Ga0500651_0323019
845 Ga0500554_002438
846 Ga0500556_0000111
847 Ga0500556_0001018
848 Ga0500597_227737
849 Ga0500608_000162
850 Ga0500614_009446
851 Ga0500658_0003442
852 Ga0500559_0016615
853 Ga0500577_0000938
854 Ga0500616_0001634
855 Ga0500616_0160422
856 Ga0500616_0195049
857 Ga0500622_0004239
858 Ga0500622_0008932
859 Ga0500622_0013975
860 Ga0500622_0071998
861 Ga0500627_0042230
862 Ga0500634_0135591
863 Ga0500611_001738
864 Ga0500645_001289
865 Ga0500645_008346
866 Ga0500609_000113
867 Ga0466962_0000985
868 Ga0466962_0131043
869 2511122149
870 2511172097
871 2585155083
872 2585199089
873 2585996633
874 2586001158
875 2587916876
876 2643750666
877 2643782060
878 2643926247
879 2643927859
880 2644225597
881 2644234988
882 2644509740
883 2819535949
884 2819646181
885 2854901300
886 2854918677
887 2891373547
888 2919172918
889 2928535503
890 2989350019
891 3002145525
892 8054561028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

39

75

0.98

PF09278

MerR-DNA-bind

MerR, DNA binding

80

145

0.98

PF13411

MerR_1

MerR HTH family regulatory protein

38

106

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v9p-assembly1.cif.gz_A crystal structure of the transposition protein tniq 0.9595 13 41
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9206 12 80
2dg6-assembly1.cif.gz_A-2 crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) 0.9044 14 79
7tec-assembly1.cif.gz_A-2 structure of the listeria monocytogenes glnr-dna complex to 3.45 angstrom 0.9038 14 73
4r4e-assembly1.cif.gz_A structure of glnr-dna complex 0.9022 12 77
ID Description Score Start End Superfamily
4r22B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9344 12 81 1.10.1660.10
3iaoA01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.915 12 78 1.10.1660.10
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9118 13 75 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9072 13 82 1.10.1660.10
4r4eA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9022 12 77 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A3D2SIZ7-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9799 8 79 GO:0003677
GO:0003700
AF-A0A6F8THA8-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.966 14 107 GO:0003677
GO:0003700
GO:0006979
GO:0051537
AF-A0A1G8TM52-F1-model_v4 deleted 0.9646 14 117
AF-A0A0B8P4B7-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9645 14 107 GO:0003677
GO:0003700
GO:0006979
GO:0051537
AF-A0A3S2AX50-F1-model_v4 deleted 0.9623 8 112

Map