F445826
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 446 | 297 | 441 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300053121|Ga0500607_018257|Ga0500607_018257_1774_2340 |
| Length | 188 |
| Sequence | MAHAQSPFLVLLDWAKTRDDEVLSNPCIQGLSMSHRIDYTQASPEGYKAFGGVYLALQKSGLPKELVDLVYLRISQINGCAYCIDMHSRDLLKGGLAVDKLVLVAVWQDGGAVFSRRERAALAWAESVTRVSDTGVPDADYDAAAAEFSAKELADLTYAIGLMNAFNRLGISFRVAPAAAVAVAAVRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 2 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 3 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 4 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 181 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 188 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 189 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 190 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 191 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 192 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 193 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 194 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 195 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 198 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 254 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 255 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 256 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 257 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 258 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 259 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 260 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 261 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 262 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 266 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 267 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 268 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 269 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 271 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 278 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 279 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 280 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 281 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 282 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 283 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 284 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 285 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 288 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 289 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 290 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 291 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 292 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 293 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 294 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 295 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 296 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 297 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.88 |
| Metatranscriptomes | 0 |
| Isolates | 1.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.26 |
| Nodule | 0.22 |
| Rhizoplane | 5.83 |
| Rhizosphere | 64.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1023845 | 3300001976 | Bacteria | 801 |
| 2 | JGI24746J21847_1017415 | 3300001977 | Bacteria | 1020 |
| 3 | JGI24739J22299_10015538 | 3300001989 | Bacteria | 2766 |
| 4 | JGI24737J22298_10067516 | 3300001990 | Bacteria | 1070 |
| 5 | JGI24735J21928_10039107 | 3300002067 | Bacteria | 1388 |
| 6 | JGI24750J21931_1001982 | 3300002070 | Bacteria | 2503 |
| 7 | JGI24745J21846_1018551 | 3300002073 | Bacteria | 812 |
| 8 | JGI24738J21930_10003669 | 3300002075 | Bacteria | 3847 |
| 9 | JGI24738J21930_10018854 | 3300002075 | Bacteria | 1441 |
| 10 | JGI24749J21850_1022612 | 3300002076 | Bacteria | 892 |
| 11 | JGI24033J26618_1006109 | 3300002155 | Bacteria | 1344 |
| 12 | JGI24034J26672_10023543 | 3300002239 | Bacteria | 978 |
| 13 | JGI24742J22300_10014170 | 3300002244 | Bacteria | 1338 |
| 14 | JGI24751J29686_10027951 | 3300002459 | Bacteria | 1172 |
| 15 | JGI25162J39368_1001062 | 3300002737 | Bacteria | 16806 |
| 16 | JGI25151J46595_10004295 | 3300003187 | Bacteria | 7570 |
| 17 | Ga0055527_1009166 | 3300003760 | Bacteria | 1167 |
| 18 | Ga0055542_1000010 | 3300003762 | Bacteria | 414813 |
| 19 | Ga0055530_10001599 | 3300003791 | Bacteria | 16226 |
| 20 | Ga0055540_1000056 | 3300003792 | Bacteria | 139732 |
| 21 | Ga0055531_10012262 | 3300003794 | Bacteria | 4048 |
| 22 | Ga0070658_10204975 | 3300005327 | Bacteria | 1665 |
| 23 | Ga0070676_10210736 | 3300005328 | Bacteria | 1279 |
| 24 | Ga0070690_100101277 | 3300005330 | Bacteria | 1910 |
| 25 | Ga0070670_100042416 | 3300005331 | Bacteria | 3911 |
| 26 | Ga0070677_10140089 | 3300005333 | Bacteria | 1114 |
| 27 | Ga0068869_100048596 | 3300005334 | Bacteria | 3068 |
| 28 | Ga0068869_100691029 | 3300005334 | Bacteria | 869 |
| 29 | Ga0070666_10174239 | 3300005335 | Bacteria | 1507 |
| 30 | Ga0070666_10416434 | 3300005335 | Bacteria | 967 |
| 31 | Ga0070682_100195956 | 3300005337 | Bacteria | 1422 |
| 32 | Ga0068868_100042826 | 3300005338 | Bacteria | 3535 |
| 33 | Ga0068868_101660059 | 3300005338 | Bacteria | 601 |
| 34 | Ga0070689_100410619 | 3300005340 | Bacteria | 1146 |
| 35 | Ga0070691_10388471 | 3300005341 | Bacteria | 784 |
| 36 | Ga0070687_100183622 | 3300005343 | Bacteria | 1255 |
| 37 | Ga0070661_100137991 | 3300005344 | Bacteria | 1836 |
| 38 | Ga0070692_10182889 | 3300005345 | Bacteria | 1216 |
| 39 | Ga0070668_100006813 | 3300005347 | Bacteria | 8472 |
| 40 | Ga0070668_100030063 | 3300005347 | Bacteria | 4129 |
| 41 | Ga0070669_100006637 | 3300005353 | Bacteria | 8333 |
| 42 | Ga0070669_100127067 | 3300005353 | Bacteria | 1952 |
| 43 | Ga0070669_101094375 | 3300005353 | Bacteria | 686 |
| 44 | Ga0070675_100058955 | 3300005354 | Bacteria | 3166 |
| 45 | Ga0070675_100137223 | 3300005354 | Bacteria | 2088 |
| 46 | Ga0070671_100363318 | 3300005355 | Bacteria | 1236 |
| 47 | Ga0070674_100041390 | 3300005356 | Bacteria | 3122 |
| 48 | Ga0070674_100053461 | 3300005356 | Bacteria | 2789 |
| 49 | Ga0070673_100115562 | 3300005364 | Bacteria | 2231 |
| 50 | Ga0070688_100009530 | 3300005365 | Bacteria | 5318 |
| 51 | Ga0070659_100184742 | 3300005366 | Bacteria | 1712 |
| 52 | Ga0070667_100188906 | 3300005367 | Bacteria | 1824 |
| 53 | Ga0070709_10056690 | 3300005434 | Bacteria | 2478 |
| 54 | Ga0070713_100079932 | 3300005436 | Bacteria | 2787 |
| 55 | Ga0070713_100276197 | 3300005436 | Bacteria | 1540 |
| 56 | Ga0070701_10020471 | 3300005438 | Bacteria | 3142 |
| 57 | Ga0070711_100035079 | 3300005439 | Bacteria | 3351 |
| 58 | Ga0070705_100078772 | 3300005440 | Bacteria | 2016 |
| 59 | Ga0070700_100160416 | 3300005441 | Bacteria | 1547 |
| 60 | Ga0070663_100058035 | 3300005455 | Bacteria | 2778 |
| 61 | Ga0070678_100064287 | 3300005456 | Bacteria | 2719 |
| 62 | Ga0070678_100948650 | 3300005456 | Bacteria | 788 |
| 63 | Ga0070662_100107482 | 3300005457 | Bacteria | 2121 |
| 64 | Ga0070662_100117561 | 3300005457 | Bacteria | 2034 |
| 65 | Ga0070662_100502811 | 3300005457 | Bacteria | 1011 |
| 66 | Ga0068867_100148739 | 3300005459 | Bacteria | 1838 |
| 67 | Ga0068867_100240270 | 3300005459 | Bacteria | 1468 |
| 68 | Ga0068867_100255308 | 3300005459 | Bacteria | 1427 |
| 69 | Ga0070685_10037468 | 3300005466 | Bacteria | 2746 |
| 70 | Ga0068853_100224682 | 3300005539 | Bacteria | 1716 |
| 71 | Ga0068853_100964050 | 3300005539 | Bacteria | 820 |
| 72 | Ga0070672_100019816 | 3300005543 | Bacteria | 4892 |
| 73 | Ga0070672_100046116 | 3300005543 | Bacteria | 3376 |
| 74 | Ga0070665_100026867 | 3300005548 | Bacteria | 5798 |
| 75 | Ga0070665_100091272 | 3300005548 | Bacteria | 3051 |
| 76 | Ga0070665_100256273 | 3300005548 | Bacteria | 1750 |
| 77 | Ga0070665_101287928 | 3300005548 | Bacteria | 741 |
| 78 | Ga0068855_101267803 | 3300005563 | Bacteria | 764 |
| 79 | Ga0068857_100495563 | 3300005577 | Bacteria | 1146 |
| 80 | Ga0068854_100345331 | 3300005578 | Bacteria | 1216 |
| 81 | Ga0068854_100796771 | 3300005578 | Bacteria | 823 |
| 82 | Ga0068856_100147693 | 3300005614 | Bacteria | 2359 |
| 83 | Ga0070702_100167949 | 3300005615 | Bacteria | 1424 |
| 84 | Ga0068852_100053731 | 3300005616 | Bacteria | 3469 |
| 85 | Ga0068859_100423518 | 3300005617 | Bacteria | 1427 |
| 86 | Ga0068864_100251097 | 3300005618 | Bacteria | 1642 |
| 87 | Ga0068864_101630587 | 3300005618 | Bacteria | 649 |
| 88 | Ga0068866_10038498 | 3300005718 | Bacteria | 2355 |
| 89 | Ga0068861_100060727 | 3300005719 | Bacteria | 2898 |
| 90 | Ga0068861_100124247 | 3300005719 | Bacteria | 2086 |
| 91 | Ga0068870_10028839 | 3300005840 | Bacteria | 2790 |
| 92 | Ga0068863_100029436 | 3300005841 | Bacteria | 5242 |
| 93 | Ga0068858_100063771 | 3300005842 | Bacteria | 3409 |
| 94 | Ga0068860_100077104 | 3300005843 | Bacteria | 3169 |
| 95 | Ga0068860_100636138 | 3300005843 | Bacteria | 1074 |
| 96 | Ga0081455_10469329 | 3300005937 | Bacteria | 854 |
| 97 | Ga0075368_10033927 | 3300006042 | Bacteria | 1987 |
| 98 | Ga0075363_100233180 | 3300006048 | Bacteria | 1057 |
| 99 | Ga0070715_10203514 | 3300006163 | Bacteria | 1007 |
| 100 | Ga0070716_100272227 | 3300006173 | Bacteria | 1164 |
| 101 | Ga0070712_100188118 | 3300006175 | Bacteria | 1613 |
| 102 | Ga0075367_10013704 | 3300006178 | Bacteria | 4368 |
| 103 | Ga0075367_10038432 | 3300006178 | Bacteria | 2786 |
| 104 | Ga0075367_10785812 | 3300006178 | Bacteria | 606 |
| 105 | Ga0075369_10290727 | 3300006186 | Bacteria | 762 |
| 106 | Ga0075366_10338163 | 3300006195 | Bacteria | 923 |
| 107 | Ga0097621_100090634 | 3300006237 | Bacteria | 2558 |
| 108 | Ga0075370_10015476 | 3300006353 | Bacteria | 4085 |
| 109 | Ga0068865_100508258 | 3300006881 | Bacteria | 1006 |
| 110 | Ga0097620_100423553 | 3300006931 | Bacteria | 1427 |
| 111 | Ga0105244_10031275 | 3300009036 | Bacteria | 2825 |
| 112 | Ga0105240_10069967 | 3300009093 | Bacteria | 4342 |
| 113 | Ga0111539_10126189 | 3300009094 | Bacteria | 2998 |
| 114 | Ga0105245_10182172 | 3300009098 | Bacteria | 2008 |
| 115 | Ga0105247_10012867 | 3300009101 | Bacteria | 5022 |
| 116 | Ga0105243_10085068 | 3300009148 | Bacteria | 2592 |
| 117 | Ga0105243_10283198 | 3300009148 | Bacteria | 1494 |
| 118 | Ga0105248_10417017 | 3300009177 | Bacteria | 1512 |
| 119 | Ga0105248_10709749 | 3300009177 | Bacteria | 1135 |
| 120 | Ga0105238_10431975 | 3300009551 | Bacteria | 1313 |
| 121 | Ga0105249_10111341 | 3300009553 | Bacteria | 2589 |
| 122 | Ga0105239_10198284 | 3300010375 | Bacteria | 2248 |
| 123 | Ga0105246_10023003 | 3300011119 | Bacteria | 4028 |
| 124 | Ga0105246_10026587 | 3300011119 | Bacteria | 3783 |
| 125 | Ga0157347_1000351 | 3300012502 | Bacteria | 2877 |
| 126 | Ga0157373_10259846 | 3300013100 | Bacteria | 1229 |
| 127 | Ga0157373_10602591 | 3300013100 | Bacteria | 800 |
| 128 | Ga0157369_10127399 | 3300013105 | Bacteria | 2698 |
| 129 | Ga0157374_10086114 | 3300013296 | Bacteria | 2989 |
| 130 | Ga0157378_10387985 | 3300013297 | Bacteria | 1373 |
| 131 | Ga0163162_10043498 | 3300013306 | Bacteria | 4498 |
| 132 | Ga0163162_10219622 | 3300013306 | Bacteria | 2031 |
| 133 | Ga0157375_10099447 | 3300013308 | Bacteria | 2988 |
| 134 | Ga0157375_11142081 | 3300013308 | Bacteria | 913 |
| 135 | Ga0157380_10071341 | 3300014326 | Bacteria | 2810 |
| 136 | Ga0157380_10207229 | 3300014326 | Bacteria | 1744 |
| 137 | Ga0157377_10010298 | 3300014745 | Bacteria | 4622 |
| 138 | Ga0157376_10053039 | 3300014969 | Bacteria | 3374 |
| 139 | Ga0163161_10041462 | 3300017792 | Bacteria | 3307 |
| 140 | Ga0163161_10087485 | 3300017792 | Bacteria | 2301 |
| 141 | Ga0163161_10411449 | 3300017792 | Bacteria | 1086 |
| 142 | Ga0209672_100149 | 3300025228 | Bacteria | 62756 |
| 143 | Ga0207427_100581 | 3300025231 | Bacteria | 18457 |
| 144 | Ga0209437_100180 | 3300025233 | Bacteria | 133661 |
| 145 | Ga0209258_115862 | 3300025242 | Bacteria | 852 |
| 146 | Ga0209026_1003397 | 3300025250 | Bacteria | 5251 |
| 147 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 148 | Ga0209148_1000927 | 3300025254 | Bacteria | 19411 |
| 149 | Ga0209455_1001132 | 3300025272 | Bacteria | 12947 |
| 150 | Ga0209675_1003885 | 3300025291 | Bacteria | 6875 |
| 151 | Ga0209676_1015207 | 3300025292 | Bacteria | 2844 |
| 152 | Ga0209025_1000038 | 3300025294 | Bacteria | 380508 |
| 153 | Ga0209025_1026751 | 3300025294 | Bacteria | 2884 |
| 154 | Ga0209025_1090166 | 3300025294 | Bacteria | 1005 |
| 155 | Ga0209050_1001130 | 3300025298 | Bacteria | 32162 |
| 156 | Ga0209050_1011411 | 3300025298 | Bacteria | 4217 |
| 157 | Ga0209051_1000068 | 3300025303 | Bacteria | 220063 |
| 158 | Ga0209051_1132710 | 3300025303 | Bacteria | 612 |
| 159 | Ga0209257_1000146 | 3300025304 | Bacteria | 194261 |
| 160 | Ga0209257_1008862 | 3300025304 | Bacteria | 5554 |
| 161 | Ga0209257_1133174 | 3300025304 | Bacteria | 567 |
| 162 | Ga0207682_10045433 | 3300025893 | Bacteria | 1802 |
| 163 | Ga0207642_10011487 | 3300025899 | Bacteria | 3162 |
| 164 | Ga0207710_10142775 | 3300025900 | Bacteria | 1157 |
| 165 | Ga0207688_10000265 | 3300025901 | Bacteria | 23890 |
| 166 | Ga0207647_10030013 | 3300025904 | Bacteria | 3512 |
| 167 | Ga0207685_10043877 | 3300025905 | Bacteria | 1688 |
| 168 | Ga0207699_10098813 | 3300025906 | Bacteria | 1848 |
| 169 | Ga0207645_10264745 | 3300025907 | Bacteria | 1139 |
| 170 | Ga0207643_10004823 | 3300025908 | Bacteria | 7222 |
| 171 | Ga0207654_10145209 | 3300025911 | Bacteria | 1517 |
| 172 | Ga0207695_10000623 | 3300025913 | Bacteria | 71205 |
| 173 | Ga0207695_10099902 | 3300025913 | Bacteria | 2898 |
| 174 | Ga0207693_10055814 | 3300025915 | Bacteria | 3098 |
| 175 | Ga0207663_10109893 | 3300025916 | Bacteria | 1869 |
| 176 | Ga0207662_10387133 | 3300025918 | Bacteria | 946 |
| 177 | Ga0207657_10509204 | 3300025919 | Bacteria | 943 |
| 178 | Ga0207649_10363048 | 3300025920 | Bacteria | 1075 |
| 179 | Ga0207694_10039780 | 3300025924 | Bacteria | 3619 |
| 180 | Ga0207650_10119381 | 3300025925 | Bacteria | 2051 |
| 181 | Ga0207659_10053643 | 3300025926 | Bacteria | 2876 |
| 182 | Ga0207659_10637084 | 3300025926 | Bacteria | 910 |
| 183 | Ga0207687_10092657 | 3300025927 | Bacteria | 2207 |
| 184 | Ga0207700_10512299 | 3300025928 | Bacteria | 1062 |
| 185 | Ga0207700_10555359 | 3300025928 | Bacteria | 1019 |
| 186 | Ga0207664_10978707 | 3300025929 | Bacteria | 758 |
| 187 | Ga0207644_10069862 | 3300025931 | Bacteria | 2565 |
| 188 | Ga0207644_10787587 | 3300025931 | Bacteria | 795 |
| 189 | Ga0207690_10231855 | 3300025932 | Bacteria | 1418 |
| 190 | Ga0207706_10051074 | 3300025933 | Bacteria | 3652 |
| 191 | Ga0207706_10059971 | 3300025933 | Bacteria | 3351 |
| 192 | Ga0207706_10662759 | 3300025933 | Bacteria | 893 |
| 193 | Ga0207686_10059739 | 3300025934 | Bacteria | 2410 |
| 194 | Ga0207709_10012396 | 3300025935 | Bacteria | 4698 |
| 195 | Ga0207709_10112089 | 3300025935 | Bacteria | 1826 |
| 196 | Ga0207709_10308224 | 3300025935 | Bacteria | 1180 |
| 197 | Ga0207670_10309023 | 3300025936 | Bacteria | 1240 |
| 198 | Ga0207669_10017754 | 3300025937 | Bacteria | 3659 |
| 199 | Ga0207669_10056272 | 3300025937 | Bacteria | 2387 |
| 200 | Ga0207704_10001613 | 3300025938 | Bacteria | 10148 |
| 201 | Ga0207665_10233989 | 3300025939 | Bacteria | 1351 |
| 202 | Ga0207691_10024948 | 3300025940 | Bacteria | 5618 |
| 203 | Ga0207691_10100234 | 3300025940 | Bacteria | 2585 |
| 204 | Ga0207711_10252071 | 3300025941 | Bacteria | 1621 |
| 205 | Ga0207711_10703876 | 3300025941 | Bacteria | 942 |
| 206 | Ga0207689_10047871 | 3300025942 | Bacteria | 3527 |
| 207 | Ga0207661_10373477 | 3300025944 | Bacteria | 1290 |
| 208 | Ga0207712_10069726 | 3300025961 | Bacteria | 2523 |
| 209 | Ga0207712_10076551 | 3300025961 | Bacteria | 2423 |
| 210 | Ga0207640_10138606 | 3300025981 | Bacteria | 1770 |
| 211 | Ga0207658_10134534 | 3300025986 | Bacteria | 1991 |
| 212 | Ga0207677_10010914 | 3300026023 | Bacteria | 5159 |
| 213 | Ga0207703_10714771 | 3300026035 | Bacteria | 953 |
| 214 | Ga0207678_10049772 | 3300026067 | Bacteria | 3621 |
| 215 | Ga0207678_10083321 | 3300026067 | Bacteria | 2735 |
| 216 | Ga0207708_10041850 | 3300026075 | Bacteria | 3492 |
| 217 | Ga0207702_10121551 | 3300026078 | Bacteria | 2338 |
| 218 | Ga0207641_11052321 | 3300026088 | Bacteria | 811 |
| 219 | Ga0207648_10067616 | 3300026089 | Bacteria | 3114 |
| 220 | Ga0207648_10145852 | 3300026089 | Bacteria | 2088 |
| 221 | Ga0207648_10165133 | 3300026089 | Bacteria | 1956 |
| 222 | Ga0207676_10028560 | 3300026095 | Bacteria | 4168 |
| 223 | Ga0207674_10435835 | 3300026116 | Bacteria | 1267 |
| 224 | Ga0207675_100022215 | 3300026118 | Bacteria | 5908 |
| 225 | Ga0207675_100165570 | 3300026118 | Bacteria | 2111 |
| 226 | Ga0207675_100426195 | 3300026118 | Bacteria | 1311 |
| 227 | Ga0207683_10085964 | 3300026121 | Bacteria | 2796 |
| 228 | Ga0207698_10041739 | 3300026142 | Bacteria | 3421 |
| 229 | Ga0209813_10067178 | 3300027866 | Bacteria | 1158 |
| 230 | Ga0207428_10197525 | 3300027907 | Bacteria | 1514 |
| 231 | Ga0268266_10000987 | 3300028379 | Bacteria | 35837 |
| 232 | Ga0268266_10053867 | 3300028379 | Bacteria | 3457 |
| 233 | Ga0268266_10688522 | 3300028379 | Bacteria | 985 |
| 234 | Ga0268264_10285724 | 3300028381 | Bacteria | 1547 |
| 235 | Ga0268264_11998581 | 3300028381 | Bacteria | 589 |
| 236 | Ga0265334_10068104 | 3300028573 | Bacteria | 1329 |
| 237 | Ga0307515_10129647 | 3300028794 | Bacteria | 2788 |
| 238 | Ga0307515_10301134 | 3300028794 | Bacteria | 1288 |
| 239 | Ga0307513_10030902 | 3300031456 | Bacteria | 6075 |
| 240 | Ga0307513_10477009 | 3300031456 | Bacteria | 968 |
| 241 | Ga0307509_10519057 | 3300031507 | Bacteria | 873 |
| 242 | Ga0307405_10456051 | 3300031731 | Bacteria | 1015 |
| 243 | Ga0307412_10000005 | 3300031911 | Bacteria | 526194 |
| 244 | Ga0307412_10000719 | 3300031911 | Bacteria | 19120 |
| 245 | Ga0307414_11447223 | 3300032004 | Bacteria | 639 |
| 246 | Ga0451791_1041558 | 3300041451 | Bacteria | 655 |
| 247 | Ga0451795_0722678 | 3300041456 | Bacteria | 857 |
| 248 | Ga0451833_0661413 | 3300041491 | Bacteria | 3556 |
| 249 | Ga0451837_1123389 | 3300041494 | Bacteria | 4104 |
| 250 | Ga0451841_0728171 | 3300041498 | Bacteria | 1006 |
| 251 | Ga0451845_0251577 | 3300041501 | Bacteria | 2909 |
| 252 | Ga0451847_0656551 | 3300041503 | Bacteria | 871 |
| 253 | Ga0451849_0023198 | 3300041505 | Bacteria | 2738 |
| 254 | Ga0451851_0863236 | 3300041507 | Bacteria | 5586 |
| 255 | Ga0451843_0193478 | 3300041509 | Bacteria | 5086 |
| 256 | Ga0451855_0182266 | 3300041511 | Bacteria | 6131 |
| 257 | Ga0451853_1869799 | 3300041512 | Bacteria | 3021 |
| 258 | Ga0439445_0144832 | 3300042004 | Bacteria | 690 |
| 259 | Ga0450911_008680 | 3300042115 | Bacteria | 1441 |
| 260 | Ga0495603_0773914 | 3300046455 | Bacteria | 548 |
| 261 | Ga0495590_0008667 | 3300046457 | Bacteria | 3872 |
| 262 | Ga0495638_0010176 | 3300046460 | Bacteria | 6549 |
| 263 | Ga0495638_0021911 | 3300046460 | Bacteria | 4200 |
| 264 | Ga0495638_0133702 | 3300046460 | Bacteria | 1455 |
| 265 | Ga0495650_0022378 | 3300046471 | Bacteria | 3032 |
| 266 | Ga0495584_0143644 | 3300046491 | Bacteria | 1212 |
| 267 | Ga0495585_0026958 | 3300046492 | Bacteria | 3281 |
| 268 | Ga0495606_0007336 | 3300046507 | Bacteria | 9910 |
| 269 | Ga0495606_0058971 | 3300046507 | Bacteria | 2464 |
| 270 | Ga0495606_0078163 | 3300046507 | Bacteria | 2064 |
| 271 | Ga0495610_0000875 | 3300046512 | Bacteria | 28109 |
| 272 | Ga0495610_0010580 | 3300046512 | Bacteria | 5720 |
| 273 | Ga0495610_0015666 | 3300046512 | Bacteria | 4395 |
| 274 | Ga0495610_0032990 | 3300046512 | Bacteria | 2682 |
| 275 | Ga0495610_0245592 | 3300046512 | Bacteria | 711 |
| 276 | Ga0495616_0001744 | 3300046513 | Bacteria | 14808 |
| 277 | Ga0495616_0004030 | 3300046513 | Bacteria | 9331 |
| 278 | Ga0495620_0162592 | 3300046515 | Bacteria | 867 |
| 279 | Ga0495620_0310559 | 3300046515 | Bacteria | 599 |
| 280 | Ga0495630_0009209 | 3300046517 | Bacteria | 7100 |
| 281 | Ga0495631_0000034 | 3300046518 | Bacteria | 84600 |
| 282 | Ga0495631_0004507 | 3300046518 | Bacteria | 7402 |
| 283 | Ga0495631_0014386 | 3300046518 | Bacteria | 3820 |
| 284 | Ga0495632_0080239 | 3300046519 | Bacteria | 1557 |
| 285 | Ga0495637_0022179 | 3300046520 | Bacteria | 2900 |
| 286 | Ga0495637_0050724 | 3300046520 | Bacteria | 1740 |
| 287 | Ga0495637_0087133 | 3300046520 | Bacteria | 1237 |
| 288 | Ga0495643_0000119 | 3300046522 | Bacteria | 127740 |
| 289 | Ga0495643_0044388 | 3300046522 | Bacteria | 2416 |
| 290 | Ga0495643_0208460 | 3300046522 | Bacteria | 934 |
| 291 | Ga0495648_0029383 | 3300046524 | Bacteria | 3649 |
| 292 | Ga0495654_0009859 | 3300046530 | Bacteria | 5219 |
| 293 | Ga0495609_0175862 | 3300046538 | Bacteria | 902 |
| 294 | Ga0495621_0000487 | 3300046539 | Bacteria | 9778 |
| 295 | Ga0495621_0010490 | 3300046539 | Bacteria | 2836 |
| 296 | Ga0495622_0000017 | 3300046557 | Bacteria | 176313 |
| 297 | Ga0495622_0066853 | 3300046557 | Bacteria | 1661 |
| 298 | Ga0495633_0013469 | 3300046558 | Bacteria | 4308 |
| 299 | Ga0495668_0029656 | 3300046616 | Bacteria | 3090 |
| 300 | Ga0495625_0011979 | 3300046660 | Bacteria | 7038 |
| 301 | Ga0495625_0014791 | 3300046660 | Bacteria | 6211 |
| 302 | Ga0495625_0036359 | 3300046660 | Bacteria | 3620 |
| 303 | Ga0495625_0281932 | 3300046660 | Bacteria | 1069 |
| 304 | Ga0495625_0654391 | 3300046660 | Bacteria | 625 |
| 305 | Ga0495588_0023432 | 3300046674 | Bacteria | 3056 |
| 306 | Ga0495588_0074947 | 3300046674 | Bacteria | 1762 |
| 307 | Ga0495599_0258338 | 3300046678 | Bacteria | 1059 |
| 308 | Ga0495624_0007293 | 3300046690 | Bacteria | 7767 |
| 309 | Ga0495624_0256011 | 3300046690 | Bacteria | 1058 |
| 310 | Ga0495670_0000034 | 3300046691 | Bacteria | 80461 |
| 311 | Ga0495649_0006213 | 3300046694 | Bacteria | 7453 |
| 312 | Ga0495649_0016664 | 3300046694 | Bacteria | 4164 |
| 313 | Ga0495660_0074634 | 3300046810 | Bacteria | 1791 |
| 314 | Ga0495660_0131077 | 3300046810 | Bacteria | 1258 |
| 315 | Ga0495636_0446237 | 3300047318 | Bacteria | 621 |
| 316 | Ga0495674_0020845 | 3300047319 | Bacteria | 6068 |
| 317 | Ga0495672_0000113 | 3300047320 | Bacteria | 129189 |
| 318 | Ga0495672_0046337 | 3300047320 | Bacteria | 2593 |
| 319 | Ga0495672_0492234 | 3300047320 | Bacteria | 546 |
| 320 | Ga0495676_0000452 | 3300047321 | Bacteria | 33608 |
| 321 | Ga0495676_0069445 | 3300047321 | Bacteria | 2718 |
| 322 | Ga0495683_0004301 | 3300047323 | Bacteria | 8116 |
| 323 | Ga0495687_026193 | 3300047443 | Bacteria | 2749 |
| 324 | Ga0495687_223492 | 3300047443 | Bacteria | 580 |
| 325 | Ga0495684_0303529 | 3300047471 | Unclassified | 1146 |
| 326 | Ga0495686_0000171 | 3300047472 | Bacteria | 123194 |
| 327 | Ga0495686_0005885 | 3300047472 | Bacteria | 9560 |
| 328 | Ga0495686_0024920 | 3300047472 | Bacteria | 3925 |
| 329 | Ga0495686_0061218 | 3300047472 | Bacteria | 2338 |
| 330 | Ga0495686_0090099 | 3300047472 | Bacteria | 1863 |
| 331 | Ga0495686_0099934 | 3300047472 | Bacteria | 1751 |
| 332 | Ga0495686_0125915 | 3300047472 | Bacteria | 1523 |
| 333 | Ga0495602_0983897 | 3300048088 | Bacteria | 557 |
| 334 | Ga0495626_0043164 | 3300048091 | Bacteria | 2116 |
| 335 | Ga0496100_0011905 | 3300048903 | Bacteria | 4968 |
| 336 | Ga0496100_0341411 | 3300048903 | Bacteria | 1129 |
| 337 | Ga0496101_0039548 | 3300048904 | Bacteria | 3355 |
| 338 | Ga0496102_0068441 | 3300048905 | Bacteria | 3258 |
| 339 | Ga0496102_0116826 | 3300048905 | Bacteria | 2489 |
| 340 | Ga0496103_0031903 | 3300048906 | Bacteria | 3213 |
| 341 | Ga0496104_0001689 | 3300048907 | Bacteria | 19062 |
| 342 | Ga0496104_0385637 | 3300048907 | Bacteria | 1313 |
| 343 | Ga0496105_0006576 | 3300048908 | Bacteria | 8948 |
| 344 | Ga0496105_0011543 | 3300048908 | Bacteria | 6984 |
| 345 | Ga0496106_0026193 | 3300048909 | Bacteria | 4339 |
| 346 | Ga0496107_0057656 | 3300048910 | Bacteria | 2807 |
| 347 | Ga0496108_0125569 | 3300048911 | Bacteria | 2202 |
| 348 | Ga0496110_0011458 | 3300048913 | Bacteria | 7257 |
| 349 | Ga0496110_0011618 | 3300048913 | Bacteria | 7219 |
| 350 | Ga0496111_0022690 | 3300048914 | Bacteria | 4396 |
| 351 | Ga0496112_0039790 | 3300048915 | Bacteria | 4595 |
| 352 | Ga0496113_0010233 | 3300048916 | Bacteria | 6193 |
| 353 | Ga0496113_0165182 | 3300048916 | Bacteria | 1751 |
| 354 | Ga0496114_0021581 | 3300048917 | Bacteria | 5239 |
| 355 | Ga0496114_0654513 | 3300048917 | Bacteria | 924 |
| 356 | Ga0496114_1048527 | 3300048917 | Bacteria | 699 |
| 357 | Ga0496115_0005763 | 3300048918 | Bacteria | 9020 |
| 358 | Ga0496115_0009575 | 3300048918 | Bacteria | 7200 |
| 359 | Ga0496116_0038115 | 3300048919 | Bacteria | 3342 |
| 360 | Ga0496116_0084581 | 3300048919 | Bacteria | 1953 |
| 361 | Ga0496116_0295822 | 3300048919 | Bacteria | 774 |
| 362 | Ga0496117_0035957 | 3300048920 | Bacteria | 3712 |
| 363 | Ga0496117_0205156 | 3300048920 | Bacteria | 1110 |
| 364 | Ga0496117_0249188 | 3300048920 | Bacteria | 970 |
| 365 | Ga0496118_0014499 | 3300048921 | Bacteria | 7376 |
| 366 | Ga0496118_0026112 | 3300048921 | Bacteria | 4985 |
| 367 | Ga0496118_0163190 | 3300048921 | Bacteria | 1374 |
| 368 | Ga0496118_0180919 | 3300048921 | Bacteria | 1274 |
| 369 | Ga0496119_0058022 | 3300048922 | Bacteria | 2335 |
| 370 | Ga0496119_0061915 | 3300048922 | Bacteria | 2232 |
| 371 | Ga0496119_0069059 | 3300048922 | Bacteria | 2078 |
| 372 | Ga0496119_0146193 | 3300048922 | Bacteria | 1272 |
| 373 | Ga0496120_0362516 | 3300048923 | Bacteria | 648 |
| 374 | Ga0496121_0002773 | 3300048924 | Bacteria | 25999 |
| 375 | Ga0496121_0033112 | 3300048924 | Bacteria | 4684 |
| 376 | Ga0496121_0035998 | 3300048924 | Bacteria | 4420 |
| 377 | Ga0496121_0075659 | 3300048924 | Bacteria | 2688 |
| 378 | Ga0496121_0080934 | 3300048924 | Bacteria | 2572 |
| 379 | Ga0496122_0037324 | 3300048925 | Bacteria | 3913 |
| 380 | Ga0496122_0226287 | 3300048925 | Bacteria | 1068 |
| 381 | Ga0496123_0025585 | 3300048926 | Bacteria | 4446 |
| 382 | Ga0496123_0057017 | 3300048926 | Bacteria | 2547 |
| 383 | Ga0496123_0098155 | 3300048926 | Bacteria | 1714 |
| 384 | Ga0496124_0002374 | 3300048927 | Bacteria | 24819 |
| 385 | Ga0496125_0112004 | 3300048928 | Bacteria | 1973 |
| 386 | Ga0496125_0172242 | 3300048928 | Bacteria | 1453 |
| 387 | Ga0496125_0201044 | 3300048928 | Bacteria | 1304 |
| 388 | Ga0496125_0224222 | 3300048928 | Bacteria | 1208 |
| 389 | Ga0496125_0249920 | 3300048928 | Bacteria | 1120 |
| 390 | Ga0496126_0054105 | 3300048929 | Bacteria | 3637 |
| 391 | Ga0496126_0129639 | 3300048929 | Bacteria | 2180 |
| 392 | Ga0496126_0148263 | 3300048929 | Bacteria | 2013 |
| 393 | Ga0496126_0296535 | 3300048929 | Bacteria | 1335 |
| 394 | Ga0496126_1026637 | 3300048929 | Bacteria | 617 |
| 395 | Ga0495678_000827 | 3300049459 | Bacteria | 27747 |
| 396 | nmdc:mga03683_382034_c1 | 3300050489 | Bacteria | 670 |
| 397 | nmdc:mga03n38_831348_c1 | 3300050490 | Bacteria | 539 |
| 398 | nmdc:mga00v17_573799_c1 | 3300050491 | Bacteria | 728 |
| 399 | nmdc:mga0k408_116257_c1 | 3300050493 | Bacteria | 1582 |
| 400 | nmdc:mga0k408_389060_c1 | 3300050493 | Bacteria | 830 |
| 401 | nmdc:mga06z11_100373_c1 | 3300050494 | Bacteria | 1587 |
| 402 | nmdc:mga04h51_81015_c1 | 3300050495 | Bacteria | 1152 |
| 403 | nmdc:mga07m45_266808_c1 | 3300050496 | Bacteria | 652 |
| 404 | nmdc:mga08y16_233061_c1 | 3300050511 | Bacteria | 1904 |
| 405 | Ga0495601_0044636 | 3300053077 | Bacteria | 2786 |
| 406 | Ga0495655_0020548 | 3300053083 | Bacteria | 1483 |
| 407 | Ga0495619_0067071 | 3300053085 | Bacteria | 2395 |
| 408 | Ga0500644_0012962 | 3300053088 | Bacteria | 2318 |
| 409 | Ga0500651_0350923 | 3300053093 | Bacteria | 837 |
| 410 | Ga0500641_0044750 | 3300053096 | Bacteria | 1801 |
| 411 | Ga0500556_0005358 | 3300053104 | Bacteria | 3624 |
| 412 | Ga0500562_001659 | 3300053108 | Bacteria | 5536 |
| 413 | Ga0500562_079611 | 3300053108 | Bacteria | 886 |
| 414 | Ga0500594_0006714 | 3300053118 | Bacteria | 2591 |
| 415 | Ga0500594_0066079 | 3300053118 | Bacteria | 1053 |
| 416 | Ga0500595_007507 | 3300053119 | Bacteria | 4523 |
| 417 | Ga0500595_013335 | 3300053119 | Bacteria | 3151 |
| 418 | Ga0500595_057976 | 3300053119 | Bacteria | 1178 |
| 419 | Ga0500607_003871 | 3300053121 | Bacteria | 10629 |
| 420 | Ga0500607_018257 | 3300053121 | Bacteria | 3986 |
| 421 | Ga0500614_102201 | 3300053123 | Bacteria | 827 |
| 422 | Ga0500618_000581 | 3300053125 | Bacteria | 22578 |
| 423 | Ga0500658_0000554 | 3300053134 | Bacteria | 15719 |
| 424 | Ga0500658_0000843 | 3300053134 | Bacteria | 12609 |
| 425 | Ga0500658_0000851 | 3300053134 | Bacteria | 12533 |
| 426 | Ga0500658_0137494 | 3300053134 | Bacteria | 1094 |
| 427 | Ga0500658_0546389 | 3300053134 | Bacteria | 522 |
| 428 | Ga0500568_0002458 | 3300053139 | Bacteria | 10893 |
| 429 | Ga0500568_0006339 | 3300053139 | Bacteria | 5950 |
| 430 | Ga0500568_0038655 | 3300053139 | Bacteria | 1930 |
| 431 | Ga0500586_027711 | 3300053145 | Bacteria | 1843 |
| 432 | Ga0500590_064260 | 3300053148 | Bacteria | 1838 |
| 433 | Ga0500604_0019312 | 3300053151 | Bacteria | 1907 |
| 434 | Ga0500616_0023743 | 3300053153 | Bacteria | 3413 |
| 435 | Ga0500622_0003049 | 3300053156 | Bacteria | 11576 |
| 436 | Ga0500637_0044706 | 3300053178 | Bacteria | 2510 |
| 437 | Ga0500584_190358 | 3300053726 | Bacteria | 702 |
| 438 | Ga0500645_003307 | 3300053730 | Bacteria | 6634 |
| 439 | Ga0500645_008145 | 3300053730 | Bacteria | 3602 |
| 440 | Ga0500596_015262 | 3300053735 | Bacteria | 1154 |
| 441 | Ga0500587_009791 | 3300053739 | Bacteria | 1221 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2884811622 | 2884813478 | 147 |
| 2 | iso_pu_bacteria | 2884811622 | 2884813505 | 147 |
| 3 | iso_pu_bacteria | 2884836552 | 2884838314 | 147 |
| 4 | iso_pu_bacteria | 2884852848 | 2884854606 | 147 |
| 5 | iso_pu_bacteria | 2896154374 | 2896156726 | 147 |
| 6 | 3300005937 | Ga0081455_10469329 | Ga0081455_104693292 | 149 |
| 7 | 3300005539 | Ga0068853_100964050 | Ga0068853_1009640501 | 150 |
| 8 | 3300006178 | Ga0075367_10038432 | Ga0075367_100384323 | 150 |
| 9 | 3300013100 | Ga0157373_10602591 | Ga0157373_106025911 | 150 |
| 10 | 3300013105 | Ga0157369_10127399 | Ga0157369_101273994 | 150 |
| 11 | 3300046520 | Ga0495637_0022179 | Ga0495637_0022179_1212_1709 | 150 |
| 12 | 3300047472 | Ga0495686_0061218 | Ga0495686_0061218_615_1133 | 150 |
| 13 | 3300048924 | Ga0496121_0002773 | Ga0496121_0002773_18182_18700 | 150 |
| 14 | 3300053104 | Ga0500556_0005358 | Ga0500556_0005358_1662_2180 | 150 |
| 15 | 3300053134 | Ga0500658_0000851 | Ga0500658_0000851_11514_12032 | 150 |
| 16 | 3300001976 | JGI24752J21851_1023845 | JGI24752J21851_10238452 | 151 |
| 17 | 3300001977 | JGI24746J21847_1017415 | JGI24746J21847_10174152 | 151 |
| 18 | 3300001989 | JGI24739J22299_10015538 | JGI24739J22299_100155383 | 151 |
| 19 | 3300001990 | JGI24737J22298_10067516 | JGI24737J22298_100675162 | 151 |
| 20 | 3300002067 | JGI24735J21928_10039107 | JGI24735J21928_100391072 | 151 |
| 21 | 3300002070 | JGI24750J21931_1001982 | JGI24750J21931_10019822 | 151 |
| 22 | 3300002073 | JGI24745J21846_1018551 | JGI24745J21846_10185512 | 151 |
| 23 | 3300002075 | JGI24738J21930_10003669 | JGI24738J21930_100036694 | 151 |
| 24 | 3300002075 | JGI24738J21930_10018854 | JGI24738J21930_100188542 | 151 |
| 25 | 3300002076 | JGI24749J21850_1022612 | JGI24749J21850_10226121 | 151 |
| 26 | 3300002155 | JGI24033J26618_1006109 | JGI24033J26618_10061092 | 151 |
| 27 | 3300002239 | JGI24034J26672_10023543 | JGI24034J26672_100235431 | 151 |
| 28 | 3300002244 | JGI24742J22300_10014170 | JGI24742J22300_100141702 | 151 |
| 29 | 3300002459 | JGI24751J29686_10027951 | JGI24751J29686_100279512 | 151 |
| 30 | 3300002737 | JGI25162J39368_1001062 | JGI25162J39368_10010623 | 151 |
| 31 | 3300003187 | JGI25151J46595_10004295 | JGI25151J46595_100042957 | 151 |
| 32 | 3300003760 | Ga0055527_1009166 | Ga0055527_10091661 | 151 |
| 33 | 3300003762 | Ga0055542_1000010 | Ga0055542_1000010238 | 151 |
| 34 | 3300003791 | Ga0055530_10001599 | Ga0055530_1000159912 | 151 |
| 35 | 3300003792 | Ga0055540_1000056 | Ga0055540_100005613 | 151 |
| 36 | 3300003794 | Ga0055531_10012262 | Ga0055531_100122622 | 151 |
| 37 | 3300005327 | Ga0070658_10204975 | Ga0070658_102049753 | 151 |
| 38 | 3300005328 | Ga0070676_10210736 | Ga0070676_102107361 | 151 |
| 39 | 3300005330 | Ga0070690_100101277 | Ga0070690_1001012772 | 151 |
| 40 | 3300005331 | Ga0070670_100042416 | Ga0070670_1000424162 | 151 |
| 41 | 3300005333 | Ga0070677_10140089 | Ga0070677_101400892 | 151 |
| 42 | 3300005334 | Ga0068869_100048596 | Ga0068869_1000485963 | 151 |
| 43 | 3300005334 | Ga0068869_100691029 | Ga0068869_1006910292 | 151 |
| 44 | 3300005335 | Ga0070666_10174239 | Ga0070666_101742391 | 151 |
| 45 | 3300005335 | Ga0070666_10416434 | Ga0070666_104164341 | 151 |
| 46 | 3300005337 | Ga0070682_100195956 | Ga0070682_1001959562 | 151 |
| 47 | 3300005338 | Ga0068868_100042826 | Ga0068868_1000428262 | 151 |
| 48 | 3300005338 | Ga0068868_101660059 | Ga0068868_1016600591 | 151 |
| 49 | 3300005340 | Ga0070689_100410619 | Ga0070689_1004106192 | 151 |
| 50 | 3300005341 | Ga0070691_10388471 | Ga0070691_103884711 | 151 |
| 51 | 3300005343 | Ga0070687_100183622 | Ga0070687_1001836222 | 151 |
| 52 | 3300005344 | Ga0070661_100137991 | Ga0070661_1001379912 | 151 |
| 53 | 3300005345 | Ga0070692_10182889 | Ga0070692_101828892 | 151 |
| 54 | 3300005347 | Ga0070668_100006813 | Ga0070668_1000068132 | 151 |
| 55 | 3300005347 | Ga0070668_100030063 | Ga0070668_1000300632 | 151 |
| 56 | 3300005353 | Ga0070669_100006637 | Ga0070669_1000066379 | 151 |
| 57 | 3300005353 | Ga0070669_100127067 | Ga0070669_1001270671 | 151 |
| 58 | 3300005353 | Ga0070669_101094375 | Ga0070669_1010943751 | 151 |
| 59 | 3300005354 | Ga0070675_100058955 | Ga0070675_1000589553 | 151 |
| 60 | 3300005354 | Ga0070675_100137223 | Ga0070675_1001372231 | 151 |
| 61 | 3300005355 | Ga0070671_100363318 | Ga0070671_1003633182 | 151 |
| 62 | 3300005356 | Ga0070674_100041390 | Ga0070674_1000413902 | 151 |
| 63 | 3300005356 | Ga0070674_100053461 | Ga0070674_1000534613 | 151 |
| 64 | 3300005364 | Ga0070673_100115562 | Ga0070673_1001155623 | 151 |
| 65 | 3300005365 | Ga0070688_100009530 | Ga0070688_1000095305 | 151 |
| 66 | 3300005366 | Ga0070659_100184742 | Ga0070659_1001847422 | 151 |
| 67 | 3300005367 | Ga0070667_100188906 | Ga0070667_1001889062 | 151 |
| 68 | 3300005434 | Ga0070709_10056690 | Ga0070709_100566902 | 151 |
| 69 | 3300005436 | Ga0070713_100079932 | Ga0070713_1000799322 | 151 |
| 70 | 3300005436 | Ga0070713_100276197 | Ga0070713_1002761972 | 151 |
| 71 | 3300005438 | Ga0070701_10020471 | Ga0070701_100204713 | 151 |
| 72 | 3300005439 | Ga0070711_100035079 | Ga0070711_1000350792 | 151 |
| 73 | 3300005440 | Ga0070705_100078772 | Ga0070705_1000787722 | 151 |
| 74 | 3300005441 | Ga0070700_100160416 | Ga0070700_1001604162 | 151 |
| 75 | 3300005455 | Ga0070663_100058035 | Ga0070663_1000580353 | 151 |
| 76 | 3300005456 | Ga0070678_100064287 | Ga0070678_1000642872 | 151 |
| 77 | 3300005456 | Ga0070678_100948650 | Ga0070678_1009486501 | 151 |
| 78 | 3300005457 | Ga0070662_100107482 | Ga0070662_1001074823 | 151 |
| 79 | 3300005457 | Ga0070662_100117561 | Ga0070662_1001175611 | 151 |
| 80 | 3300005457 | Ga0070662_100502811 | Ga0070662_1005028112 | 151 |
| 81 | 3300005459 | Ga0068867_100148739 | Ga0068867_1001487393 | 151 |
| 82 | 3300005459 | Ga0068867_100240270 | Ga0068867_1002402702 | 151 |
| 83 | 3300005459 | Ga0068867_100255308 | Ga0068867_1002553082 | 151 |
| 84 | 3300005466 | Ga0070685_10037468 | Ga0070685_100374682 | 151 |
| 85 | 3300005539 | Ga0068853_100224682 | Ga0068853_1002246822 | 151 |
| 86 | 3300005543 | Ga0070672_100019816 | Ga0070672_1000198162 | 151 |
| 87 | 3300005543 | Ga0070672_100046116 | Ga0070672_1000461164 | 151 |
| 88 | 3300005548 | Ga0070665_100026867 | Ga0070665_1000268674 | 151 |
| 89 | 3300005548 | Ga0070665_100091272 | Ga0070665_1000912723 | 151 |
| 90 | 3300005548 | Ga0070665_100256273 | Ga0070665_1002562732 | 151 |
| 91 | 3300005548 | Ga0070665_101287928 | Ga0070665_1012879282 | 151 |
| 92 | 3300005563 | Ga0068855_101267803 | Ga0068855_1012678031 | 151 |
| 93 | 3300005577 | Ga0068857_100495563 | Ga0068857_1004955632 | 151 |
| 94 | 3300005578 | Ga0068854_100345331 | Ga0068854_1003453311 | 151 |
| 95 | 3300005578 | Ga0068854_100796771 | Ga0068854_1007967712 | 151 |
| 96 | 3300005614 | Ga0068856_100147693 | Ga0068856_1001476933 | 151 |
| 97 | 3300005615 | Ga0070702_100167949 | Ga0070702_1001679491 | 151 |
| 98 | 3300005616 | Ga0068852_100053731 | Ga0068852_1000537313 | 151 |
| 99 | 3300005617 | Ga0068859_100423518 | Ga0068859_1004235183 | 151 |
| 100 | 3300005618 | Ga0068864_100251097 | Ga0068864_1002510973 | 151 |
| 101 | 3300005618 | Ga0068864_101630587 | Ga0068864_1016305871 | 151 |
| 102 | 3300005718 | Ga0068866_10038498 | Ga0068866_100384983 | 151 |
| 103 | 3300005719 | Ga0068861_100060727 | Ga0068861_1000607273 | 151 |
| 104 | 3300005719 | Ga0068861_100124247 | Ga0068861_1001242472 | 151 |
| 105 | 3300005840 | Ga0068870_10028839 | Ga0068870_100288393 | 151 |
| 106 | 3300005841 | Ga0068863_100029436 | Ga0068863_1000294365 | 151 |
| 107 | 3300005842 | Ga0068858_100063771 | Ga0068858_1000637713 | 151 |
| 108 | 3300005843 | Ga0068860_100077104 | Ga0068860_1000771043 | 151 |
| 109 | 3300005843 | Ga0068860_100636138 | Ga0068860_1006361382 | 151 |
| 110 | 3300006042 | Ga0075368_10033927 | Ga0075368_100339272 | 151 |
| 111 | 3300006048 | Ga0075363_100233180 | Ga0075363_1002331802 | 151 |
| 112 | 3300006163 | Ga0070715_10203514 | Ga0070715_102035142 | 151 |
| 113 | 3300006173 | Ga0070716_100272227 | Ga0070716_1002722272 | 151 |
| 114 | 3300006175 | Ga0070712_100188118 | Ga0070712_1001881181 | 151 |
| 115 | 3300006178 | Ga0075367_10013704 | Ga0075367_100137044 | 151 |
| 116 | 3300006178 | Ga0075367_10785812 | Ga0075367_107858121 | 151 |
| 117 | 3300006186 | Ga0075369_10290727 | Ga0075369_102907272 | 151 |
| 118 | 3300006195 | Ga0075366_10338163 | Ga0075366_103381632 | 151 |
| 119 | 3300006237 | Ga0097621_100090634 | Ga0097621_1000906342 | 151 |
| 120 | 3300006353 | Ga0075370_10015476 | Ga0075370_100154763 | 151 |
| 121 | 3300006881 | Ga0068865_100508258 | Ga0068865_1005082582 | 151 |
| 122 | 3300006931 | Ga0097620_100423553 | Ga0097620_1004235533 | 151 |
| 123 | 3300009036 | Ga0105244_10031275 | Ga0105244_100312753 | 151 |
| 124 | 3300009093 | Ga0105240_10069967 | Ga0105240_100699672 | 151 |
| 125 | 3300009094 | Ga0111539_10126189 | Ga0111539_101261892 | 151 |
| 126 | 3300009098 | Ga0105245_10182172 | Ga0105245_101821722 | 151 |
| 127 | 3300009101 | Ga0105247_10012867 | Ga0105247_100128672 | 151 |
| 128 | 3300009148 | Ga0105243_10085068 | Ga0105243_100850682 | 151 |
| 129 | 3300009148 | Ga0105243_10283198 | Ga0105243_102831982 | 151 |
| 130 | 3300009177 | Ga0105248_10417017 | Ga0105248_104170172 | 151 |
| 131 | 3300009177 | Ga0105248_10709749 | Ga0105248_107097492 | 151 |
| 132 | 3300009551 | Ga0105238_10431975 | Ga0105238_104319752 | 151 |
| 133 | 3300009553 | Ga0105249_10111341 | Ga0105249_101113412 | 151 |
| 134 | 3300010375 | Ga0105239_10198284 | Ga0105239_101982842 | 151 |
| 135 | 3300011119 | Ga0105246_10023003 | Ga0105246_100230033 | 151 |
| 136 | 3300011119 | Ga0105246_10026587 | Ga0105246_100265874 | 151 |
| 137 | 3300012502 | Ga0157347_1000351 | Ga0157347_10003513 | 151 |
| 138 | 3300013100 | Ga0157373_10259846 | Ga0157373_102598463 | 151 |
| 139 | 3300013296 | Ga0157374_10086114 | Ga0157374_100861143 | 151 |
| 140 | 3300013297 | Ga0157378_10387985 | Ga0157378_103879852 | 151 |
| 141 | 3300013306 | Ga0163162_10043498 | Ga0163162_100434984 | 151 |
| 142 | 3300013306 | Ga0163162_10219622 | Ga0163162_102196222 | 151 |
| 143 | 3300013308 | Ga0157375_10099447 | Ga0157375_100994472 | 151 |
| 144 | 3300013308 | Ga0157375_11142081 | Ga0157375_111420812 | 151 |
| 145 | 3300014326 | Ga0157380_10071341 | Ga0157380_100713412 | 151 |
| 146 | 3300014326 | Ga0157380_10207229 | Ga0157380_102072292 | 151 |
| 147 | 3300014745 | Ga0157377_10010298 | Ga0157377_100102984 | 151 |
| 148 | 3300014969 | Ga0157376_10053039 | Ga0157376_100530392 | 151 |
| 149 | 3300017792 | Ga0163161_10041462 | Ga0163161_100414623 | 151 |
| 150 | 3300017792 | Ga0163161_10087485 | Ga0163161_100874852 | 151 |
| 151 | 3300017792 | Ga0163161_10411449 | Ga0163161_104114493 | 151 |
| 152 | 3300025228 | Ga0209672_100149 | Ga0209672_10014945 | 151 |
| 153 | 3300025231 | Ga0207427_100581 | Ga0207427_1005813 | 151 |
| 154 | 3300025233 | Ga0209437_100180 | Ga0209437_10018010 | 151 |
| 155 | 3300025242 | Ga0209258_115862 | Ga0209258_1158622 | 151 |
| 156 | 3300025250 | Ga0209026_1003397 | Ga0209026_10033973 | 151 |
| 157 | 3300025254 | Ga0209148_1000005 | Ga0209148_1000005110 | 151 |
| 158 | 3300025254 | Ga0209148_1000927 | Ga0209148_10009274 | 151 |
| 159 | 3300025272 | Ga0209455_1001132 | Ga0209455_10011327 | 151 |
| 160 | 3300025291 | Ga0209675_1003885 | Ga0209675_10038854 | 151 |
| 161 | 3300025292 | Ga0209676_1015207 | Ga0209676_10152072 | 151 |
| 162 | 3300025294 | Ga0209025_1000038 | Ga0209025_1000038229 | 151 |
| 163 | 3300025294 | Ga0209025_1026751 | Ga0209025_10267514 | 151 |
| 164 | 3300025294 | Ga0209025_1090166 | Ga0209025_10901662 | 151 |
| 165 | 3300025298 | Ga0209050_1001130 | Ga0209050_100113017 | 151 |
| 166 | 3300025298 | Ga0209050_1011411 | Ga0209050_10114113 | 151 |
| 167 | 3300025303 | Ga0209051_1000068 | Ga0209051_1000068192 | 151 |
| 168 | 3300025303 | Ga0209051_1132710 | Ga0209051_11327101 | 151 |
| 169 | 3300025304 | Ga0209257_1000146 | Ga0209257_1000146166 | 151 |
| 170 | 3300025304 | Ga0209257_1008862 | Ga0209257_10088626 | 151 |
| 171 | 3300025304 | Ga0209257_1133174 | Ga0209257_11331741 | 151 |
| 172 | 3300025893 | Ga0207682_10045433 | Ga0207682_100454332 | 151 |
| 173 | 3300025899 | Ga0207642_10011487 | Ga0207642_100114872 | 151 |
| 174 | 3300025900 | Ga0207710_10142775 | Ga0207710_101427752 | 151 |
| 175 | 3300025901 | Ga0207688_10000265 | Ga0207688_1000026522 | 151 |
| 176 | 3300025904 | Ga0207647_10030013 | Ga0207647_100300132 | 151 |
| 177 | 3300025905 | Ga0207685_10043877 | Ga0207685_100438771 | 151 |
| 178 | 3300025906 | Ga0207699_10098813 | Ga0207699_100988132 | 151 |
| 179 | 3300025907 | Ga0207645_10264745 | Ga0207645_102647452 | 151 |
| 180 | 3300025908 | Ga0207643_10004823 | Ga0207643_100048237 | 151 |
| 181 | 3300025911 | Ga0207654_10145209 | Ga0207654_101452092 | 151 |
| 182 | 3300025913 | Ga0207695_10000623 | Ga0207695_1000062325 | 151 |
| 183 | 3300025913 | Ga0207695_10099902 | Ga0207695_100999022 | 151 |
| 184 | 3300025915 | Ga0207693_10055814 | Ga0207693_100558143 | 151 |
| 185 | 3300025916 | Ga0207663_10109893 | Ga0207663_101098933 | 151 |
| 186 | 3300025918 | Ga0207662_10387133 | Ga0207662_103871332 | 151 |
| 187 | 3300025919 | Ga0207657_10509204 | Ga0207657_105092042 | 151 |
| 188 | 3300025920 | Ga0207649_10363048 | Ga0207649_103630482 | 151 |
| 189 | 3300025924 | Ga0207694_10039780 | Ga0207694_100397803 | 151 |
| 190 | 3300025925 | Ga0207650_10119381 | Ga0207650_101193812 | 151 |
| 191 | 3300025926 | Ga0207659_10053643 | Ga0207659_100536432 | 151 |
| 192 | 3300025926 | Ga0207659_10637084 | Ga0207659_106370841 | 151 |
| 193 | 3300025927 | Ga0207687_10092657 | Ga0207687_100926572 | 151 |
| 194 | 3300025928 | Ga0207700_10512299 | Ga0207700_105122992 | 151 |
| 195 | 3300025928 | Ga0207700_10555359 | Ga0207700_105553592 | 151 |
| 196 | 3300025929 | Ga0207664_10978707 | Ga0207664_109787071 | 151 |
| 197 | 3300025931 | Ga0207644_10069862 | Ga0207644_100698623 | 151 |
| 198 | 3300025931 | Ga0207644_10787587 | Ga0207644_107875872 | 151 |
| 199 | 3300025932 | Ga0207690_10231855 | Ga0207690_102318552 | 151 |
| 200 | 3300025933 | Ga0207706_10051074 | Ga0207706_100510742 | 151 |
| 201 | 3300025933 | Ga0207706_10059971 | Ga0207706_100599713 | 151 |
| 202 | 3300025933 | Ga0207706_10662759 | Ga0207706_106627592 | 151 |
| 203 | 3300025934 | Ga0207686_10059739 | Ga0207686_100597392 | 151 |
| 204 | 3300025935 | Ga0207709_10012396 | Ga0207709_100123965 | 151 |
| 205 | 3300025935 | Ga0207709_10112089 | Ga0207709_101120892 | 151 |
| 206 | 3300025935 | Ga0207709_10308224 | Ga0207709_103082241 | 151 |
| 207 | 3300025936 | Ga0207670_10309023 | Ga0207670_103090231 | 151 |
| 208 | 3300025937 | Ga0207669_10017754 | Ga0207669_100177544 | 151 |
| 209 | 3300025937 | Ga0207669_10056272 | Ga0207669_100562723 | 151 |
| 210 | 3300025938 | Ga0207704_10001613 | Ga0207704_100016132 | 151 |
| 211 | 3300025939 | Ga0207665_10233989 | Ga0207665_102339891 | 151 |
| 212 | 3300025940 | Ga0207691_10024948 | Ga0207691_100249482 | 151 |
| 213 | 3300025940 | Ga0207691_10100234 | Ga0207691_101002342 | 151 |
| 214 | 3300025941 | Ga0207711_10252071 | Ga0207711_102520712 | 151 |
| 215 | 3300025941 | Ga0207711_10703876 | Ga0207711_107038762 | 151 |
| 216 | 3300025942 | Ga0207689_10047871 | Ga0207689_100478712 | 151 |
| 217 | 3300025944 | Ga0207661_10373477 | Ga0207661_103734771 | 151 |
| 218 | 3300025961 | Ga0207712_10069726 | Ga0207712_100697262 | 151 |
| 219 | 3300025961 | Ga0207712_10076551 | Ga0207712_100765512 | 151 |
| 220 | 3300025981 | Ga0207640_10138606 | Ga0207640_101386062 | 151 |
| 221 | 3300025986 | Ga0207658_10134534 | Ga0207658_101345342 | 151 |
| 222 | 3300026023 | Ga0207677_10010914 | Ga0207677_100109142 | 151 |
| 223 | 3300026035 | Ga0207703_10714771 | Ga0207703_107147712 | 151 |
| 224 | 3300026067 | Ga0207678_10049772 | Ga0207678_100497722 | 151 |
| 225 | 3300026067 | Ga0207678_10083321 | Ga0207678_100833213 | 151 |
| 226 | 3300026075 | Ga0207708_10041850 | Ga0207708_100418502 | 151 |
| 227 | 3300026078 | Ga0207702_10121551 | Ga0207702_101215513 | 151 |
| 228 | 3300026088 | Ga0207641_11052321 | Ga0207641_110523212 | 151 |
| 229 | 3300026089 | Ga0207648_10067616 | Ga0207648_100676162 | 151 |
| 230 | 3300026089 | Ga0207648_10145852 | Ga0207648_101458522 | 151 |
| 231 | 3300026089 | Ga0207648_10165133 | Ga0207648_101651332 | 151 |
| 232 | 3300026095 | Ga0207676_10028560 | Ga0207676_100285602 | 151 |
| 233 | 3300026116 | Ga0207674_10435835 | Ga0207674_104358352 | 151 |
| 234 | 3300026118 | Ga0207675_100022215 | Ga0207675_1000222153 | 151 |
| 235 | 3300026118 | Ga0207675_100165570 | Ga0207675_1001655702 | 151 |
| 236 | 3300026118 | Ga0207675_100426195 | Ga0207675_1004261952 | 151 |
| 237 | 3300026121 | Ga0207683_10085964 | Ga0207683_100859644 | 151 |
| 238 | 3300026142 | Ga0207698_10041739 | Ga0207698_100417393 | 151 |
| 239 | 3300027866 | Ga0209813_10067178 | Ga0209813_100671782 | 151 |
| 240 | 3300027907 | Ga0207428_10197525 | Ga0207428_101975252 | 151 |
| 241 | 3300028379 | Ga0268266_10000987 | Ga0268266_100009877 | 151 |
| 242 | 3300028379 | Ga0268266_10053867 | Ga0268266_100538672 | 151 |
| 243 | 3300028379 | Ga0268266_10688522 | Ga0268266_106885222 | 151 |
| 244 | 3300028381 | Ga0268264_10285724 | Ga0268264_102857242 | 151 |
| 245 | 3300028381 | Ga0268264_11998581 | Ga0268264_119985811 | 151 |
| 246 | 3300028573 | Ga0265334_10068104 | Ga0265334_100681041 | 151 |
| 247 | 3300028794 | Ga0307515_10129647 | Ga0307515_101296472 | 151 |
| 248 | 3300028794 | Ga0307515_10301134 | Ga0307515_103011342 | 151 |
| 249 | 3300031456 | Ga0307513_10030902 | Ga0307513_100309026 | 151 |
| 250 | 3300031456 | Ga0307513_10477009 | Ga0307513_104770091 | 151 |
| 251 | 3300031507 | Ga0307509_10519057 | Ga0307509_105190571 | 151 |
| 252 | 3300031731 | Ga0307405_10456051 | Ga0307405_104560511 | 151 |
| 253 | 3300031911 | Ga0307412_10000005 | Ga0307412_10000005336 | 151 |
| 254 | 3300031911 | Ga0307412_10000719 | Ga0307412_100007198 | 151 |
| 255 | 3300032004 | Ga0307414_11447223 | Ga0307414_114472232 | 151 |
| 256 | 3300041451 | Ga0451791_1041558 | Ga0451791_1041558_136_624 | 151 |
| 257 | 3300041456 | Ga0451795_0722678 | Ga0451795_0722678_323_787 | 151 |
| 258 | 3300041491 | Ga0451833_0661413 | Ga0451833_0661413_2019_2507 | 151 |
| 259 | 3300041494 | Ga0451837_1123389 | Ga0451837_1123389_1593_2081 | 151 |
| 260 | 3300041498 | Ga0451841_0728171 | Ga0451841_0728171_263_718 | 151 |
| 261 | 3300041501 | Ga0451845_0251577 | Ga0451845_0251577_1832_2320 | 151 |
| 262 | 3300041503 | Ga0451847_0656551 | Ga0451847_0656551_291_746 | 151 |
| 263 | 3300041505 | Ga0451849_0023198 | Ga0451849_0023198_1525_2013 | 151 |
| 264 | 3300041507 | Ga0451851_0863236 | Ga0451851_0863236_3065_3553 | 151 |
| 265 | 3300041509 | Ga0451843_0193478 | Ga0451843_0193478_3436_3924 | 151 |
| 266 | 3300041511 | Ga0451855_0182266 | Ga0451855_0182266_2185_2673 | 151 |
| 267 | 3300041512 | Ga0451853_1869799 | Ga0451853_1869799_2049_2537 | 151 |
| 268 | 3300042004 | Ga0439445_0144832 | Ga0439445_0144832_70_525 | 151 |
| 269 | 3300042115 | Ga0450911_008680 | Ga0450911_008680_407_862 | 151 |
| 270 | 3300046455 | Ga0495603_0773914 | Ga0495603_0773914_71_526 | 151 |
| 271 | 3300046457 | Ga0495590_0008667 | Ga0495590_0008667_2442_2900 | 151 |
| 272 | 3300046460 | Ga0495638_0010176 | Ga0495638_0010176_508_963 | 151 |
| 273 | 3300046460 | Ga0495638_0021911 | Ga0495638_0021911_1292_1756 | 151 |
| 274 | 3300046460 | Ga0495638_0133702 | Ga0495638_0133702_164_619 | 151 |
| 275 | 3300046471 | Ga0495650_0022378 | Ga0495650_0022378_1453_1914 | 151 |
| 276 | 3300046491 | Ga0495584_0143644 | Ga0495584_0143644_45_500 | 151 |
| 277 | 3300046492 | Ga0495585_0026958 | Ga0495585_0026958_1057_1512 | 151 |
| 278 | 3300046507 | Ga0495606_0007336 | Ga0495606_0007336_5498_5956 | 151 |
| 279 | 3300046507 | Ga0495606_0058971 | Ga0495606_0058971_1357_1812 | 151 |
| 280 | 3300046507 | Ga0495606_0078163 | Ga0495606_0078163_1492_1950 | 151 |
| 281 | 3300046512 | Ga0495610_0000875 | Ga0495610_0000875_22061_22516 | 151 |
| 282 | 3300046512 | Ga0495610_0010580 | Ga0495610_0010580_138_593 | 151 |
| 283 | 3300046512 | Ga0495610_0015666 | Ga0495610_0015666_87_545 | 151 |
| 284 | 3300046512 | Ga0495610_0032990 | Ga0495610_0032990_2183_2647 | 151 |
| 285 | 3300046512 | Ga0495610_0245592 | Ga0495610_0245592_87_545 | 151 |
| 286 | 3300046513 | Ga0495616_0001744 | Ga0495616_0001744_12412_12867 | 151 |
| 287 | 3300046513 | Ga0495616_0004030 | Ga0495616_0004030_4980_5444 | 151 |
| 288 | 3300046515 | Ga0495620_0162592 | Ga0495620_0162592_164_619 | 151 |
| 289 | 3300046515 | Ga0495620_0310559 | Ga0495620_0310559_64_522 | 151 |
| 290 | 3300046517 | Ga0495630_0009209 | Ga0495630_0009209_1611_2069 | 151 |
| 291 | 3300046518 | Ga0495631_0000034 | Ga0495631_0000034_2017_2472 | 151 |
| 292 | 3300046518 | Ga0495631_0004507 | Ga0495631_0004507_6373_6837 | 151 |
| 293 | 3300046518 | Ga0495631_0014386 | Ga0495631_0014386_1489_1944 | 151 |
| 294 | 3300046519 | Ga0495632_0080239 | Ga0495632_0080239_947_1402 | 151 |
| 295 | 3300046520 | Ga0495637_0050724 | Ga0495637_0050724_247_702 | 151 |
| 296 | 3300046520 | Ga0495637_0087133 | Ga0495637_0087133_48_512 | 151 |
| 297 | 3300046522 | Ga0495643_0000119 | Ga0495643_0000119_27897_28352 | 151 |
| 298 | 3300046522 | Ga0495643_0044388 | Ga0495643_0044388_852_1310 | 151 |
| 299 | 3300046522 | Ga0495643_0208460 | Ga0495643_0208460_447_902 | 151 |
| 300 | 3300046524 | Ga0495648_0029383 | Ga0495648_0029383_2088_2588 | 151 |
| 301 | 3300046530 | Ga0495654_0009859 | Ga0495654_0009859_4173_4637 | 151 |
| 302 | 3300046538 | Ga0495609_0175862 | Ga0495609_0175862_41_496 | 151 |
| 303 | 3300046539 | Ga0495621_0000487 | Ga0495621_0000487_3044_3508 | 151 |
| 304 | 3300046539 | Ga0495621_0010490 | Ga0495621_0010490_2087_2548 | 151 |
| 305 | 3300046557 | Ga0495622_0000017 | Ga0495622_0000017_86198_86686 | 151 |
| 306 | 3300046557 | Ga0495622_0066853 | Ga0495622_0066853_1165_1620 | 151 |
| 307 | 3300046558 | Ga0495633_0013469 | Ga0495633_0013469_1037_1492 | 151 |
| 308 | 3300046616 | Ga0495668_0029656 | Ga0495668_0029656_1278_1742 | 151 |
| 309 | 3300046660 | Ga0495625_0011979 | Ga0495625_0011979_1525_1983 | 151 |
| 310 | 3300046660 | Ga0495625_0014791 | Ga0495625_0014791_2124_2624 | 151 |
| 311 | 3300046660 | Ga0495625_0036359 | Ga0495625_0036359_1887_2351 | 151 |
| 312 | 3300046660 | Ga0495625_0281932 | Ga0495625_0281932_498_956 | 151 |
| 313 | 3300046660 | Ga0495625_0654391 | Ga0495625_0654391_121_612 | 151 |
| 314 | 3300046674 | Ga0495588_0023432 | Ga0495588_0023432_2042_2497 | 151 |
| 315 | 3300046674 | Ga0495588_0074947 | Ga0495588_0074947_100_564 | 151 |
| 316 | 3300046678 | Ga0495599_0258338 | Ga0495599_0258338_549_1004 | 151 |
| 317 | 3300046690 | Ga0495624_0007293 | Ga0495624_0007293_3597_4055 | 151 |
| 318 | 3300046690 | Ga0495624_0256011 | Ga0495624_0256011_263_751 | 151 |
| 319 | 3300046691 | Ga0495670_0000034 | Ga0495670_0000034_51430_51918 | 151 |
| 320 | 3300046694 | Ga0495649_0006213 | Ga0495649_0006213_1703_2161 | 151 |
| 321 | 3300046694 | Ga0495649_0016664 | Ga0495649_0016664_2515_2970 | 151 |
| 322 | 3300046810 | Ga0495660_0074634 | Ga0495660_0074634_1104_1562 | 151 |
| 323 | 3300046810 | Ga0495660_0131077 | Ga0495660_0131077_608_1063 | 151 |
| 324 | 3300047318 | Ga0495636_0446237 | Ga0495636_0446237_118_579 | 151 |
| 325 | 3300047319 | Ga0495674_0020845 | Ga0495674_0020845_2326_2784 | 151 |
| 326 | 3300047320 | Ga0495672_0000113 | Ga0495672_0000113_120778_121233 | 151 |
| 327 | 3300047320 | Ga0495672_0046337 | Ga0495672_0046337_228_683 | 151 |
| 328 | 3300047320 | Ga0495672_0492234 | Ga0495672_0492234_37_492 | 151 |
| 329 | 3300047321 | Ga0495676_0000452 | Ga0495676_0000452_31499_31954 | 151 |
| 330 | 3300047321 | Ga0495676_0069445 | Ga0495676_0069445_833_1291 | 151 |
| 331 | 3300047323 | Ga0495683_0004301 | Ga0495683_0004301_6280_6738 | 151 |
| 332 | 3300047443 | Ga0495687_026193 | Ga0495687_026193_236_694 | 151 |
| 333 | 3300047443 | Ga0495687_223492 | Ga0495687_223492_89_553 | 151 |
| 334 | 3300047471 | Ga0495684_0303529 | Ga0495684_0303529_154_609 | 151 |
| 335 | 3300047472 | Ga0495686_0000171 | Ga0495686_0000171_66293_66748 | 151 |
| 336 | 3300047472 | Ga0495686_0005885 | Ga0495686_0005885_7521_7976 | 151 |
| 337 | 3300047472 | Ga0495686_0024920 | Ga0495686_0024920_2545_3000 | 151 |
| 338 | 3300047472 | Ga0495686_0090099 | Ga0495686_0090099_1111_1572 | 151 |
| 339 | 3300047472 | Ga0495686_0099934 | Ga0495686_0099934_1251_1706 | 151 |
| 340 | 3300047472 | Ga0495686_0125915 | Ga0495686_0125915_848_1321 | 151 |
| 341 | 3300048088 | Ga0495602_0983897 | Ga0495602_0983897_85_540 | 151 |
| 342 | 3300048091 | Ga0495626_0043164 | Ga0495626_0043164_469_927 | 151 |
| 343 | 3300048903 | Ga0496100_0011905 | Ga0496100_0011905_4053_4508 | 151 |
| 344 | 3300048903 | Ga0496100_0341411 | Ga0496100_0341411_23_478 | 151 |
| 345 | 3300048904 | Ga0496101_0039548 | Ga0496101_0039548_897_1352 | 151 |
| 346 | 3300048905 | Ga0496102_0068441 | Ga0496102_0068441_2550_3005 | 151 |
| 347 | 3300048905 | Ga0496102_0116826 | Ga0496102_0116826_681_1136 | 151 |
| 348 | 3300048906 | Ga0496103_0031903 | Ga0496103_0031903_2030_2485 | 151 |
| 349 | 3300048907 | Ga0496104_0001689 | Ga0496104_0001689_15387_15842 | 151 |
| 350 | 3300048907 | Ga0496104_0385637 | Ga0496104_0385637_728_1183 | 151 |
| 351 | 3300048908 | Ga0496105_0006576 | Ga0496105_0006576_4955_5410 | 151 |
| 352 | 3300048908 | Ga0496105_0011543 | Ga0496105_0011543_5633_6088 | 151 |
| 353 | 3300048909 | Ga0496106_0026193 | Ga0496106_0026193_2153_2608 | 151 |
| 354 | 3300048910 | Ga0496107_0057656 | Ga0496107_0057656_812_1267 | 151 |
| 355 | 3300048911 | Ga0496108_0125569 | Ga0496108_0125569_79_534 | 151 |
| 356 | 3300048913 | Ga0496110_0011458 | Ga0496110_0011458_845_1300 | 151 |
| 357 | 3300048913 | Ga0496110_0011618 | Ga0496110_0011618_2738_3193 | 151 |
| 358 | 3300048914 | Ga0496111_0022690 | Ga0496111_0022690_3125_3580 | 151 |
| 359 | 3300048915 | Ga0496112_0039790 | Ga0496112_0039790_569_1024 | 151 |
| 360 | 3300048916 | Ga0496113_0010233 | Ga0496113_0010233_3818_4273 | 151 |
| 361 | 3300048916 | Ga0496113_0165182 | Ga0496113_0165182_175_630 | 151 |
| 362 | 3300048917 | Ga0496114_0021581 | Ga0496114_0021581_4049_4504 | 151 |
| 363 | 3300048917 | Ga0496114_0654513 | Ga0496114_0654513_93_557 | 151 |
| 364 | 3300048917 | Ga0496114_1048527 | Ga0496114_1048527_47_502 | 151 |
| 365 | 3300048918 | Ga0496115_0005763 | Ga0496115_0005763_7790_8245 | 151 |
| 366 | 3300048918 | Ga0496115_0009575 | Ga0496115_0009575_3595_4050 | 151 |
| 367 | 3300048919 | Ga0496116_0038115 | Ga0496116_0038115_2498_2953 | 151 |
| 368 | 3300048919 | Ga0496116_0084581 | Ga0496116_0084581_341_808 | 151 |
| 369 | 3300048919 | Ga0496116_0295822 | Ga0496116_0295822_267_755 | 151 |
| 370 | 3300048920 | Ga0496117_0035957 | Ga0496117_0035957_1075_1542 | 151 |
| 371 | 3300048920 | Ga0496117_0205156 | Ga0496117_0205156_494_961 | 151 |
| 372 | 3300048920 | Ga0496117_0249188 | Ga0496117_0249188_343_807 | 151 |
| 373 | 3300048921 | Ga0496118_0014499 | Ga0496118_0014499_4692_5156 | 151 |
| 374 | 3300048921 | Ga0496118_0026112 | Ga0496118_0026112_1377_1844 | 151 |
| 375 | 3300048921 | Ga0496118_0163190 | Ga0496118_0163190_629_1084 | 151 |
| 376 | 3300048921 | Ga0496118_0180919 | Ga0496118_0180919_696_1151 | 151 |
| 377 | 3300048922 | Ga0496119_0058022 | Ga0496119_0058022_699_1166 | 151 |
| 378 | 3300048922 | Ga0496119_0061915 | Ga0496119_0061915_1197_1685 | 151 |
| 379 | 3300048922 | Ga0496119_0069059 | Ga0496119_0069059_212_676 | 151 |
| 380 | 3300048922 | Ga0496119_0146193 | Ga0496119_0146193_673_1128 | 151 |
| 381 | 3300048923 | Ga0496120_0362516 | Ga0496120_0362516_145_609 | 151 |
| 382 | 3300048924 | Ga0496121_0033112 | Ga0496121_0033112_52_510 | 151 |
| 383 | 3300048924 | Ga0496121_0035998 | Ga0496121_0035998_47_502 | 151 |
| 384 | 3300048924 | Ga0496121_0075659 | Ga0496121_0075659_1659_2126 | 151 |
| 385 | 3300048924 | Ga0496121_0080934 | Ga0496121_0080934_1338_1802 | 151 |
| 386 | 3300048925 | Ga0496122_0037324 | Ga0496122_0037324_3400_3855 | 151 |
| 387 | 3300048925 | Ga0496122_0226287 | Ga0496122_0226287_96_560 | 151 |
| 388 | 3300048926 | Ga0496123_0025585 | Ga0496123_0025585_2772_3227 | 151 |
| 389 | 3300048926 | Ga0496123_0057017 | Ga0496123_0057017_554_1021 | 151 |
| 390 | 3300048926 | Ga0496123_0098155 | Ga0496123_0098155_931_1389 | 151 |
| 391 | 3300048927 | Ga0496124_0002374 | Ga0496124_0002374_20397_20852 | 151 |
| 392 | 3300048928 | Ga0496125_0112004 | Ga0496125_0112004_1098_1565 | 151 |
| 393 | 3300048928 | Ga0496125_0172242 | Ga0496125_0172242_926_1390 | 151 |
| 394 | 3300048928 | Ga0496125_0201044 | Ga0496125_0201044_771_1259 | 151 |
| 395 | 3300048928 | Ga0496125_0224222 | Ga0496125_0224222_582_1046 | 151 |
| 396 | 3300048928 | Ga0496125_0249920 | Ga0496125_0249920_227_682 | 151 |
| 397 | 3300048929 | Ga0496126_0054105 | Ga0496126_0054105_2433_2888 | 151 |
| 398 | 3300048929 | Ga0496126_0129639 | Ga0496126_0129639_751_1206 | 151 |
| 399 | 3300048929 | Ga0496126_0148263 | Ga0496126_0148263_1523_1987 | 151 |
| 400 | 3300048929 | Ga0496126_0296535 | Ga0496126_0296535_436_891 | 151 |
| 401 | 3300048929 | Ga0496126_1026637 | Ga0496126_1026637_23_478 | 151 |
| 402 | 3300049459 | Ga0495678_000827 | Ga0495678_000827_21882_22337 | 151 |
| 403 | 3300050489 | nmdc:mga03683_382034_c1 | nmdc:mga03683_382034_c1_62_517 | 151 |
| 404 | 3300050490 | nmdc:mga03n38_831348_c1 | nmdc:mga03n38_831348_c1_73_528 | 151 |
| 405 | 3300050491 | nmdc:mga00v17_573799_c1 | nmdc:mga00v17_573799_c1_61_516 | 151 |
| 406 | 3300050493 | nmdc:mga0k408_116257_c1 | nmdc:mga0k408_116257_c1_1074_1529 | 151 |
| 407 | 3300050493 | nmdc:mga0k408_389060_c1 | nmdc:mga0k408_389060_c1_243_707 | 151 |
| 408 | 3300050494 | nmdc:mga06z11_100373_c1 | nmdc:mga06z11_100373_c1_231_698 | 151 |
| 409 | 3300050495 | nmdc:mga04h51_81015_c1 | nmdc:mga04h51_81015_c1_325_792 | 151 |
| 410 | 3300050496 | nmdc:mga07m45_266808_c1 | nmdc:mga07m45_266808_c1_167_634 | 151 |
| 411 | 3300050511 | nmdc:mga08y16_233061_c1 | nmdc:mga08y16_233061_c1_342_797 | 151 |
| 412 | 3300053077 | Ga0495601_0044636 | Ga0495601_0044636_1019_1474 | 151 |
| 413 | 3300053083 | Ga0495655_0020548 | Ga0495655_0020548_743_1198 | 151 |
| 414 | 3300053085 | Ga0495619_0067071 | Ga0495619_0067071_1459_1914 | 151 |
| 415 | 3300053088 | Ga0500644_0012962 | Ga0500644_0012962_42_500 | 151 |
| 416 | 3300053093 | Ga0500651_0350923 | Ga0500651_0350923_20_475 | 151 |
| 417 | 3300053096 | Ga0500641_0044750 | Ga0500641_0044750_371_826 | 151 |
| 418 | 3300053108 | Ga0500562_001659 | Ga0500562_001659_847_1311 | 151 |
| 419 | 3300053108 | Ga0500562_079611 | Ga0500562_079611_403_867 | 151 |
| 420 | 3300053118 | Ga0500594_0006714 | Ga0500594_0006714_1662_2162 | 151 |
| 421 | 3300053118 | Ga0500594_0066079 | Ga0500594_0066079_466_930 | 151 |
| 422 | 3300053119 | Ga0500595_007507 | Ga0500595_007507_1746_2201 | 151 |
| 423 | 3300053119 | Ga0500595_013335 | Ga0500595_013335_1878_2402 | 151 |
| 424 | 3300053119 | Ga0500595_057976 | Ga0500595_057976_343_798 | 151 |
| 425 | 3300053121 | Ga0500607_003871 | Ga0500607_003871_2360_2824 | 151 |
| 426 | 3300053121 | Ga0500607_018257 | Ga0500607_018257_1774_2340 | 151 |
| 427 | 3300053123 | Ga0500614_102201 | Ga0500614_102201_215_679 | 151 |
| 428 | 3300053125 | Ga0500618_000581 | Ga0500618_000581_20442_20897 | 151 |
| 429 | 3300053134 | Ga0500658_0000554 | Ga0500658_0000554_4711_5175 | 151 |
| 430 | 3300053134 | Ga0500658_0000843 | Ga0500658_0000843_11648_12154 | 151 |
| 431 | 3300053134 | Ga0500658_0137494 | Ga0500658_0137494_266_721 | 151 |
| 432 | 3300053134 | Ga0500658_0546389 | Ga0500658_0546389_52_507 | 151 |
| 433 | 3300053139 | Ga0500568_0002458 | Ga0500568_0002458_1466_1930 | 151 |
| 434 | 3300053139 | Ga0500568_0006339 | Ga0500568_0006339_5168_5623 | 151 |
| 435 | 3300053139 | Ga0500568_0038655 | Ga0500568_0038655_1323_1778 | 151 |
| 436 | 3300053145 | Ga0500586_027711 | Ga0500586_027711_616_1071 | 151 |
| 437 | 3300053148 | Ga0500590_064260 | Ga0500590_064260_213_668 | 151 |
| 438 | 3300053151 | Ga0500604_0019312 | Ga0500604_0019312_789_1244 | 151 |
| 439 | 3300053153 | Ga0500616_0023743 | Ga0500616_0023743_2345_2809 | 151 |
| 440 | 3300053156 | Ga0500622_0003049 | Ga0500622_0003049_6194_6661 | 151 |
| 441 | 3300053178 | Ga0500637_0044706 | Ga0500637_0044706_1180_1635 | 151 |
| 442 | 3300053726 | Ga0500584_190358 | Ga0500584_190358_54_512 | 151 |
| 443 | 3300053730 | Ga0500645_003307 | Ga0500645_003307_694_1152 | 151 |
| 444 | 3300053730 | Ga0500645_008145 | Ga0500645_008145_754_1209 | 151 |
| 445 | 3300053735 | Ga0500596_015262 | Ga0500596_015262_180_638 | 151 |
| 446 | 3300053739 | Ga0500587_009791 | Ga0500587_009791_100_555 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.9757 | 11 | 143 |
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.9614 | 11 | 143 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.9573 | 1 | 145 |
| 2gmy-assembly1.cif.gz_C | crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd | 0.9547 | 2 | 145 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.9444 | 1 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ijcF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9704 | 4 | 139 | 1.20.1290.10 |
| 2o4dA00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9697 | 4 | 139 | 1.20.1290.10 |
| 2gmyF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9581 | 2 | 145 | 1.20.1290.10 |
| af_Q2FVE0_2_139_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9542 | 6 | 143 | 1.20.1290.10 |
| af_Q2FVE0_2_139_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9342 | 6 | 143 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q7RCA5-F1-model_v4 | AhpD family alkylhydroperoxidase | 1.001 | 4 | 146 |
GO:0051920
|
| AF-A0A4P7L6S2-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9998 | 4 | 150 |
GO:0051920
|
| AF-A0A512N1X1-F1-model_v4 | Alkyl hydroperoxide reductase AhpD | 0.9944 | 16 | 146 |
GO:0051920
|
| AF-A0A0T6Z810-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.9939 | 39 | 151 |
GO:0051920
|
| AF-A0A1V2H0A2-F1-model_v4 | Alkylhydroperoxidase | 0.9935 | 3 | 148 |
GO:0051920
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar