F445826

General Info

Members Datasets Scaffolds Average Seq Length
446 297 441 153

Family's Representative Sequence

Representative Sequence 3300053121|Ga0500607_018257|Ga0500607_018257_1774_2340
Length 188
Sequence MAHAQSPFLVLLDWAKTRDDEVLSNPCIQGLSMSHRIDYTQASPEGYKAFGGVYLALQKSGLPKELVDLVYLRISQINGCAYCIDMHSRDLLKGGLAVDKLVLVAVWQDGGAVFSRRERAALAWAESVTRVSDTGVPDADYDAAAAEFSAKELADLTYAIGLMNAFNRLGISFRVAPAAAVAVAAVRA

Samples

Sample ID Description Type Environment
1 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
2 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
3 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
4 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
190 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
191 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
192 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
193 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
194 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
195 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
198 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
265 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
280 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
281 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
282 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
283 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
284 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
289 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
290 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
293 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
294 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
297 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.88
Metatranscriptomes 0
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.26
Nodule 0.22
Rhizoplane 5.83
Rhizosphere 64.13
Stem 0
Stem Tuber 0
Unclassified 12.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1023845 3300001976 Bacteria 801
2 JGI24746J21847_1017415 3300001977 Bacteria 1020
3 JGI24739J22299_10015538 3300001989 Bacteria 2766
4 JGI24737J22298_10067516 3300001990 Bacteria 1070
5 JGI24735J21928_10039107 3300002067 Bacteria 1388
6 JGI24750J21931_1001982 3300002070 Bacteria 2503
7 JGI24745J21846_1018551 3300002073 Bacteria 812
8 JGI24738J21930_10003669 3300002075 Bacteria 3847
9 JGI24738J21930_10018854 3300002075 Bacteria 1441
10 JGI24749J21850_1022612 3300002076 Bacteria 892
11 JGI24033J26618_1006109 3300002155 Bacteria 1344
12 JGI24034J26672_10023543 3300002239 Bacteria 978
13 JGI24742J22300_10014170 3300002244 Bacteria 1338
14 JGI24751J29686_10027951 3300002459 Bacteria 1172
15 JGI25162J39368_1001062 3300002737 Bacteria 16806
16 JGI25151J46595_10004295 3300003187 Bacteria 7570
17 Ga0055527_1009166 3300003760 Bacteria 1167
18 Ga0055542_1000010 3300003762 Bacteria 414813
19 Ga0055530_10001599 3300003791 Bacteria 16226
20 Ga0055540_1000056 3300003792 Bacteria 139732
21 Ga0055531_10012262 3300003794 Bacteria 4048
22 Ga0070658_10204975 3300005327 Bacteria 1665
23 Ga0070676_10210736 3300005328 Bacteria 1279
24 Ga0070690_100101277 3300005330 Bacteria 1910
25 Ga0070670_100042416 3300005331 Bacteria 3911
26 Ga0070677_10140089 3300005333 Bacteria 1114
27 Ga0068869_100048596 3300005334 Bacteria 3068
28 Ga0068869_100691029 3300005334 Bacteria 869
29 Ga0070666_10174239 3300005335 Bacteria 1507
30 Ga0070666_10416434 3300005335 Bacteria 967
31 Ga0070682_100195956 3300005337 Bacteria 1422
32 Ga0068868_100042826 3300005338 Bacteria 3535
33 Ga0068868_101660059 3300005338 Bacteria 601
34 Ga0070689_100410619 3300005340 Bacteria 1146
35 Ga0070691_10388471 3300005341 Bacteria 784
36 Ga0070687_100183622 3300005343 Bacteria 1255
37 Ga0070661_100137991 3300005344 Bacteria 1836
38 Ga0070692_10182889 3300005345 Bacteria 1216
39 Ga0070668_100006813 3300005347 Bacteria 8472
40 Ga0070668_100030063 3300005347 Bacteria 4129
41 Ga0070669_100006637 3300005353 Bacteria 8333
42 Ga0070669_100127067 3300005353 Bacteria 1952
43 Ga0070669_101094375 3300005353 Bacteria 686
44 Ga0070675_100058955 3300005354 Bacteria 3166
45 Ga0070675_100137223 3300005354 Bacteria 2088
46 Ga0070671_100363318 3300005355 Bacteria 1236
47 Ga0070674_100041390 3300005356 Bacteria 3122
48 Ga0070674_100053461 3300005356 Bacteria 2789
49 Ga0070673_100115562 3300005364 Bacteria 2231
50 Ga0070688_100009530 3300005365 Bacteria 5318
51 Ga0070659_100184742 3300005366 Bacteria 1712
52 Ga0070667_100188906 3300005367 Bacteria 1824
53 Ga0070709_10056690 3300005434 Bacteria 2478
54 Ga0070713_100079932 3300005436 Bacteria 2787
55 Ga0070713_100276197 3300005436 Bacteria 1540
56 Ga0070701_10020471 3300005438 Bacteria 3142
57 Ga0070711_100035079 3300005439 Bacteria 3351
58 Ga0070705_100078772 3300005440 Bacteria 2016
59 Ga0070700_100160416 3300005441 Bacteria 1547
60 Ga0070663_100058035 3300005455 Bacteria 2778
61 Ga0070678_100064287 3300005456 Bacteria 2719
62 Ga0070678_100948650 3300005456 Bacteria 788
63 Ga0070662_100107482 3300005457 Bacteria 2121
64 Ga0070662_100117561 3300005457 Bacteria 2034
65 Ga0070662_100502811 3300005457 Bacteria 1011
66 Ga0068867_100148739 3300005459 Bacteria 1838
67 Ga0068867_100240270 3300005459 Bacteria 1468
68 Ga0068867_100255308 3300005459 Bacteria 1427
69 Ga0070685_10037468 3300005466 Bacteria 2746
70 Ga0068853_100224682 3300005539 Bacteria 1716
71 Ga0068853_100964050 3300005539 Bacteria 820
72 Ga0070672_100019816 3300005543 Bacteria 4892
73 Ga0070672_100046116 3300005543 Bacteria 3376
74 Ga0070665_100026867 3300005548 Bacteria 5798
75 Ga0070665_100091272 3300005548 Bacteria 3051
76 Ga0070665_100256273 3300005548 Bacteria 1750
77 Ga0070665_101287928 3300005548 Bacteria 741
78 Ga0068855_101267803 3300005563 Bacteria 764
79 Ga0068857_100495563 3300005577 Bacteria 1146
80 Ga0068854_100345331 3300005578 Bacteria 1216
81 Ga0068854_100796771 3300005578 Bacteria 823
82 Ga0068856_100147693 3300005614 Bacteria 2359
83 Ga0070702_100167949 3300005615 Bacteria 1424
84 Ga0068852_100053731 3300005616 Bacteria 3469
85 Ga0068859_100423518 3300005617 Bacteria 1427
86 Ga0068864_100251097 3300005618 Bacteria 1642
87 Ga0068864_101630587 3300005618 Bacteria 649
88 Ga0068866_10038498 3300005718 Bacteria 2355
89 Ga0068861_100060727 3300005719 Bacteria 2898
90 Ga0068861_100124247 3300005719 Bacteria 2086
91 Ga0068870_10028839 3300005840 Bacteria 2790
92 Ga0068863_100029436 3300005841 Bacteria 5242
93 Ga0068858_100063771 3300005842 Bacteria 3409
94 Ga0068860_100077104 3300005843 Bacteria 3169
95 Ga0068860_100636138 3300005843 Bacteria 1074
96 Ga0081455_10469329 3300005937 Bacteria 854
97 Ga0075368_10033927 3300006042 Bacteria 1987
98 Ga0075363_100233180 3300006048 Bacteria 1057
99 Ga0070715_10203514 3300006163 Bacteria 1007
100 Ga0070716_100272227 3300006173 Bacteria 1164
101 Ga0070712_100188118 3300006175 Bacteria 1613
102 Ga0075367_10013704 3300006178 Bacteria 4368
103 Ga0075367_10038432 3300006178 Bacteria 2786
104 Ga0075367_10785812 3300006178 Bacteria 606
105 Ga0075369_10290727 3300006186 Bacteria 762
106 Ga0075366_10338163 3300006195 Bacteria 923
107 Ga0097621_100090634 3300006237 Bacteria 2558
108 Ga0075370_10015476 3300006353 Bacteria 4085
109 Ga0068865_100508258 3300006881 Bacteria 1006
110 Ga0097620_100423553 3300006931 Bacteria 1427
111 Ga0105244_10031275 3300009036 Bacteria 2825
112 Ga0105240_10069967 3300009093 Bacteria 4342
113 Ga0111539_10126189 3300009094 Bacteria 2998
114 Ga0105245_10182172 3300009098 Bacteria 2008
115 Ga0105247_10012867 3300009101 Bacteria 5022
116 Ga0105243_10085068 3300009148 Bacteria 2592
117 Ga0105243_10283198 3300009148 Bacteria 1494
118 Ga0105248_10417017 3300009177 Bacteria 1512
119 Ga0105248_10709749 3300009177 Bacteria 1135
120 Ga0105238_10431975 3300009551 Bacteria 1313
121 Ga0105249_10111341 3300009553 Bacteria 2589
122 Ga0105239_10198284 3300010375 Bacteria 2248
123 Ga0105246_10023003 3300011119 Bacteria 4028
124 Ga0105246_10026587 3300011119 Bacteria 3783
125 Ga0157347_1000351 3300012502 Bacteria 2877
126 Ga0157373_10259846 3300013100 Bacteria 1229
127 Ga0157373_10602591 3300013100 Bacteria 800
128 Ga0157369_10127399 3300013105 Bacteria 2698
129 Ga0157374_10086114 3300013296 Bacteria 2989
130 Ga0157378_10387985 3300013297 Bacteria 1373
131 Ga0163162_10043498 3300013306 Bacteria 4498
132 Ga0163162_10219622 3300013306 Bacteria 2031
133 Ga0157375_10099447 3300013308 Bacteria 2988
134 Ga0157375_11142081 3300013308 Bacteria 913
135 Ga0157380_10071341 3300014326 Bacteria 2810
136 Ga0157380_10207229 3300014326 Bacteria 1744
137 Ga0157377_10010298 3300014745 Bacteria 4622
138 Ga0157376_10053039 3300014969 Bacteria 3374
139 Ga0163161_10041462 3300017792 Bacteria 3307
140 Ga0163161_10087485 3300017792 Bacteria 2301
141 Ga0163161_10411449 3300017792 Bacteria 1086
142 Ga0209672_100149 3300025228 Bacteria 62756
143 Ga0207427_100581 3300025231 Bacteria 18457
144 Ga0209437_100180 3300025233 Bacteria 133661
145 Ga0209258_115862 3300025242 Bacteria 852
146 Ga0209026_1003397 3300025250 Bacteria 5251
147 Ga0209148_1000005 3300025254 Bacteria 1806504
148 Ga0209148_1000927 3300025254 Bacteria 19411
149 Ga0209455_1001132 3300025272 Bacteria 12947
150 Ga0209675_1003885 3300025291 Bacteria 6875
151 Ga0209676_1015207 3300025292 Bacteria 2844
152 Ga0209025_1000038 3300025294 Bacteria 380508
153 Ga0209025_1026751 3300025294 Bacteria 2884
154 Ga0209025_1090166 3300025294 Bacteria 1005
155 Ga0209050_1001130 3300025298 Bacteria 32162
156 Ga0209050_1011411 3300025298 Bacteria 4217
157 Ga0209051_1000068 3300025303 Bacteria 220063
158 Ga0209051_1132710 3300025303 Bacteria 612
159 Ga0209257_1000146 3300025304 Bacteria 194261
160 Ga0209257_1008862 3300025304 Bacteria 5554
161 Ga0209257_1133174 3300025304 Bacteria 567
162 Ga0207682_10045433 3300025893 Bacteria 1802
163 Ga0207642_10011487 3300025899 Bacteria 3162
164 Ga0207710_10142775 3300025900 Bacteria 1157
165 Ga0207688_10000265 3300025901 Bacteria 23890
166 Ga0207647_10030013 3300025904 Bacteria 3512
167 Ga0207685_10043877 3300025905 Bacteria 1688
168 Ga0207699_10098813 3300025906 Bacteria 1848
169 Ga0207645_10264745 3300025907 Bacteria 1139
170 Ga0207643_10004823 3300025908 Bacteria 7222
171 Ga0207654_10145209 3300025911 Bacteria 1517
172 Ga0207695_10000623 3300025913 Bacteria 71205
173 Ga0207695_10099902 3300025913 Bacteria 2898
174 Ga0207693_10055814 3300025915 Bacteria 3098
175 Ga0207663_10109893 3300025916 Bacteria 1869
176 Ga0207662_10387133 3300025918 Bacteria 946
177 Ga0207657_10509204 3300025919 Bacteria 943
178 Ga0207649_10363048 3300025920 Bacteria 1075
179 Ga0207694_10039780 3300025924 Bacteria 3619
180 Ga0207650_10119381 3300025925 Bacteria 2051
181 Ga0207659_10053643 3300025926 Bacteria 2876
182 Ga0207659_10637084 3300025926 Bacteria 910
183 Ga0207687_10092657 3300025927 Bacteria 2207
184 Ga0207700_10512299 3300025928 Bacteria 1062
185 Ga0207700_10555359 3300025928 Bacteria 1019
186 Ga0207664_10978707 3300025929 Bacteria 758
187 Ga0207644_10069862 3300025931 Bacteria 2565
188 Ga0207644_10787587 3300025931 Bacteria 795
189 Ga0207690_10231855 3300025932 Bacteria 1418
190 Ga0207706_10051074 3300025933 Bacteria 3652
191 Ga0207706_10059971 3300025933 Bacteria 3351
192 Ga0207706_10662759 3300025933 Bacteria 893
193 Ga0207686_10059739 3300025934 Bacteria 2410
194 Ga0207709_10012396 3300025935 Bacteria 4698
195 Ga0207709_10112089 3300025935 Bacteria 1826
196 Ga0207709_10308224 3300025935 Bacteria 1180
197 Ga0207670_10309023 3300025936 Bacteria 1240
198 Ga0207669_10017754 3300025937 Bacteria 3659
199 Ga0207669_10056272 3300025937 Bacteria 2387
200 Ga0207704_10001613 3300025938 Bacteria 10148
201 Ga0207665_10233989 3300025939 Bacteria 1351
202 Ga0207691_10024948 3300025940 Bacteria 5618
203 Ga0207691_10100234 3300025940 Bacteria 2585
204 Ga0207711_10252071 3300025941 Bacteria 1621
205 Ga0207711_10703876 3300025941 Bacteria 942
206 Ga0207689_10047871 3300025942 Bacteria 3527
207 Ga0207661_10373477 3300025944 Bacteria 1290
208 Ga0207712_10069726 3300025961 Bacteria 2523
209 Ga0207712_10076551 3300025961 Bacteria 2423
210 Ga0207640_10138606 3300025981 Bacteria 1770
211 Ga0207658_10134534 3300025986 Bacteria 1991
212 Ga0207677_10010914 3300026023 Bacteria 5159
213 Ga0207703_10714771 3300026035 Bacteria 953
214 Ga0207678_10049772 3300026067 Bacteria 3621
215 Ga0207678_10083321 3300026067 Bacteria 2735
216 Ga0207708_10041850 3300026075 Bacteria 3492
217 Ga0207702_10121551 3300026078 Bacteria 2338
218 Ga0207641_11052321 3300026088 Bacteria 811
219 Ga0207648_10067616 3300026089 Bacteria 3114
220 Ga0207648_10145852 3300026089 Bacteria 2088
221 Ga0207648_10165133 3300026089 Bacteria 1956
222 Ga0207676_10028560 3300026095 Bacteria 4168
223 Ga0207674_10435835 3300026116 Bacteria 1267
224 Ga0207675_100022215 3300026118 Bacteria 5908
225 Ga0207675_100165570 3300026118 Bacteria 2111
226 Ga0207675_100426195 3300026118 Bacteria 1311
227 Ga0207683_10085964 3300026121 Bacteria 2796
228 Ga0207698_10041739 3300026142 Bacteria 3421
229 Ga0209813_10067178 3300027866 Bacteria 1158
230 Ga0207428_10197525 3300027907 Bacteria 1514
231 Ga0268266_10000987 3300028379 Bacteria 35837
232 Ga0268266_10053867 3300028379 Bacteria 3457
233 Ga0268266_10688522 3300028379 Bacteria 985
234 Ga0268264_10285724 3300028381 Bacteria 1547
235 Ga0268264_11998581 3300028381 Bacteria 589
236 Ga0265334_10068104 3300028573 Bacteria 1329
237 Ga0307515_10129647 3300028794 Bacteria 2788
238 Ga0307515_10301134 3300028794 Bacteria 1288
239 Ga0307513_10030902 3300031456 Bacteria 6075
240 Ga0307513_10477009 3300031456 Bacteria 968
241 Ga0307509_10519057 3300031507 Bacteria 873
242 Ga0307405_10456051 3300031731 Bacteria 1015
243 Ga0307412_10000005 3300031911 Bacteria 526194
244 Ga0307412_10000719 3300031911 Bacteria 19120
245 Ga0307414_11447223 3300032004 Bacteria 639
246 Ga0451791_1041558 3300041451 Bacteria 655
247 Ga0451795_0722678 3300041456 Bacteria 857
248 Ga0451833_0661413 3300041491 Bacteria 3556
249 Ga0451837_1123389 3300041494 Bacteria 4104
250 Ga0451841_0728171 3300041498 Bacteria 1006
251 Ga0451845_0251577 3300041501 Bacteria 2909
252 Ga0451847_0656551 3300041503 Bacteria 871
253 Ga0451849_0023198 3300041505 Bacteria 2738
254 Ga0451851_0863236 3300041507 Bacteria 5586
255 Ga0451843_0193478 3300041509 Bacteria 5086
256 Ga0451855_0182266 3300041511 Bacteria 6131
257 Ga0451853_1869799 3300041512 Bacteria 3021
258 Ga0439445_0144832 3300042004 Bacteria 690
259 Ga0450911_008680 3300042115 Bacteria 1441
260 Ga0495603_0773914 3300046455 Bacteria 548
261 Ga0495590_0008667 3300046457 Bacteria 3872
262 Ga0495638_0010176 3300046460 Bacteria 6549
263 Ga0495638_0021911 3300046460 Bacteria 4200
264 Ga0495638_0133702 3300046460 Bacteria 1455
265 Ga0495650_0022378 3300046471 Bacteria 3032
266 Ga0495584_0143644 3300046491 Bacteria 1212
267 Ga0495585_0026958 3300046492 Bacteria 3281
268 Ga0495606_0007336 3300046507 Bacteria 9910
269 Ga0495606_0058971 3300046507 Bacteria 2464
270 Ga0495606_0078163 3300046507 Bacteria 2064
271 Ga0495610_0000875 3300046512 Bacteria 28109
272 Ga0495610_0010580 3300046512 Bacteria 5720
273 Ga0495610_0015666 3300046512 Bacteria 4395
274 Ga0495610_0032990 3300046512 Bacteria 2682
275 Ga0495610_0245592 3300046512 Bacteria 711
276 Ga0495616_0001744 3300046513 Bacteria 14808
277 Ga0495616_0004030 3300046513 Bacteria 9331
278 Ga0495620_0162592 3300046515 Bacteria 867
279 Ga0495620_0310559 3300046515 Bacteria 599
280 Ga0495630_0009209 3300046517 Bacteria 7100
281 Ga0495631_0000034 3300046518 Bacteria 84600
282 Ga0495631_0004507 3300046518 Bacteria 7402
283 Ga0495631_0014386 3300046518 Bacteria 3820
284 Ga0495632_0080239 3300046519 Bacteria 1557
285 Ga0495637_0022179 3300046520 Bacteria 2900
286 Ga0495637_0050724 3300046520 Bacteria 1740
287 Ga0495637_0087133 3300046520 Bacteria 1237
288 Ga0495643_0000119 3300046522 Bacteria 127740
289 Ga0495643_0044388 3300046522 Bacteria 2416
290 Ga0495643_0208460 3300046522 Bacteria 934
291 Ga0495648_0029383 3300046524 Bacteria 3649
292 Ga0495654_0009859 3300046530 Bacteria 5219
293 Ga0495609_0175862 3300046538 Bacteria 902
294 Ga0495621_0000487 3300046539 Bacteria 9778
295 Ga0495621_0010490 3300046539 Bacteria 2836
296 Ga0495622_0000017 3300046557 Bacteria 176313
297 Ga0495622_0066853 3300046557 Bacteria 1661
298 Ga0495633_0013469 3300046558 Bacteria 4308
299 Ga0495668_0029656 3300046616 Bacteria 3090
300 Ga0495625_0011979 3300046660 Bacteria 7038
301 Ga0495625_0014791 3300046660 Bacteria 6211
302 Ga0495625_0036359 3300046660 Bacteria 3620
303 Ga0495625_0281932 3300046660 Bacteria 1069
304 Ga0495625_0654391 3300046660 Bacteria 625
305 Ga0495588_0023432 3300046674 Bacteria 3056
306 Ga0495588_0074947 3300046674 Bacteria 1762
307 Ga0495599_0258338 3300046678 Bacteria 1059
308 Ga0495624_0007293 3300046690 Bacteria 7767
309 Ga0495624_0256011 3300046690 Bacteria 1058
310 Ga0495670_0000034 3300046691 Bacteria 80461
311 Ga0495649_0006213 3300046694 Bacteria 7453
312 Ga0495649_0016664 3300046694 Bacteria 4164
313 Ga0495660_0074634 3300046810 Bacteria 1791
314 Ga0495660_0131077 3300046810 Bacteria 1258
315 Ga0495636_0446237 3300047318 Bacteria 621
316 Ga0495674_0020845 3300047319 Bacteria 6068
317 Ga0495672_0000113 3300047320 Bacteria 129189
318 Ga0495672_0046337 3300047320 Bacteria 2593
319 Ga0495672_0492234 3300047320 Bacteria 546
320 Ga0495676_0000452 3300047321 Bacteria 33608
321 Ga0495676_0069445 3300047321 Bacteria 2718
322 Ga0495683_0004301 3300047323 Bacteria 8116
323 Ga0495687_026193 3300047443 Bacteria 2749
324 Ga0495687_223492 3300047443 Bacteria 580
325 Ga0495684_0303529 3300047471 Unclassified 1146
326 Ga0495686_0000171 3300047472 Bacteria 123194
327 Ga0495686_0005885 3300047472 Bacteria 9560
328 Ga0495686_0024920 3300047472 Bacteria 3925
329 Ga0495686_0061218 3300047472 Bacteria 2338
330 Ga0495686_0090099 3300047472 Bacteria 1863
331 Ga0495686_0099934 3300047472 Bacteria 1751
332 Ga0495686_0125915 3300047472 Bacteria 1523
333 Ga0495602_0983897 3300048088 Bacteria 557
334 Ga0495626_0043164 3300048091 Bacteria 2116
335 Ga0496100_0011905 3300048903 Bacteria 4968
336 Ga0496100_0341411 3300048903 Bacteria 1129
337 Ga0496101_0039548 3300048904 Bacteria 3355
338 Ga0496102_0068441 3300048905 Bacteria 3258
339 Ga0496102_0116826 3300048905 Bacteria 2489
340 Ga0496103_0031903 3300048906 Bacteria 3213
341 Ga0496104_0001689 3300048907 Bacteria 19062
342 Ga0496104_0385637 3300048907 Bacteria 1313
343 Ga0496105_0006576 3300048908 Bacteria 8948
344 Ga0496105_0011543 3300048908 Bacteria 6984
345 Ga0496106_0026193 3300048909 Bacteria 4339
346 Ga0496107_0057656 3300048910 Bacteria 2807
347 Ga0496108_0125569 3300048911 Bacteria 2202
348 Ga0496110_0011458 3300048913 Bacteria 7257
349 Ga0496110_0011618 3300048913 Bacteria 7219
350 Ga0496111_0022690 3300048914 Bacteria 4396
351 Ga0496112_0039790 3300048915 Bacteria 4595
352 Ga0496113_0010233 3300048916 Bacteria 6193
353 Ga0496113_0165182 3300048916 Bacteria 1751
354 Ga0496114_0021581 3300048917 Bacteria 5239
355 Ga0496114_0654513 3300048917 Bacteria 924
356 Ga0496114_1048527 3300048917 Bacteria 699
357 Ga0496115_0005763 3300048918 Bacteria 9020
358 Ga0496115_0009575 3300048918 Bacteria 7200
359 Ga0496116_0038115 3300048919 Bacteria 3342
360 Ga0496116_0084581 3300048919 Bacteria 1953
361 Ga0496116_0295822 3300048919 Bacteria 774
362 Ga0496117_0035957 3300048920 Bacteria 3712
363 Ga0496117_0205156 3300048920 Bacteria 1110
364 Ga0496117_0249188 3300048920 Bacteria 970
365 Ga0496118_0014499 3300048921 Bacteria 7376
366 Ga0496118_0026112 3300048921 Bacteria 4985
367 Ga0496118_0163190 3300048921 Bacteria 1374
368 Ga0496118_0180919 3300048921 Bacteria 1274
369 Ga0496119_0058022 3300048922 Bacteria 2335
370 Ga0496119_0061915 3300048922 Bacteria 2232
371 Ga0496119_0069059 3300048922 Bacteria 2078
372 Ga0496119_0146193 3300048922 Bacteria 1272
373 Ga0496120_0362516 3300048923 Bacteria 648
374 Ga0496121_0002773 3300048924 Bacteria 25999
375 Ga0496121_0033112 3300048924 Bacteria 4684
376 Ga0496121_0035998 3300048924 Bacteria 4420
377 Ga0496121_0075659 3300048924 Bacteria 2688
378 Ga0496121_0080934 3300048924 Bacteria 2572
379 Ga0496122_0037324 3300048925 Bacteria 3913
380 Ga0496122_0226287 3300048925 Bacteria 1068
381 Ga0496123_0025585 3300048926 Bacteria 4446
382 Ga0496123_0057017 3300048926 Bacteria 2547
383 Ga0496123_0098155 3300048926 Bacteria 1714
384 Ga0496124_0002374 3300048927 Bacteria 24819
385 Ga0496125_0112004 3300048928 Bacteria 1973
386 Ga0496125_0172242 3300048928 Bacteria 1453
387 Ga0496125_0201044 3300048928 Bacteria 1304
388 Ga0496125_0224222 3300048928 Bacteria 1208
389 Ga0496125_0249920 3300048928 Bacteria 1120
390 Ga0496126_0054105 3300048929 Bacteria 3637
391 Ga0496126_0129639 3300048929 Bacteria 2180
392 Ga0496126_0148263 3300048929 Bacteria 2013
393 Ga0496126_0296535 3300048929 Bacteria 1335
394 Ga0496126_1026637 3300048929 Bacteria 617
395 Ga0495678_000827 3300049459 Bacteria 27747
396 nmdc:mga03683_382034_c1 3300050489 Bacteria 670
397 nmdc:mga03n38_831348_c1 3300050490 Bacteria 539
398 nmdc:mga00v17_573799_c1 3300050491 Bacteria 728
399 nmdc:mga0k408_116257_c1 3300050493 Bacteria 1582
400 nmdc:mga0k408_389060_c1 3300050493 Bacteria 830
401 nmdc:mga06z11_100373_c1 3300050494 Bacteria 1587
402 nmdc:mga04h51_81015_c1 3300050495 Bacteria 1152
403 nmdc:mga07m45_266808_c1 3300050496 Bacteria 652
404 nmdc:mga08y16_233061_c1 3300050511 Bacteria 1904
405 Ga0495601_0044636 3300053077 Bacteria 2786
406 Ga0495655_0020548 3300053083 Bacteria 1483
407 Ga0495619_0067071 3300053085 Bacteria 2395
408 Ga0500644_0012962 3300053088 Bacteria 2318
409 Ga0500651_0350923 3300053093 Bacteria 837
410 Ga0500641_0044750 3300053096 Bacteria 1801
411 Ga0500556_0005358 3300053104 Bacteria 3624
412 Ga0500562_001659 3300053108 Bacteria 5536
413 Ga0500562_079611 3300053108 Bacteria 886
414 Ga0500594_0006714 3300053118 Bacteria 2591
415 Ga0500594_0066079 3300053118 Bacteria 1053
416 Ga0500595_007507 3300053119 Bacteria 4523
417 Ga0500595_013335 3300053119 Bacteria 3151
418 Ga0500595_057976 3300053119 Bacteria 1178
419 Ga0500607_003871 3300053121 Bacteria 10629
420 Ga0500607_018257 3300053121 Bacteria 3986
421 Ga0500614_102201 3300053123 Bacteria 827
422 Ga0500618_000581 3300053125 Bacteria 22578
423 Ga0500658_0000554 3300053134 Bacteria 15719
424 Ga0500658_0000843 3300053134 Bacteria 12609
425 Ga0500658_0000851 3300053134 Bacteria 12533
426 Ga0500658_0137494 3300053134 Bacteria 1094
427 Ga0500658_0546389 3300053134 Bacteria 522
428 Ga0500568_0002458 3300053139 Bacteria 10893
429 Ga0500568_0006339 3300053139 Bacteria 5950
430 Ga0500568_0038655 3300053139 Bacteria 1930
431 Ga0500586_027711 3300053145 Bacteria 1843
432 Ga0500590_064260 3300053148 Bacteria 1838
433 Ga0500604_0019312 3300053151 Bacteria 1907
434 Ga0500616_0023743 3300053153 Bacteria 3413
435 Ga0500622_0003049 3300053156 Bacteria 11576
436 Ga0500637_0044706 3300053178 Bacteria 2510
437 Ga0500584_190358 3300053726 Bacteria 702
438 Ga0500645_003307 3300053730 Bacteria 6634
439 Ga0500645_008145 3300053730 Bacteria 3602
440 Ga0500596_015262 3300053735 Bacteria 1154
441 Ga0500587_009791 3300053739 Bacteria 1221

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2884811622 2884813478 147
2 iso_pu_bacteria 2884811622 2884813505 147
3 iso_pu_bacteria 2884836552 2884838314 147
4 iso_pu_bacteria 2884852848 2884854606 147
5 iso_pu_bacteria 2896154374 2896156726 147
6 3300005937 Ga0081455_10469329 Ga0081455_104693292 149
7 3300005539 Ga0068853_100964050 Ga0068853_1009640501 150
8 3300006178 Ga0075367_10038432 Ga0075367_100384323 150
9 3300013100 Ga0157373_10602591 Ga0157373_106025911 150
10 3300013105 Ga0157369_10127399 Ga0157369_101273994 150
11 3300046520 Ga0495637_0022179 Ga0495637_0022179_1212_1709 150
12 3300047472 Ga0495686_0061218 Ga0495686_0061218_615_1133 150
13 3300048924 Ga0496121_0002773 Ga0496121_0002773_18182_18700 150
14 3300053104 Ga0500556_0005358 Ga0500556_0005358_1662_2180 150
15 3300053134 Ga0500658_0000851 Ga0500658_0000851_11514_12032 150
16 3300001976 JGI24752J21851_1023845 JGI24752J21851_10238452 151
17 3300001977 JGI24746J21847_1017415 JGI24746J21847_10174152 151
18 3300001989 JGI24739J22299_10015538 JGI24739J22299_100155383 151
19 3300001990 JGI24737J22298_10067516 JGI24737J22298_100675162 151
20 3300002067 JGI24735J21928_10039107 JGI24735J21928_100391072 151
21 3300002070 JGI24750J21931_1001982 JGI24750J21931_10019822 151
22 3300002073 JGI24745J21846_1018551 JGI24745J21846_10185512 151
23 3300002075 JGI24738J21930_10003669 JGI24738J21930_100036694 151
24 3300002075 JGI24738J21930_10018854 JGI24738J21930_100188542 151
25 3300002076 JGI24749J21850_1022612 JGI24749J21850_10226121 151
26 3300002155 JGI24033J26618_1006109 JGI24033J26618_10061092 151
27 3300002239 JGI24034J26672_10023543 JGI24034J26672_100235431 151
28 3300002244 JGI24742J22300_10014170 JGI24742J22300_100141702 151
29 3300002459 JGI24751J29686_10027951 JGI24751J29686_100279512 151
30 3300002737 JGI25162J39368_1001062 JGI25162J39368_10010623 151
31 3300003187 JGI25151J46595_10004295 JGI25151J46595_100042957 151
32 3300003760 Ga0055527_1009166 Ga0055527_10091661 151
33 3300003762 Ga0055542_1000010 Ga0055542_1000010238 151
34 3300003791 Ga0055530_10001599 Ga0055530_1000159912 151
35 3300003792 Ga0055540_1000056 Ga0055540_100005613 151
36 3300003794 Ga0055531_10012262 Ga0055531_100122622 151
37 3300005327 Ga0070658_10204975 Ga0070658_102049753 151
38 3300005328 Ga0070676_10210736 Ga0070676_102107361 151
39 3300005330 Ga0070690_100101277 Ga0070690_1001012772 151
40 3300005331 Ga0070670_100042416 Ga0070670_1000424162 151
41 3300005333 Ga0070677_10140089 Ga0070677_101400892 151
42 3300005334 Ga0068869_100048596 Ga0068869_1000485963 151
43 3300005334 Ga0068869_100691029 Ga0068869_1006910292 151
44 3300005335 Ga0070666_10174239 Ga0070666_101742391 151
45 3300005335 Ga0070666_10416434 Ga0070666_104164341 151
46 3300005337 Ga0070682_100195956 Ga0070682_1001959562 151
47 3300005338 Ga0068868_100042826 Ga0068868_1000428262 151
48 3300005338 Ga0068868_101660059 Ga0068868_1016600591 151
49 3300005340 Ga0070689_100410619 Ga0070689_1004106192 151
50 3300005341 Ga0070691_10388471 Ga0070691_103884711 151
51 3300005343 Ga0070687_100183622 Ga0070687_1001836222 151
52 3300005344 Ga0070661_100137991 Ga0070661_1001379912 151
53 3300005345 Ga0070692_10182889 Ga0070692_101828892 151
54 3300005347 Ga0070668_100006813 Ga0070668_1000068132 151
55 3300005347 Ga0070668_100030063 Ga0070668_1000300632 151
56 3300005353 Ga0070669_100006637 Ga0070669_1000066379 151
57 3300005353 Ga0070669_100127067 Ga0070669_1001270671 151
58 3300005353 Ga0070669_101094375 Ga0070669_1010943751 151
59 3300005354 Ga0070675_100058955 Ga0070675_1000589553 151
60 3300005354 Ga0070675_100137223 Ga0070675_1001372231 151
61 3300005355 Ga0070671_100363318 Ga0070671_1003633182 151
62 3300005356 Ga0070674_100041390 Ga0070674_1000413902 151
63 3300005356 Ga0070674_100053461 Ga0070674_1000534613 151
64 3300005364 Ga0070673_100115562 Ga0070673_1001155623 151
65 3300005365 Ga0070688_100009530 Ga0070688_1000095305 151
66 3300005366 Ga0070659_100184742 Ga0070659_1001847422 151
67 3300005367 Ga0070667_100188906 Ga0070667_1001889062 151
68 3300005434 Ga0070709_10056690 Ga0070709_100566902 151
69 3300005436 Ga0070713_100079932 Ga0070713_1000799322 151
70 3300005436 Ga0070713_100276197 Ga0070713_1002761972 151
71 3300005438 Ga0070701_10020471 Ga0070701_100204713 151
72 3300005439 Ga0070711_100035079 Ga0070711_1000350792 151
73 3300005440 Ga0070705_100078772 Ga0070705_1000787722 151
74 3300005441 Ga0070700_100160416 Ga0070700_1001604162 151
75 3300005455 Ga0070663_100058035 Ga0070663_1000580353 151
76 3300005456 Ga0070678_100064287 Ga0070678_1000642872 151
77 3300005456 Ga0070678_100948650 Ga0070678_1009486501 151
78 3300005457 Ga0070662_100107482 Ga0070662_1001074823 151
79 3300005457 Ga0070662_100117561 Ga0070662_1001175611 151
80 3300005457 Ga0070662_100502811 Ga0070662_1005028112 151
81 3300005459 Ga0068867_100148739 Ga0068867_1001487393 151
82 3300005459 Ga0068867_100240270 Ga0068867_1002402702 151
83 3300005459 Ga0068867_100255308 Ga0068867_1002553082 151
84 3300005466 Ga0070685_10037468 Ga0070685_100374682 151
85 3300005539 Ga0068853_100224682 Ga0068853_1002246822 151
86 3300005543 Ga0070672_100019816 Ga0070672_1000198162 151
87 3300005543 Ga0070672_100046116 Ga0070672_1000461164 151
88 3300005548 Ga0070665_100026867 Ga0070665_1000268674 151
89 3300005548 Ga0070665_100091272 Ga0070665_1000912723 151
90 3300005548 Ga0070665_100256273 Ga0070665_1002562732 151
91 3300005548 Ga0070665_101287928 Ga0070665_1012879282 151
92 3300005563 Ga0068855_101267803 Ga0068855_1012678031 151
93 3300005577 Ga0068857_100495563 Ga0068857_1004955632 151
94 3300005578 Ga0068854_100345331 Ga0068854_1003453311 151
95 3300005578 Ga0068854_100796771 Ga0068854_1007967712 151
96 3300005614 Ga0068856_100147693 Ga0068856_1001476933 151
97 3300005615 Ga0070702_100167949 Ga0070702_1001679491 151
98 3300005616 Ga0068852_100053731 Ga0068852_1000537313 151
99 3300005617 Ga0068859_100423518 Ga0068859_1004235183 151
100 3300005618 Ga0068864_100251097 Ga0068864_1002510973 151
101 3300005618 Ga0068864_101630587 Ga0068864_1016305871 151
102 3300005718 Ga0068866_10038498 Ga0068866_100384983 151
103 3300005719 Ga0068861_100060727 Ga0068861_1000607273 151
104 3300005719 Ga0068861_100124247 Ga0068861_1001242472 151
105 3300005840 Ga0068870_10028839 Ga0068870_100288393 151
106 3300005841 Ga0068863_100029436 Ga0068863_1000294365 151
107 3300005842 Ga0068858_100063771 Ga0068858_1000637713 151
108 3300005843 Ga0068860_100077104 Ga0068860_1000771043 151
109 3300005843 Ga0068860_100636138 Ga0068860_1006361382 151
110 3300006042 Ga0075368_10033927 Ga0075368_100339272 151
111 3300006048 Ga0075363_100233180 Ga0075363_1002331802 151
112 3300006163 Ga0070715_10203514 Ga0070715_102035142 151
113 3300006173 Ga0070716_100272227 Ga0070716_1002722272 151
114 3300006175 Ga0070712_100188118 Ga0070712_1001881181 151
115 3300006178 Ga0075367_10013704 Ga0075367_100137044 151
116 3300006178 Ga0075367_10785812 Ga0075367_107858121 151
117 3300006186 Ga0075369_10290727 Ga0075369_102907272 151
118 3300006195 Ga0075366_10338163 Ga0075366_103381632 151
119 3300006237 Ga0097621_100090634 Ga0097621_1000906342 151
120 3300006353 Ga0075370_10015476 Ga0075370_100154763 151
121 3300006881 Ga0068865_100508258 Ga0068865_1005082582 151
122 3300006931 Ga0097620_100423553 Ga0097620_1004235533 151
123 3300009036 Ga0105244_10031275 Ga0105244_100312753 151
124 3300009093 Ga0105240_10069967 Ga0105240_100699672 151
125 3300009094 Ga0111539_10126189 Ga0111539_101261892 151
126 3300009098 Ga0105245_10182172 Ga0105245_101821722 151
127 3300009101 Ga0105247_10012867 Ga0105247_100128672 151
128 3300009148 Ga0105243_10085068 Ga0105243_100850682 151
129 3300009148 Ga0105243_10283198 Ga0105243_102831982 151
130 3300009177 Ga0105248_10417017 Ga0105248_104170172 151
131 3300009177 Ga0105248_10709749 Ga0105248_107097492 151
132 3300009551 Ga0105238_10431975 Ga0105238_104319752 151
133 3300009553 Ga0105249_10111341 Ga0105249_101113412 151
134 3300010375 Ga0105239_10198284 Ga0105239_101982842 151
135 3300011119 Ga0105246_10023003 Ga0105246_100230033 151
136 3300011119 Ga0105246_10026587 Ga0105246_100265874 151
137 3300012502 Ga0157347_1000351 Ga0157347_10003513 151
138 3300013100 Ga0157373_10259846 Ga0157373_102598463 151
139 3300013296 Ga0157374_10086114 Ga0157374_100861143 151
140 3300013297 Ga0157378_10387985 Ga0157378_103879852 151
141 3300013306 Ga0163162_10043498 Ga0163162_100434984 151
142 3300013306 Ga0163162_10219622 Ga0163162_102196222 151
143 3300013308 Ga0157375_10099447 Ga0157375_100994472 151
144 3300013308 Ga0157375_11142081 Ga0157375_111420812 151
145 3300014326 Ga0157380_10071341 Ga0157380_100713412 151
146 3300014326 Ga0157380_10207229 Ga0157380_102072292 151
147 3300014745 Ga0157377_10010298 Ga0157377_100102984 151
148 3300014969 Ga0157376_10053039 Ga0157376_100530392 151
149 3300017792 Ga0163161_10041462 Ga0163161_100414623 151
150 3300017792 Ga0163161_10087485 Ga0163161_100874852 151
151 3300017792 Ga0163161_10411449 Ga0163161_104114493 151
152 3300025228 Ga0209672_100149 Ga0209672_10014945 151
153 3300025231 Ga0207427_100581 Ga0207427_1005813 151
154 3300025233 Ga0209437_100180 Ga0209437_10018010 151
155 3300025242 Ga0209258_115862 Ga0209258_1158622 151
156 3300025250 Ga0209026_1003397 Ga0209026_10033973 151
157 3300025254 Ga0209148_1000005 Ga0209148_1000005110 151
158 3300025254 Ga0209148_1000927 Ga0209148_10009274 151
159 3300025272 Ga0209455_1001132 Ga0209455_10011327 151
160 3300025291 Ga0209675_1003885 Ga0209675_10038854 151
161 3300025292 Ga0209676_1015207 Ga0209676_10152072 151
162 3300025294 Ga0209025_1000038 Ga0209025_1000038229 151
163 3300025294 Ga0209025_1026751 Ga0209025_10267514 151
164 3300025294 Ga0209025_1090166 Ga0209025_10901662 151
165 3300025298 Ga0209050_1001130 Ga0209050_100113017 151
166 3300025298 Ga0209050_1011411 Ga0209050_10114113 151
167 3300025303 Ga0209051_1000068 Ga0209051_1000068192 151
168 3300025303 Ga0209051_1132710 Ga0209051_11327101 151
169 3300025304 Ga0209257_1000146 Ga0209257_1000146166 151
170 3300025304 Ga0209257_1008862 Ga0209257_10088626 151
171 3300025304 Ga0209257_1133174 Ga0209257_11331741 151
172 3300025893 Ga0207682_10045433 Ga0207682_100454332 151
173 3300025899 Ga0207642_10011487 Ga0207642_100114872 151
174 3300025900 Ga0207710_10142775 Ga0207710_101427752 151
175 3300025901 Ga0207688_10000265 Ga0207688_1000026522 151
176 3300025904 Ga0207647_10030013 Ga0207647_100300132 151
177 3300025905 Ga0207685_10043877 Ga0207685_100438771 151
178 3300025906 Ga0207699_10098813 Ga0207699_100988132 151
179 3300025907 Ga0207645_10264745 Ga0207645_102647452 151
180 3300025908 Ga0207643_10004823 Ga0207643_100048237 151
181 3300025911 Ga0207654_10145209 Ga0207654_101452092 151
182 3300025913 Ga0207695_10000623 Ga0207695_1000062325 151
183 3300025913 Ga0207695_10099902 Ga0207695_100999022 151
184 3300025915 Ga0207693_10055814 Ga0207693_100558143 151
185 3300025916 Ga0207663_10109893 Ga0207663_101098933 151
186 3300025918 Ga0207662_10387133 Ga0207662_103871332 151
187 3300025919 Ga0207657_10509204 Ga0207657_105092042 151
188 3300025920 Ga0207649_10363048 Ga0207649_103630482 151
189 3300025924 Ga0207694_10039780 Ga0207694_100397803 151
190 3300025925 Ga0207650_10119381 Ga0207650_101193812 151
191 3300025926 Ga0207659_10053643 Ga0207659_100536432 151
192 3300025926 Ga0207659_10637084 Ga0207659_106370841 151
193 3300025927 Ga0207687_10092657 Ga0207687_100926572 151
194 3300025928 Ga0207700_10512299 Ga0207700_105122992 151
195 3300025928 Ga0207700_10555359 Ga0207700_105553592 151
196 3300025929 Ga0207664_10978707 Ga0207664_109787071 151
197 3300025931 Ga0207644_10069862 Ga0207644_100698623 151
198 3300025931 Ga0207644_10787587 Ga0207644_107875872 151
199 3300025932 Ga0207690_10231855 Ga0207690_102318552 151
200 3300025933 Ga0207706_10051074 Ga0207706_100510742 151
201 3300025933 Ga0207706_10059971 Ga0207706_100599713 151
202 3300025933 Ga0207706_10662759 Ga0207706_106627592 151
203 3300025934 Ga0207686_10059739 Ga0207686_100597392 151
204 3300025935 Ga0207709_10012396 Ga0207709_100123965 151
205 3300025935 Ga0207709_10112089 Ga0207709_101120892 151
206 3300025935 Ga0207709_10308224 Ga0207709_103082241 151
207 3300025936 Ga0207670_10309023 Ga0207670_103090231 151
208 3300025937 Ga0207669_10017754 Ga0207669_100177544 151
209 3300025937 Ga0207669_10056272 Ga0207669_100562723 151
210 3300025938 Ga0207704_10001613 Ga0207704_100016132 151
211 3300025939 Ga0207665_10233989 Ga0207665_102339891 151
212 3300025940 Ga0207691_10024948 Ga0207691_100249482 151
213 3300025940 Ga0207691_10100234 Ga0207691_101002342 151
214 3300025941 Ga0207711_10252071 Ga0207711_102520712 151
215 3300025941 Ga0207711_10703876 Ga0207711_107038762 151
216 3300025942 Ga0207689_10047871 Ga0207689_100478712 151
217 3300025944 Ga0207661_10373477 Ga0207661_103734771 151
218 3300025961 Ga0207712_10069726 Ga0207712_100697262 151
219 3300025961 Ga0207712_10076551 Ga0207712_100765512 151
220 3300025981 Ga0207640_10138606 Ga0207640_101386062 151
221 3300025986 Ga0207658_10134534 Ga0207658_101345342 151
222 3300026023 Ga0207677_10010914 Ga0207677_100109142 151
223 3300026035 Ga0207703_10714771 Ga0207703_107147712 151
224 3300026067 Ga0207678_10049772 Ga0207678_100497722 151
225 3300026067 Ga0207678_10083321 Ga0207678_100833213 151
226 3300026075 Ga0207708_10041850 Ga0207708_100418502 151
227 3300026078 Ga0207702_10121551 Ga0207702_101215513 151
228 3300026088 Ga0207641_11052321 Ga0207641_110523212 151
229 3300026089 Ga0207648_10067616 Ga0207648_100676162 151
230 3300026089 Ga0207648_10145852 Ga0207648_101458522 151
231 3300026089 Ga0207648_10165133 Ga0207648_101651332 151
232 3300026095 Ga0207676_10028560 Ga0207676_100285602 151
233 3300026116 Ga0207674_10435835 Ga0207674_104358352 151
234 3300026118 Ga0207675_100022215 Ga0207675_1000222153 151
235 3300026118 Ga0207675_100165570 Ga0207675_1001655702 151
236 3300026118 Ga0207675_100426195 Ga0207675_1004261952 151
237 3300026121 Ga0207683_10085964 Ga0207683_100859644 151
238 3300026142 Ga0207698_10041739 Ga0207698_100417393 151
239 3300027866 Ga0209813_10067178 Ga0209813_100671782 151
240 3300027907 Ga0207428_10197525 Ga0207428_101975252 151
241 3300028379 Ga0268266_10000987 Ga0268266_100009877 151
242 3300028379 Ga0268266_10053867 Ga0268266_100538672 151
243 3300028379 Ga0268266_10688522 Ga0268266_106885222 151
244 3300028381 Ga0268264_10285724 Ga0268264_102857242 151
245 3300028381 Ga0268264_11998581 Ga0268264_119985811 151
246 3300028573 Ga0265334_10068104 Ga0265334_100681041 151
247 3300028794 Ga0307515_10129647 Ga0307515_101296472 151
248 3300028794 Ga0307515_10301134 Ga0307515_103011342 151
249 3300031456 Ga0307513_10030902 Ga0307513_100309026 151
250 3300031456 Ga0307513_10477009 Ga0307513_104770091 151
251 3300031507 Ga0307509_10519057 Ga0307509_105190571 151
252 3300031731 Ga0307405_10456051 Ga0307405_104560511 151
253 3300031911 Ga0307412_10000005 Ga0307412_10000005336 151
254 3300031911 Ga0307412_10000719 Ga0307412_100007198 151
255 3300032004 Ga0307414_11447223 Ga0307414_114472232 151
256 3300041451 Ga0451791_1041558 Ga0451791_1041558_136_624 151
257 3300041456 Ga0451795_0722678 Ga0451795_0722678_323_787 151
258 3300041491 Ga0451833_0661413 Ga0451833_0661413_2019_2507 151
259 3300041494 Ga0451837_1123389 Ga0451837_1123389_1593_2081 151
260 3300041498 Ga0451841_0728171 Ga0451841_0728171_263_718 151
261 3300041501 Ga0451845_0251577 Ga0451845_0251577_1832_2320 151
262 3300041503 Ga0451847_0656551 Ga0451847_0656551_291_746 151
263 3300041505 Ga0451849_0023198 Ga0451849_0023198_1525_2013 151
264 3300041507 Ga0451851_0863236 Ga0451851_0863236_3065_3553 151
265 3300041509 Ga0451843_0193478 Ga0451843_0193478_3436_3924 151
266 3300041511 Ga0451855_0182266 Ga0451855_0182266_2185_2673 151
267 3300041512 Ga0451853_1869799 Ga0451853_1869799_2049_2537 151
268 3300042004 Ga0439445_0144832 Ga0439445_0144832_70_525 151
269 3300042115 Ga0450911_008680 Ga0450911_008680_407_862 151
270 3300046455 Ga0495603_0773914 Ga0495603_0773914_71_526 151
271 3300046457 Ga0495590_0008667 Ga0495590_0008667_2442_2900 151
272 3300046460 Ga0495638_0010176 Ga0495638_0010176_508_963 151
273 3300046460 Ga0495638_0021911 Ga0495638_0021911_1292_1756 151
274 3300046460 Ga0495638_0133702 Ga0495638_0133702_164_619 151
275 3300046471 Ga0495650_0022378 Ga0495650_0022378_1453_1914 151
276 3300046491 Ga0495584_0143644 Ga0495584_0143644_45_500 151
277 3300046492 Ga0495585_0026958 Ga0495585_0026958_1057_1512 151
278 3300046507 Ga0495606_0007336 Ga0495606_0007336_5498_5956 151
279 3300046507 Ga0495606_0058971 Ga0495606_0058971_1357_1812 151
280 3300046507 Ga0495606_0078163 Ga0495606_0078163_1492_1950 151
281 3300046512 Ga0495610_0000875 Ga0495610_0000875_22061_22516 151
282 3300046512 Ga0495610_0010580 Ga0495610_0010580_138_593 151
283 3300046512 Ga0495610_0015666 Ga0495610_0015666_87_545 151
284 3300046512 Ga0495610_0032990 Ga0495610_0032990_2183_2647 151
285 3300046512 Ga0495610_0245592 Ga0495610_0245592_87_545 151
286 3300046513 Ga0495616_0001744 Ga0495616_0001744_12412_12867 151
287 3300046513 Ga0495616_0004030 Ga0495616_0004030_4980_5444 151
288 3300046515 Ga0495620_0162592 Ga0495620_0162592_164_619 151
289 3300046515 Ga0495620_0310559 Ga0495620_0310559_64_522 151
290 3300046517 Ga0495630_0009209 Ga0495630_0009209_1611_2069 151
291 3300046518 Ga0495631_0000034 Ga0495631_0000034_2017_2472 151
292 3300046518 Ga0495631_0004507 Ga0495631_0004507_6373_6837 151
293 3300046518 Ga0495631_0014386 Ga0495631_0014386_1489_1944 151
294 3300046519 Ga0495632_0080239 Ga0495632_0080239_947_1402 151
295 3300046520 Ga0495637_0050724 Ga0495637_0050724_247_702 151
296 3300046520 Ga0495637_0087133 Ga0495637_0087133_48_512 151
297 3300046522 Ga0495643_0000119 Ga0495643_0000119_27897_28352 151
298 3300046522 Ga0495643_0044388 Ga0495643_0044388_852_1310 151
299 3300046522 Ga0495643_0208460 Ga0495643_0208460_447_902 151
300 3300046524 Ga0495648_0029383 Ga0495648_0029383_2088_2588 151
301 3300046530 Ga0495654_0009859 Ga0495654_0009859_4173_4637 151
302 3300046538 Ga0495609_0175862 Ga0495609_0175862_41_496 151
303 3300046539 Ga0495621_0000487 Ga0495621_0000487_3044_3508 151
304 3300046539 Ga0495621_0010490 Ga0495621_0010490_2087_2548 151
305 3300046557 Ga0495622_0000017 Ga0495622_0000017_86198_86686 151
306 3300046557 Ga0495622_0066853 Ga0495622_0066853_1165_1620 151
307 3300046558 Ga0495633_0013469 Ga0495633_0013469_1037_1492 151
308 3300046616 Ga0495668_0029656 Ga0495668_0029656_1278_1742 151
309 3300046660 Ga0495625_0011979 Ga0495625_0011979_1525_1983 151
310 3300046660 Ga0495625_0014791 Ga0495625_0014791_2124_2624 151
311 3300046660 Ga0495625_0036359 Ga0495625_0036359_1887_2351 151
312 3300046660 Ga0495625_0281932 Ga0495625_0281932_498_956 151
313 3300046660 Ga0495625_0654391 Ga0495625_0654391_121_612 151
314 3300046674 Ga0495588_0023432 Ga0495588_0023432_2042_2497 151
315 3300046674 Ga0495588_0074947 Ga0495588_0074947_100_564 151
316 3300046678 Ga0495599_0258338 Ga0495599_0258338_549_1004 151
317 3300046690 Ga0495624_0007293 Ga0495624_0007293_3597_4055 151
318 3300046690 Ga0495624_0256011 Ga0495624_0256011_263_751 151
319 3300046691 Ga0495670_0000034 Ga0495670_0000034_51430_51918 151
320 3300046694 Ga0495649_0006213 Ga0495649_0006213_1703_2161 151
321 3300046694 Ga0495649_0016664 Ga0495649_0016664_2515_2970 151
322 3300046810 Ga0495660_0074634 Ga0495660_0074634_1104_1562 151
323 3300046810 Ga0495660_0131077 Ga0495660_0131077_608_1063 151
324 3300047318 Ga0495636_0446237 Ga0495636_0446237_118_579 151
325 3300047319 Ga0495674_0020845 Ga0495674_0020845_2326_2784 151
326 3300047320 Ga0495672_0000113 Ga0495672_0000113_120778_121233 151
327 3300047320 Ga0495672_0046337 Ga0495672_0046337_228_683 151
328 3300047320 Ga0495672_0492234 Ga0495672_0492234_37_492 151
329 3300047321 Ga0495676_0000452 Ga0495676_0000452_31499_31954 151
330 3300047321 Ga0495676_0069445 Ga0495676_0069445_833_1291 151
331 3300047323 Ga0495683_0004301 Ga0495683_0004301_6280_6738 151
332 3300047443 Ga0495687_026193 Ga0495687_026193_236_694 151
333 3300047443 Ga0495687_223492 Ga0495687_223492_89_553 151
334 3300047471 Ga0495684_0303529 Ga0495684_0303529_154_609 151
335 3300047472 Ga0495686_0000171 Ga0495686_0000171_66293_66748 151
336 3300047472 Ga0495686_0005885 Ga0495686_0005885_7521_7976 151
337 3300047472 Ga0495686_0024920 Ga0495686_0024920_2545_3000 151
338 3300047472 Ga0495686_0090099 Ga0495686_0090099_1111_1572 151
339 3300047472 Ga0495686_0099934 Ga0495686_0099934_1251_1706 151
340 3300047472 Ga0495686_0125915 Ga0495686_0125915_848_1321 151
341 3300048088 Ga0495602_0983897 Ga0495602_0983897_85_540 151
342 3300048091 Ga0495626_0043164 Ga0495626_0043164_469_927 151
343 3300048903 Ga0496100_0011905 Ga0496100_0011905_4053_4508 151
344 3300048903 Ga0496100_0341411 Ga0496100_0341411_23_478 151
345 3300048904 Ga0496101_0039548 Ga0496101_0039548_897_1352 151
346 3300048905 Ga0496102_0068441 Ga0496102_0068441_2550_3005 151
347 3300048905 Ga0496102_0116826 Ga0496102_0116826_681_1136 151
348 3300048906 Ga0496103_0031903 Ga0496103_0031903_2030_2485 151
349 3300048907 Ga0496104_0001689 Ga0496104_0001689_15387_15842 151
350 3300048907 Ga0496104_0385637 Ga0496104_0385637_728_1183 151
351 3300048908 Ga0496105_0006576 Ga0496105_0006576_4955_5410 151
352 3300048908 Ga0496105_0011543 Ga0496105_0011543_5633_6088 151
353 3300048909 Ga0496106_0026193 Ga0496106_0026193_2153_2608 151
354 3300048910 Ga0496107_0057656 Ga0496107_0057656_812_1267 151
355 3300048911 Ga0496108_0125569 Ga0496108_0125569_79_534 151
356 3300048913 Ga0496110_0011458 Ga0496110_0011458_845_1300 151
357 3300048913 Ga0496110_0011618 Ga0496110_0011618_2738_3193 151
358 3300048914 Ga0496111_0022690 Ga0496111_0022690_3125_3580 151
359 3300048915 Ga0496112_0039790 Ga0496112_0039790_569_1024 151
360 3300048916 Ga0496113_0010233 Ga0496113_0010233_3818_4273 151
361 3300048916 Ga0496113_0165182 Ga0496113_0165182_175_630 151
362 3300048917 Ga0496114_0021581 Ga0496114_0021581_4049_4504 151
363 3300048917 Ga0496114_0654513 Ga0496114_0654513_93_557 151
364 3300048917 Ga0496114_1048527 Ga0496114_1048527_47_502 151
365 3300048918 Ga0496115_0005763 Ga0496115_0005763_7790_8245 151
366 3300048918 Ga0496115_0009575 Ga0496115_0009575_3595_4050 151
367 3300048919 Ga0496116_0038115 Ga0496116_0038115_2498_2953 151
368 3300048919 Ga0496116_0084581 Ga0496116_0084581_341_808 151
369 3300048919 Ga0496116_0295822 Ga0496116_0295822_267_755 151
370 3300048920 Ga0496117_0035957 Ga0496117_0035957_1075_1542 151
371 3300048920 Ga0496117_0205156 Ga0496117_0205156_494_961 151
372 3300048920 Ga0496117_0249188 Ga0496117_0249188_343_807 151
373 3300048921 Ga0496118_0014499 Ga0496118_0014499_4692_5156 151
374 3300048921 Ga0496118_0026112 Ga0496118_0026112_1377_1844 151
375 3300048921 Ga0496118_0163190 Ga0496118_0163190_629_1084 151
376 3300048921 Ga0496118_0180919 Ga0496118_0180919_696_1151 151
377 3300048922 Ga0496119_0058022 Ga0496119_0058022_699_1166 151
378 3300048922 Ga0496119_0061915 Ga0496119_0061915_1197_1685 151
379 3300048922 Ga0496119_0069059 Ga0496119_0069059_212_676 151
380 3300048922 Ga0496119_0146193 Ga0496119_0146193_673_1128 151
381 3300048923 Ga0496120_0362516 Ga0496120_0362516_145_609 151
382 3300048924 Ga0496121_0033112 Ga0496121_0033112_52_510 151
383 3300048924 Ga0496121_0035998 Ga0496121_0035998_47_502 151
384 3300048924 Ga0496121_0075659 Ga0496121_0075659_1659_2126 151
385 3300048924 Ga0496121_0080934 Ga0496121_0080934_1338_1802 151
386 3300048925 Ga0496122_0037324 Ga0496122_0037324_3400_3855 151
387 3300048925 Ga0496122_0226287 Ga0496122_0226287_96_560 151
388 3300048926 Ga0496123_0025585 Ga0496123_0025585_2772_3227 151
389 3300048926 Ga0496123_0057017 Ga0496123_0057017_554_1021 151
390 3300048926 Ga0496123_0098155 Ga0496123_0098155_931_1389 151
391 3300048927 Ga0496124_0002374 Ga0496124_0002374_20397_20852 151
392 3300048928 Ga0496125_0112004 Ga0496125_0112004_1098_1565 151
393 3300048928 Ga0496125_0172242 Ga0496125_0172242_926_1390 151
394 3300048928 Ga0496125_0201044 Ga0496125_0201044_771_1259 151
395 3300048928 Ga0496125_0224222 Ga0496125_0224222_582_1046 151
396 3300048928 Ga0496125_0249920 Ga0496125_0249920_227_682 151
397 3300048929 Ga0496126_0054105 Ga0496126_0054105_2433_2888 151
398 3300048929 Ga0496126_0129639 Ga0496126_0129639_751_1206 151
399 3300048929 Ga0496126_0148263 Ga0496126_0148263_1523_1987 151
400 3300048929 Ga0496126_0296535 Ga0496126_0296535_436_891 151
401 3300048929 Ga0496126_1026637 Ga0496126_1026637_23_478 151
402 3300049459 Ga0495678_000827 Ga0495678_000827_21882_22337 151
403 3300050489 nmdc:mga03683_382034_c1 nmdc:mga03683_382034_c1_62_517 151
404 3300050490 nmdc:mga03n38_831348_c1 nmdc:mga03n38_831348_c1_73_528 151
405 3300050491 nmdc:mga00v17_573799_c1 nmdc:mga00v17_573799_c1_61_516 151
406 3300050493 nmdc:mga0k408_116257_c1 nmdc:mga0k408_116257_c1_1074_1529 151
407 3300050493 nmdc:mga0k408_389060_c1 nmdc:mga0k408_389060_c1_243_707 151
408 3300050494 nmdc:mga06z11_100373_c1 nmdc:mga06z11_100373_c1_231_698 151
409 3300050495 nmdc:mga04h51_81015_c1 nmdc:mga04h51_81015_c1_325_792 151
410 3300050496 nmdc:mga07m45_266808_c1 nmdc:mga07m45_266808_c1_167_634 151
411 3300050511 nmdc:mga08y16_233061_c1 nmdc:mga08y16_233061_c1_342_797 151
412 3300053077 Ga0495601_0044636 Ga0495601_0044636_1019_1474 151
413 3300053083 Ga0495655_0020548 Ga0495655_0020548_743_1198 151
414 3300053085 Ga0495619_0067071 Ga0495619_0067071_1459_1914 151
415 3300053088 Ga0500644_0012962 Ga0500644_0012962_42_500 151
416 3300053093 Ga0500651_0350923 Ga0500651_0350923_20_475 151
417 3300053096 Ga0500641_0044750 Ga0500641_0044750_371_826 151
418 3300053108 Ga0500562_001659 Ga0500562_001659_847_1311 151
419 3300053108 Ga0500562_079611 Ga0500562_079611_403_867 151
420 3300053118 Ga0500594_0006714 Ga0500594_0006714_1662_2162 151
421 3300053118 Ga0500594_0066079 Ga0500594_0066079_466_930 151
422 3300053119 Ga0500595_007507 Ga0500595_007507_1746_2201 151
423 3300053119 Ga0500595_013335 Ga0500595_013335_1878_2402 151
424 3300053119 Ga0500595_057976 Ga0500595_057976_343_798 151
425 3300053121 Ga0500607_003871 Ga0500607_003871_2360_2824 151
426 3300053121 Ga0500607_018257 Ga0500607_018257_1774_2340 151
427 3300053123 Ga0500614_102201 Ga0500614_102201_215_679 151
428 3300053125 Ga0500618_000581 Ga0500618_000581_20442_20897 151
429 3300053134 Ga0500658_0000554 Ga0500658_0000554_4711_5175 151
430 3300053134 Ga0500658_0000843 Ga0500658_0000843_11648_12154 151
431 3300053134 Ga0500658_0137494 Ga0500658_0137494_266_721 151
432 3300053134 Ga0500658_0546389 Ga0500658_0546389_52_507 151
433 3300053139 Ga0500568_0002458 Ga0500568_0002458_1466_1930 151
434 3300053139 Ga0500568_0006339 Ga0500568_0006339_5168_5623 151
435 3300053139 Ga0500568_0038655 Ga0500568_0038655_1323_1778 151
436 3300053145 Ga0500586_027711 Ga0500586_027711_616_1071 151
437 3300053148 Ga0500590_064260 Ga0500590_064260_213_668 151
438 3300053151 Ga0500604_0019312 Ga0500604_0019312_789_1244 151
439 3300053153 Ga0500616_0023743 Ga0500616_0023743_2345_2809 151
440 3300053156 Ga0500622_0003049 Ga0500622_0003049_6194_6661 151
441 3300053178 Ga0500637_0044706 Ga0500637_0044706_1180_1635 151
442 3300053726 Ga0500584_190358 Ga0500584_190358_54_512 151
443 3300053730 Ga0500645_003307 Ga0500645_003307_694_1152 151
444 3300053730 Ga0500645_008145 Ga0500645_008145_754_1209 151
445 3300053735 Ga0500596_015262 Ga0500596_015262_180_638 151
446 3300053739 Ga0500587_009791 Ga0500587_009791_100_555 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

44

127

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9757 11 143
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9614 11 143
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9573 1 145
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9547 2 145
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9444 1 145
ID Description Score Start End Superfamily
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9704 4 139 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9697 4 139 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9581 2 145 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9542 6 143 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9342 6 143 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A4Q7RCA5-F1-model_v4 AhpD family alkylhydroperoxidase 1.001 4 146 GO:0051920
AF-A0A4P7L6S2-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9998 4 150 GO:0051920
AF-A0A512N1X1-F1-model_v4 Alkyl hydroperoxide reductase AhpD 0.9944 16 146 GO:0051920
AF-A0A0T6Z810-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9939 39 151 GO:0051920
AF-A0A1V2H0A2-F1-model_v4 Alkylhydroperoxidase 0.9935 3 148 GO:0051920

Feature Viewer

pLDDT pTM Quality
94.99 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map