F445909
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 447 | 295 | 416 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10234957|Ga0070717_102349572 |
| Length | 226 |
| Sequence | MRPLTDSCEAGWARALEPVAAQISAMGDFLREEITQGRTYLPSGDNVLRAFKQPFDEVRVLIVGQDPYPTPGHPIGLSFSVAPTVKRIPGSLLNIFKEYTADLGYPRPATGDLTPWAENGVLLLNRVLTVQPGKPGSHRGKGWEAVTEQAIKALAERNDRGNPLVAILWGRDARNLAPLLGGVPKIESAHPSPMVANGDFFGSRPFSRANQLLEAHGGTAVDWKLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 3 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 4 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 5 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 6 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 7 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 8 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 9 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 10 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 11 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 12 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 13 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 14 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 15 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 16 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 17 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 18 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 19 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 20 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 21 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 22 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 23 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 24 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 25 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 26 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 27 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 28 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 29 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 30 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 31 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 32 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 33 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 170 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 171 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 175 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 176 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 177 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 179 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 180 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 189 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 278 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 290 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 293 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 294 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 295 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.72 |
| Metatranscriptomes | 1.34 |
| Isolates | 6.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.57 |
| Nodule | 0.45 |
| Rhizoplane | 6.26 |
| Rhizosphere | 83.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10054851 | 3300001990 | Bacteria | 1205 |
| 2 | rootH2_10078173 | 3300003320 | Bacteria | 7058 |
| 3 | rootH2_10154633 | 3300003320 | Bacteria | 2278 |
| 4 | rootL2_10064882 | 3300003322 | Bacteria | 5965 |
| 5 | rootH1_10000259 | 3300003323 | Bacteria | 5285 |
| 6 | Ga0070658_10273613 | 3300005327 | Bacteria | 1437 |
| 7 | Ga0070658_10315635 | 3300005327 | Bacteria | 1334 |
| 8 | Ga0070676_10090925 | 3300005328 | Bacteria | 1869 |
| 9 | Ga0070676_10284737 | 3300005328 | Bacteria | 1115 |
| 10 | Ga0070683_100349820 | 3300005329 | Bacteria | 1407 |
| 11 | Ga0070683_101152881 | 3300005329 | Bacteria | 745 |
| 12 | Ga0070682_100138817 | 3300005337 | Bacteria | 1654 |
| 13 | Ga0070682_100399074 | 3300005337 | Bacteria | 1039 |
| 14 | Ga0068868_100280413 | 3300005338 | Bacteria | 1410 |
| 15 | Ga0068868_100329627 | 3300005338 | Bacteria | 1302 |
| 16 | Ga0068868_100555549 | 3300005338 | Bacteria | 1012 |
| 17 | Ga0070661_100119207 | 3300005344 | Bacteria | 1975 |
| 18 | Ga0070692_10205648 | 3300005345 | Bacteria | 1155 |
| 19 | Ga0070668_100502719 | 3300005347 | Bacteria | 1049 |
| 20 | Ga0070675_100094864 | 3300005354 | Bacteria | 2504 |
| 21 | Ga0070671_100000412 | 3300005355 | Bacteria | 29645 |
| 22 | Ga0070671_100141970 | 3300005355 | Bacteria | 2026 |
| 23 | Ga0070674_100250145 | 3300005356 | Bacteria | 1392 |
| 24 | Ga0070674_100443684 | 3300005356 | Bacteria | 1070 |
| 25 | Ga0070674_100470224 | 3300005356 | Bacteria | 1041 |
| 26 | Ga0070659_100024271 | 3300005366 | Bacteria | 4647 |
| 27 | Ga0070659_100275667 | 3300005366 | Bacteria | 1398 |
| 28 | Ga0070667_100000063 | 3300005367 | Bacteria | 138777 |
| 29 | Ga0070667_100066231 | 3300005367 | Bacteria | 3069 |
| 30 | Ga0070667_100248145 | 3300005367 | Bacteria | 1591 |
| 31 | Ga0070667_100343974 | 3300005367 | Bacteria | 1349 |
| 32 | Ga0070714_100003703 | 3300005435 | Bacteria | 11447 |
| 33 | Ga0070714_100202674 | 3300005435 | Bacteria | 1815 |
| 34 | Ga0070714_100333367 | 3300005435 | Bacteria | 1421 |
| 35 | Ga0070713_100065734 | 3300005436 | Bacteria | 3048 |
| 36 | Ga0070710_10292177 | 3300005437 | Bacteria | 1061 |
| 37 | Ga0070710_10340458 | 3300005437 | Bacteria | 990 |
| 38 | Ga0070663_100134044 | 3300005455 | Bacteria | 1884 |
| 39 | Ga0070663_100165363 | 3300005455 | Bacteria | 1706 |
| 40 | Ga0070663_100313277 | 3300005455 | Bacteria | 1260 |
| 41 | Ga0070662_100200027 | 3300005457 | Bacteria | 1585 |
| 42 | Ga0070681_10313913 | 3300005458 | Bacteria | 1477 |
| 43 | Ga0068867_100093300 | 3300005459 | Bacteria | 2288 |
| 44 | Ga0068867_100393851 | 3300005459 | Bacteria | 1167 |
| 45 | Ga0070685_10065308 | 3300005466 | Bacteria | 2141 |
| 46 | Ga0070698_100059764 | 3300005471 | Bacteria | 3849 |
| 47 | Ga0070684_100308254 | 3300005535 | Bacteria | 1453 |
| 48 | Ga0068853_100091299 | 3300005539 | Bacteria | 2678 |
| 49 | Ga0070672_100372170 | 3300005543 | Bacteria | 1221 |
| 50 | Ga0070696_100006628 | 3300005546 | Bacteria | 7736 |
| 51 | Ga0070665_100099962 | 3300005548 | Bacteria | 2905 |
| 52 | Ga0070665_100349692 | 3300005548 | Bacteria | 1483 |
| 53 | Ga0068855_100102803 | 3300005563 | Bacteria | 3288 |
| 54 | Ga0070664_100042117 | 3300005564 | Bacteria | 3855 |
| 55 | Ga0068857_100268183 | 3300005577 | Bacteria | 1568 |
| 56 | Ga0068854_100048597 | 3300005578 | Bacteria | 3027 |
| 57 | Ga0068856_100498678 | 3300005614 | Bacteria | 1238 |
| 58 | Ga0070702_100172161 | 3300005615 | Bacteria | 1409 |
| 59 | Ga0068852_100634905 | 3300005616 | Bacteria | 1074 |
| 60 | Ga0068859_100000777 | 3300005617 | Bacteria | 32236 |
| 61 | Ga0068859_100000944 | 3300005617 | Bacteria | 29749 |
| 62 | Ga0068859_100682276 | 3300005617 | Bacteria | 1119 |
| 63 | Ga0068864_100661970 | 3300005618 | Bacteria | 1017 |
| 64 | Ga0068866_10499300 | 3300005718 | Bacteria | 805 |
| 65 | Ga0068851_10052054 | 3300005834 | Bacteria | 2082 |
| 66 | Ga0068851_10095684 | 3300005834 | Bacteria | 1569 |
| 67 | Ga0068870_10356105 | 3300005840 | Bacteria | 940 |
| 68 | Ga0068863_100000159 | 3300005841 | Bacteria | 71831 |
| 69 | Ga0068863_100000648 | 3300005841 | Bacteria | 35309 |
| 70 | Ga0068863_100007113 | 3300005841 | Bacteria | 10973 |
| 71 | Ga0068863_100035863 | 3300005841 | Bacteria | 4723 |
| 72 | Ga0068858_100009162 | 3300005842 | Bacteria | 9462 |
| 73 | Ga0068858_100051255 | 3300005842 | Bacteria | 3818 |
| 74 | Ga0068858_100056127 | 3300005842 | Bacteria | 3641 |
| 75 | Ga0068860_100000065 | 3300005843 | Bacteria | 186634 |
| 76 | Ga0068862_100000028 | 3300005844 | Bacteria | 184197 |
| 77 | Ga0068862_100583839 | 3300005844 | Bacteria | 1071 |
| 78 | Ga0081540_1005051 | 3300005983 | Bacteria | 9898 |
| 79 | Ga0070717_10205762 | 3300006028 | Bacteria | 1725 |
| 80 | Ga0070717_10234957 | 3300006028 | Bacteria | 1615 |
| 81 | Ga0070717_10543512 | 3300006028 | Bacteria | 1052 |
| 82 | Ga0075365_10091417 | 3300006038 | Bacteria | 2074 |
| 83 | Ga0075364_10130295 | 3300006051 | Bacteria | 1688 |
| 84 | Ga0075370_10117767 | 3300006353 | Bacteria | 1545 |
| 85 | Ga0075428_100006048 | 3300006844 | Bacteria | 13445 |
| 86 | Ga0075428_100293330 | 3300006844 | Bacteria | 1749 |
| 87 | Ga0075430_100019963 | 3300006846 | Bacteria | 5702 |
| 88 | Ga0097620_100000777 | 3300006931 | Bacteria | 32236 |
| 89 | Ga0097620_100000944 | 3300006931 | Bacteria | 29749 |
| 90 | Ga0097620_100016788 | 3300006931 | Bacteria | 7351 |
| 91 | Ga0097620_100682290 | 3300006931 | Bacteria | 1119 |
| 92 | Ga0099794_10239930 | 3300007265 | Bacteria | 934 |
| 93 | Ga0111539_10587084 | 3300009094 | Bacteria | 1297 |
| 94 | Ga0111539_10885408 | 3300009094 | Bacteria | 1038 |
| 95 | Ga0111539_11266795 | 3300009094 | Bacteria | 856 |
| 96 | Ga0105245_10172177 | 3300009098 | Bacteria | 2062 |
| 97 | Ga0105245_10554059 | 3300009098 | Bacteria | 1172 |
| 98 | Ga0105247_10254600 | 3300009101 | Bacteria | 1201 |
| 99 | Ga0114129_10001766 | 3300009147 | Bacteria | 29481 |
| 100 | Ga0105243_10017906 | 3300009148 | Bacteria | 5361 |
| 101 | Ga0105243_10998772 | 3300009148 | Bacteria | 839 |
| 102 | Ga0105241_10118131 | 3300009174 | Bacteria | 2132 |
| 103 | Ga0105242_10267051 | 3300009176 | Bacteria | 1548 |
| 104 | Ga0105242_10632539 | 3300009176 | Bacteria | 1038 |
| 105 | Ga0105248_10050782 | 3300009177 | Bacteria | 4652 |
| 106 | Ga0105237_10351936 | 3300009545 | Bacteria | 1477 |
| 107 | Ga0105237_10808241 | 3300009545 | Bacteria | 944 |
| 108 | Ga0105238_10979354 | 3300009551 | Bacteria | 866 |
| 109 | Ga0105249_10080852 | 3300009553 | Bacteria | 3020 |
| 110 | Ga0105249_10108052 | 3300009553 | Bacteria | 2626 |
| 111 | Ga0105249_11123445 | 3300009553 | Bacteria | 856 |
| 112 | Ga0105239_10454534 | 3300010375 | Bacteria | 1453 |
| 113 | Ga0105239_10673605 | 3300010375 | Bacteria | 1182 |
| 114 | Ga0105239_11197895 | 3300010375 | Bacteria | 875 |
| 115 | Ga0105246_10069559 | 3300011119 | Bacteria | 2473 |
| 116 | Ga0105246_10526913 | 3300011119 | Bacteria | 1008 |
| 117 | Ga0157369_10721866 | 3300013105 | Bacteria | 1026 |
| 118 | Ga0157374_10922242 | 3300013296 | Bacteria | 891 |
| 119 | Ga0157374_11124584 | 3300013296 | Bacteria | 806 |
| 120 | Ga0157378_10205516 | 3300013297 | Bacteria | 1865 |
| 121 | Ga0163162_11193323 | 3300013306 | Bacteria | 863 |
| 122 | Ga0157372_10634128 | 3300013307 | Bacteria | 1245 |
| 123 | Ga0157375_10361858 | 3300013308 | Bacteria | 1617 |
| 124 | Ga0163163_10567906 | 3300014325 | Bacteria | 1197 |
| 125 | Ga0163163_10744957 | 3300014325 | Bacteria | 1043 |
| 126 | Ga0163163_10834937 | 3300014325 | Bacteria | 985 |
| 127 | Ga0157377_10187800 | 3300014745 | Bacteria | 1304 |
| 128 | Ga0157379_10001387 | 3300014968 | Bacteria | 19820 |
| 129 | Ga0157379_10473616 | 3300014968 | Bacteria | 1158 |
| 130 | Ga0206356_11257196 | 3300020070 | Bacteria | 758 |
| 131 | Ga0206354_10127114 | 3300020081 | Bacteria | 1097 |
| 132 | Ga0206354_10547656 | 3300020081 | Bacteria | 1366 |
| 133 | Ga0206354_11585944 | 3300020081 | Bacteria | 2151 |
| 134 | Ga0206353_11490006 | 3300020082 | Bacteria | 5780 |
| 135 | Ga0213876_10140919 | 3300021384 | Bacteria | 1282 |
| 136 | Ga0224712_10001633 | 3300022467 | Bacteria | 5269 |
| 137 | Ga0207656_10056297 | 3300025321 | Bacteria | 1714 |
| 138 | Ga0207692_10191226 | 3300025898 | Bacteria | 1198 |
| 139 | Ga0207710_10000014 | 3300025900 | Bacteria | 408072 |
| 140 | Ga0207680_10083273 | 3300025903 | Bacteria | 2016 |
| 141 | Ga0207647_10010162 | 3300025904 | Bacteria | 6652 |
| 142 | Ga0207647_10029890 | 3300025904 | Bacteria | 3520 |
| 143 | Ga0207645_10005431 | 3300025907 | Bacteria | 9240 |
| 144 | Ga0207643_10022720 | 3300025908 | Bacteria | 3456 |
| 145 | Ga0207705_10511636 | 3300025909 | Bacteria | 933 |
| 146 | Ga0207684_10040070 | 3300025910 | Bacteria | 3971 |
| 147 | Ga0207654_10275731 | 3300025911 | Bacteria | 1136 |
| 148 | Ga0207707_10153234 | 3300025912 | Bacteria | 2015 |
| 149 | Ga0207671_10201562 | 3300025914 | Bacteria | 1554 |
| 150 | Ga0207662_10077997 | 3300025918 | Bacteria | 2016 |
| 151 | Ga0207657_10038410 | 3300025919 | Bacteria | 4262 |
| 152 | Ga0207657_10165552 | 3300025919 | Bacteria | 1794 |
| 153 | Ga0207646_10007353 | 3300025922 | Bacteria | 11218 |
| 154 | Ga0207681_10008158 | 3300025923 | Bacteria | 6403 |
| 155 | Ga0207681_10052825 | 3300025923 | Bacteria | 2757 |
| 156 | Ga0207694_10280498 | 3300025924 | Bacteria | 1368 |
| 157 | Ga0207700_10040749 | 3300025928 | Bacteria | 3392 |
| 158 | Ga0207700_10759554 | 3300025928 | Bacteria | 866 |
| 159 | Ga0207664_10019741 | 3300025929 | Bacteria | 4988 |
| 160 | Ga0207664_10021809 | 3300025929 | Bacteria | 4772 |
| 161 | Ga0207644_10000973 | 3300025931 | Bacteria | 18301 |
| 162 | Ga0207690_10397641 | 3300025932 | Bacteria | 1098 |
| 163 | Ga0207706_10028187 | 3300025933 | Bacteria | 5017 |
| 164 | Ga0207709_10018663 | 3300025935 | Bacteria | 3888 |
| 165 | Ga0207711_10000373 | 3300025941 | Bacteria | 47596 |
| 166 | Ga0207661_10212631 | 3300025944 | Bacteria | 1705 |
| 167 | Ga0207661_10442651 | 3300025944 | Bacteria | 1183 |
| 168 | Ga0207661_10614303 | 3300025944 | Bacteria | 998 |
| 169 | Ga0207661_11036715 | 3300025944 | Bacteria | 755 |
| 170 | Ga0207679_10853935 | 3300025945 | Bacteria | 831 |
| 171 | Ga0207712_10000020 | 3300025961 | Bacteria | 292796 |
| 172 | Ga0207712_10156740 | 3300025961 | Bacteria | 1765 |
| 173 | Ga0207640_10021935 | 3300025981 | Bacteria | 3814 |
| 174 | Ga0207658_10002515 | 3300025986 | Bacteria | 13345 |
| 175 | Ga0207658_10468518 | 3300025986 | Bacteria | 1118 |
| 176 | Ga0207677_10362973 | 3300026023 | Bacteria | 1217 |
| 177 | Ga0207677_10412387 | 3300026023 | Bacteria | 1148 |
| 178 | Ga0207677_10422772 | 3300026023 | Bacteria | 1135 |
| 179 | Ga0207678_10042928 | 3300026067 | Bacteria | 3914 |
| 180 | Ga0207678_10209556 | 3300026067 | Bacteria | 1667 |
| 181 | Ga0207678_10351524 | 3300026067 | Bacteria | 1271 |
| 182 | Ga0207702_10519405 | 3300026078 | Bacteria | 1162 |
| 183 | Ga0207702_10533345 | 3300026078 | Bacteria | 1147 |
| 184 | Ga0207641_10000156 | 3300026088 | Bacteria | 97171 |
| 185 | Ga0207641_10006370 | 3300026088 | Bacteria | 9964 |
| 186 | Ga0207641_10010166 | 3300026088 | Bacteria | 7738 |
| 187 | Ga0207641_10452737 | 3300026088 | Bacteria | 1241 |
| 188 | Ga0207641_10563431 | 3300026088 | Bacteria | 1112 |
| 189 | Ga0207648_10028113 | 3300026089 | Bacteria | 4988 |
| 190 | Ga0207674_10140376 | 3300026116 | Bacteria | 2375 |
| 191 | Ga0207674_10248874 | 3300026116 | Bacteria | 1724 |
| 192 | Ga0207674_10271064 | 3300026116 | Bacteria | 1645 |
| 193 | Ga0207674_10273547 | 3300026116 | Bacteria | 1637 |
| 194 | Ga0207675_100096500 | 3300026118 | Bacteria | 2783 |
| 195 | Ga0207683_10058309 | 3300026121 | Bacteria | 3390 |
| 196 | Ga0207683_10119659 | 3300026121 | Bacteria | 2363 |
| 197 | Ga0207683_10683255 | 3300026121 | Bacteria | 951 |
| 198 | Ga0207698_10174278 | 3300026142 | Bacteria | 1898 |
| 199 | Ga0207698_10378080 | 3300026142 | Bacteria | 1346 |
| 200 | Ga0207698_10525772 | 3300026142 | Bacteria | 1155 |
| 201 | Ga0207428_10078385 | 3300027907 | Bacteria | 2585 |
| 202 | Ga0268266_10021318 | 3300028379 | Bacteria | 5521 |
| 203 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 204 | Ga0268264_10000024 | 3300028381 | Bacteria | 470081 |
| 205 | Ga0268264_10127816 | 3300028381 | Bacteria | 2249 |
| 206 | Ga0268264_10628197 | 3300028381 | Bacteria | 1061 |
| 207 | Ga0265319_1000773 | 3300028563 | Bacteria | 20790 |
| 208 | Ga0265334_10005961 | 3300028573 | Bacteria | 5301 |
| 209 | Ga0265318_10050946 | 3300028577 | Bacteria | 1555 |
| 210 | Ga0265323_10005739 | 3300028653 | Bacteria | 5259 |
| 211 | Ga0265322_10002763 | 3300028654 | Bacteria | 5366 |
| 212 | Ga0265338_10000755 | 3300028800 | Bacteria | 55199 |
| 213 | Ga0265338_10002435 | 3300028800 | Bacteria | 27969 |
| 214 | Ga0265338_10563380 | 3300028800 | Bacteria | 797 |
| 215 | Ga0265324_10000222 | 3300029957 | Bacteria | 43679 |
| 216 | Ga0265324_10005107 | 3300029957 | Bacteria | 5745 |
| 217 | Ga0316182_1326249 | 3300030745 | Bacteria | 1193 |
| 218 | Ga0265332_10001370 | 3300031238 | Bacteria | 13798 |
| 219 | Ga0265320_10031179 | 3300031240 | Bacteria | 2740 |
| 220 | Ga0265320_10064379 | 3300031240 | Bacteria | 1742 |
| 221 | Ga0265325_10027514 | 3300031241 | Bacteria | 3073 |
| 222 | Ga0307513_10128345 | 3300031456 | Bacteria | 2486 |
| 223 | Ga0307513_10297614 | 3300031456 | Bacteria | 1382 |
| 224 | Ga0307516_10330947 | 3300031730 | Bacteria | 1192 |
| 225 | Ga0307416_100541720 | 3300032002 | Bacteria | 1236 |
| 226 | Ga0373926_0000330 | 3300035083 | Bacteria | 11877 |
| 227 | Ga0373952_0032421 | 3300035092 | Bacteria | 1167 |
| 228 | Ga0373932_0078812 | 3300035112 | Bacteria | 1037 |
| 229 | Ga0373956_0003565 | 3300035119 | Bacteria | 6275 |
| 230 | Ga0373935_0001562 | 3300035692 | Bacteria | 12768 |
| 231 | Ga0373947_0000002 | 3300035725 | Bacteria | 383924 |
| 232 | Ga0373947_0127998 | 3300035725 | Bacteria | 1619 |
| 233 | Ga0316582_0123477 | 3300036647 | Bacteria | 1735 |
| 234 | Ga0316584_0110382 | 3300036712 | Bacteria | 2058 |
| 235 | Ga0451789_0149872 | 3300041443 | Bacteria | 788 |
| 236 | Ga0451789_0935306 | 3300041443 | Bacteria | 1184 |
| 237 | Ga0451793_0586671 | 3300041452 | Bacteria | 2667 |
| 238 | Ga0439449_0041648 | 3300042007 | Bacteria | 1708 |
| 239 | Ga0439444_0042162 | 3300042437 | Bacteria | 900 |
| 240 | Ga0466969_0000386 | 3300044656 | Bacteria | 24220 |
| 241 | Ga0466969_0044445 | 3300044656 | Bacteria | 2209 |
| 242 | Ga0466965_0035620 | 3300044683 | Bacteria | 2438 |
| 243 | Ga0466965_0047415 | 3300044683 | Bacteria | 2127 |
| 244 | Ga0466966_0106717 | 3300044684 | Bacteria | 1728 |
| 245 | Ga0466961_0015101 | 3300044693 | Bacteria | 4958 |
| 246 | Ga0466963_0124736 | 3300044694 | Bacteria | 1775 |
| 247 | Ga0466963_0187707 | 3300044694 | Bacteria | 1444 |
| 248 | Ga0466963_0405643 | 3300044694 | Bacteria | 961 |
| 249 | Ga0466971_0002410 | 3300044719 | Bacteria | 7890 |
| 250 | Ga0466970_0149293 | 3300044765 | Bacteria | 1290 |
| 251 | Ga0466957_0014665 | 3300044842 | Bacteria | 4566 |
| 252 | Ga0466957_0057863 | 3300044842 | Bacteria | 2374 |
| 253 | Ga0466957_0172952 | 3300044842 | Bacteria | 1408 |
| 254 | Ga0466957_0301215 | 3300044842 | Bacteria | 1077 |
| 255 | Ga0466960_0000108 | 3300044901 | Bacteria | 27686 |
| 256 | Ga0466960_0014121 | 3300044901 | Bacteria | 3409 |
| 257 | Ga0466959_0001180 | 3300045049 | Bacteria | 15747 |
| 258 | Ga0466959_0224221 | 3300045049 | Bacteria | 1303 |
| 259 | Ga0466959_0312294 | 3300045049 | Bacteria | 1076 |
| 260 | Ga0466959_0328691 | 3300045049 | Bacteria | 1044 |
| 261 | Ga0466959_0454727 | 3300045049 | Bacteria | 868 |
| 262 | Ga0466958_0114096 | 3300045836 | Bacteria | 1688 |
| 263 | Ga0466958_0117484 | 3300045836 | Bacteria | 1663 |
| 264 | Ga0466967_0028784 | 3300045976 | Bacteria | 4643 |
| 265 | Ga0466967_0085802 | 3300045976 | Bacteria | 2851 |
| 266 | Ga0466967_0096688 | 3300045976 | Bacteria | 2694 |
| 267 | Ga0466967_0215740 | 3300045976 | Bacteria | 1821 |
| 268 | Ga0466967_0278964 | 3300045976 | Bacteria | 1603 |
| 269 | Ga0495592_0009158 | 3300046454 | Bacteria | 7450 |
| 270 | Ga0495603_0029187 | 3300046455 | Bacteria | 3327 |
| 271 | Ga0495651_0100043 | 3300046462 | Bacteria | 2160 |
| 272 | Ga0495653_0067394 | 3300046463 | Bacteria | 2688 |
| 273 | Ga0495653_0128051 | 3300046463 | Bacteria | 1801 |
| 274 | Ga0495580_0174055 | 3300046472 | Bacteria | 1487 |
| 275 | Ga0495664_0008865 | 3300046477 | Bacteria | 5620 |
| 276 | Ga0495608_0007435 | 3300046511 | Bacteria | 7739 |
| 277 | Ga0495628_0010260 | 3300046516 | Bacteria | 7967 |
| 278 | Ga0495666_0049966 | 3300046526 | Bacteria | 2010 |
| 279 | Ga0495652_0001620 | 3300046529 | Bacteria | 24570 |
| 280 | Ga0495665_0008244 | 3300046531 | Bacteria | 5649 |
| 281 | Ga0495640_0053358 | 3300046533 | Bacteria | 2771 |
| 282 | Ga0495597_0147059 | 3300046542 | Bacteria | 969 |
| 283 | Ga0495667_0056514 | 3300046559 | Bacteria | 2580 |
| 284 | Ga0495667_0369029 | 3300046559 | Bacteria | 906 |
| 285 | Ga0495634_0132515 | 3300046642 | Bacteria | 1588 |
| 286 | Ga0495634_0167054 | 3300046642 | Bacteria | 1384 |
| 287 | Ga0495625_0119933 | 3300046660 | Bacteria | 1791 |
| 288 | Ga0495635_0004216 | 3300046663 | Bacteria | 9972 |
| 289 | Ga0495657_0039313 | 3300046675 | Bacteria | 3251 |
| 290 | Ga0495599_0120302 | 3300046678 | Bacteria | 1632 |
| 291 | Ga0495623_0159350 | 3300046679 | Bacteria | 1327 |
| 292 | Ga0495646_0123080 | 3300046680 | Bacteria | 1466 |
| 293 | Ga0495646_0236636 | 3300046680 | Bacteria | 982 |
| 294 | Ga0495613_0002970 | 3300046689 | Bacteria | 12699 |
| 295 | Ga0495624_0091791 | 3300046690 | Bacteria | 1873 |
| 296 | Ga0495600_0038112 | 3300046809 | Bacteria | 3127 |
| 297 | Ga0495600_0119978 | 3300046809 | Bacteria | 1710 |
| 298 | Ga0495581_0088263 | 3300047315 | Bacteria | 1798 |
| 299 | Ga0495604_0016869 | 3300047317 | Bacteria | 5838 |
| 300 | Ga0495604_0244591 | 3300047317 | Bacteria | 1225 |
| 301 | Ga0495676_0339906 | 3300047321 | Bacteria | 1005 |
| 302 | Ga0495680_0152605 | 3300047322 | Bacteria | 1683 |
| 303 | Ga0495683_0002207 | 3300047323 | Bacteria | 11926 |
| 304 | Ga0495675_0004200 | 3300047444 | Bacteria | 8719 |
| 305 | Ga0495675_0016253 | 3300047444 | Bacteria | 4706 |
| 306 | Ga0495684_0049796 | 3300047471 | Bacteria | 3200 |
| 307 | Ga0495593_0027202 | 3300047673 | Bacteria | 3150 |
| 308 | Ga0495602_0150691 | 3300048088 | Bacteria | 1828 |
| 309 | Ga0496100_0077030 | 3300048903 | Bacteria | 2241 |
| 310 | Ga0496100_0083631 | 3300048903 | Bacteria | 2161 |
| 311 | Ga0496100_0474858 | 3300048903 | Bacteria | 961 |
| 312 | Ga0496101_0003689 | 3300048904 | Bacteria | 9558 |
| 313 | Ga0496101_0359974 | 3300048904 | Bacteria | 1144 |
| 314 | Ga0496101_0362901 | 3300048904 | Bacteria | 1139 |
| 315 | Ga0496102_0000042 | 3300048905 | Bacteria | 196538 |
| 316 | Ga0496102_0000164 | 3300048905 | Bacteria | 89355 |
| 317 | Ga0496103_0000063 | 3300048906 | Bacteria | 128503 |
| 318 | Ga0496103_0000194 | 3300048906 | Bacteria | 60666 |
| 319 | Ga0496104_0038838 | 3300048907 | Bacteria | 4456 |
| 320 | Ga0496104_0481239 | 3300048907 | Bacteria | 1153 |
| 321 | Ga0496104_0909601 | 3300048907 | Bacteria | 785 |
| 322 | Ga0496105_0026455 | 3300048908 | Bacteria | 4732 |
| 323 | Ga0496107_0233890 | 3300048910 | Bacteria | 1367 |
| 324 | Ga0496107_0438060 | 3300048910 | Bacteria | 971 |
| 325 | Ga0496108_0135393 | 3300048911 | Bacteria | 2119 |
| 326 | Ga0496109_0281969 | 3300048912 | Bacteria | 1566 |
| 327 | Ga0496109_0444941 | 3300048912 | Bacteria | 1224 |
| 328 | Ga0496109_0567241 | 3300048912 | Bacteria | 1070 |
| 329 | Ga0496109_0855132 | 3300048912 | Bacteria | 847 |
| 330 | Ga0496110_0207856 | 3300048913 | Bacteria | 1779 |
| 331 | Ga0496113_0303403 | 3300048916 | Bacteria | 1279 |
| 332 | Ga0496114_0242584 | 3300048917 | Bacteria | 1585 |
| 333 | Ga0496114_0668389 | 3300048917 | Bacteria | 913 |
| 334 | Ga0496116_0024448 | 3300048919 | Bacteria | 4468 |
| 335 | Ga0496117_0000261 | 3300048920 | Bacteria | 99625 |
| 336 | Ga0496118_0000241 | 3300048921 | Bacteria | 96484 |
| 337 | Ga0496118_0006546 | 3300048921 | Bacteria | 12745 |
| 338 | Ga0496118_0161118 | 3300048921 | Bacteria | 1387 |
| 339 | Ga0496119_0000210 | 3300048922 | Bacteria | 83492 |
| 340 | Ga0496119_0039783 | 3300048922 | Bacteria | 3019 |
| 341 | Ga0496120_0019006 | 3300048923 | Bacteria | 4411 |
| 342 | Ga0496121_0068582 | 3300048924 | Bacteria | 2868 |
| 343 | Ga0496121_0092923 | 3300048924 | Bacteria | 2350 |
| 344 | Ga0496123_0219412 | 3300048926 | Bacteria | 960 |
| 345 | Ga0496126_0000255 | 3300048929 | Bacteria | 114737 |
| 346 | Ga0496126_0021449 | 3300048929 | Bacteria | 6308 |
| 347 | Ga0501031_0006742 | 3300049568 | Bacteria | 7489 |
| 348 | Ga0501031_0295865 | 3300049568 | Bacteria | 1049 |
| 349 | Ga0501031_0366968 | 3300049568 | Bacteria | 932 |
| 350 | Ga0501032_0019953 | 3300049569 | Bacteria | 4678 |
| 351 | Ga0501032_0022091 | 3300049569 | Bacteria | 4416 |
| 352 | Ga0501033_0039913 | 3300049570 | Bacteria | 3505 |
| 353 | Ga0501034_0059273 | 3300049571 | Bacteria | 3845 |
| 354 | Ga0501034_0117469 | 3300049571 | Bacteria | 2647 |
| 355 | Ga0501036_0002429 | 3300049572 | Bacteria | 14586 |
| 356 | Ga0501037_0001974 | 3300049573 | Bacteria | 14840 |
| 357 | Ga0501037_0153102 | 3300049573 | Bacteria | 1647 |
| 358 | Ga0501038_0013929 | 3300049574 | Bacteria | 7329 |
| 359 | Ga0501039_0016960 | 3300049575 | Bacteria | 5582 |
| 360 | Ga0501040_0011494 | 3300049576 | Bacteria | 5794 |
| 361 | Ga0501041_0003738 | 3300049577 | Bacteria | 8753 |
| 362 | Ga0501042_0102903 | 3300049578 | Bacteria | 2054 |
| 363 | Ga0501043_0000682 | 3300049579 | Bacteria | 29934 |
| 364 | Ga0501043_0081667 | 3300049579 | Bacteria | 2540 |
| 365 | Ga0501046_0032542 | 3300049580 | Bacteria | 4223 |
| 366 | Ga0501046_0077015 | 3300049580 | Bacteria | 2582 |
| 367 | Ga0501047_0000031 | 3300049581 | Bacteria | 215903 |
| 368 | Ga0501047_0000947 | 3300049581 | Bacteria | 29395 |
| 369 | Ga0501047_0001051 | 3300049581 | Bacteria | 27524 |
| 370 | Ga0501047_0008300 | 3300049581 | Bacteria | 9803 |
| 371 | Ga0501048_0000085 | 3300049582 | Bacteria | 48910 |
| 372 | Ga0501048_0093600 | 3300049582 | Bacteria | 2119 |
| 373 | Ga0501048_0338400 | 3300049582 | Bacteria | 1073 |
| 374 | Ga0501067_0001352 | 3300049583 | Bacteria | 13275 |
| 375 | Ga0501067_0042268 | 3300049583 | Bacteria | 2530 |
| 376 | Ga0501068_0019476 | 3300049584 | Bacteria | 3942 |
| 377 | Ga0501069_0020661 | 3300049585 | Bacteria | 3568 |
| 378 | Ga0501070_0012956 | 3300049586 | Bacteria | 7027 |
| 379 | Ga0501070_0020999 | 3300049586 | Bacteria | 5478 |
| 380 | Ga0501070_0124903 | 3300049586 | Bacteria | 2127 |
| 381 | Ga0501071_0001160 | 3300049587 | Bacteria | 14757 |
| 382 | Ga0501072_0010818 | 3300049588 | Bacteria | 6952 |
| 383 | Ga0501073_0039289 | 3300049589 | Bacteria | 3352 |
| 384 | Ga0501074_0031695 | 3300049590 | Bacteria | 3829 |
| 385 | Ga0501074_0129179 | 3300049590 | Bacteria | 1808 |
| 386 | Ga0501076_0003071 | 3300049592 | Bacteria | 11624 |
| 387 | Ga0501077_0041741 | 3300049593 | Bacteria | 2919 |
| 388 | Ga0501079_0006331 | 3300049741 | Bacteria | 8882 |
| 389 | Ga0501080_0032629 | 3300049742 | Bacteria | 4857 |
| 390 | Ga0501083_0003083 | 3300049744 | Bacteria | 11583 |
| 391 | Ga0501035_0013124 | 3300049822 | Bacteria | 7645 |
| 392 | Ga0501044_0012529 | 3300049823 | Bacteria | 9184 |
| 393 | Ga0501044_0046879 | 3300049823 | Bacteria | 4473 |
| 394 | Ga0501044_0463456 | 3300049823 | Bacteria | 1172 |
| 395 | Ga0501045_0004098 | 3300049824 | Bacteria | 10060 |
| 396 | nmdc:mga00v17_114444_c1 | 3300050491 | Bacteria | 1713 |
| 397 | nmdc:mga0yw44_75362_c1 | 3300050492 | Bacteria | 2103 |
| 398 | nmdc:mga07m45_115896_c1 | 3300050496 | Bacteria | 1545 |
| 399 | nmdc:mga05p37_554887_c1 | 3300050507 | Bacteria | 1307 |
| 400 | nmdc:mga09592_40051_c1 | 3300050508 | Bacteria | 3937 |
| 401 | nmdc:mga0qj67_5984_c1 | 3300050509 | Bacteria | 8912 |
| 402 | nmdc:mga06r32_97529_c1 | 3300050510 | Bacteria | 2881 |
| 403 | nmdc:mga08y16_195828_c1 | 3300050511 | Bacteria | 2095 |
| 404 | nmdc:mga08y16_277452_c1 | 3300050511 | Bacteria | 1729 |
| 405 | Ga0495601_0004422 | 3300053077 | Bacteria | 8117 |
| 406 | Ga0495601_0037885 | 3300053077 | Bacteria | 3014 |
| 407 | Ga0495601_0058957 | 3300053077 | Bacteria | 2433 |
| 408 | Ga0495612_0008859 | 3300053078 | Bacteria | 4076 |
| 409 | Ga0495655_0070294 | 3300053083 | Bacteria | 977 |
| 410 | Ga0495619_0176446 | 3300053085 | Bacteria | 1478 |
| 411 | Ga0495619_0407797 | 3300053085 | Bacteria | 938 |
| 412 | Ga0500645_000075 | 3300053730 | Bacteria | 78736 |
| 413 | Ga0501084_0013503 | 3300054114 | Bacteria | 6759 |
| 414 | Ga0501082_0027263 | 3300060353 | Bacteria | 4919 |
| 415 | Ga0466962_0084125 | 3300061719 | Bacteria | 1522 |
| 416 | Ga0530510_0117686 | 3300061734 | Bacteria | 1949 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10563380 | Ga0265338_105633801 | 209 |
| 2 | 3300035083 | Ga0373926_0000330 | Ga0373926_0000330_10264_10893 | 209 |
| 3 | 3300035692 | Ga0373935_0001562 | Ga0373935_0001562_10978_11607 | 209 |
| 4 | 3300035725 | Ga0373947_0000002 | Ga0373947_0000002_269344_269973 | 209 |
| 5 | 3300025919 | Ga0207657_10165552 | Ga0207657_101655523 | 210 |
| 6 | iso_pu_bacteria | 2818991463 | 2819698625 | 212 |
| 7 | 3300028577 | Ga0265318_10050946 | Ga0265318_100509462 | 213 |
| 8 | 3300031240 | Ga0265320_10064379 | Ga0265320_100643793 | 213 |
| 9 | 3300006038 | Ga0075365_10091417 | Ga0075365_100914172 | 216 |
| 10 | 3300014325 | Ga0163163_10834937 | Ga0163163_108349372 | 216 |
| 11 | 3300041443 | Ga0451789_0935306 | Ga0451789_0935306_247_897 | 216 |
| 12 | 3300050492 | nmdc:mga0yw44_75362_c1 | nmdc:mga0yw44_75362_c1_1222_1878 | 216 |
| 13 | 3300048904 | Ga0496101_0359974 | Ga0496101_0359974_397_1056 | 217 |
| 14 | 3300009553 | Ga0105249_10108052 | Ga0105249_101080523 | 220 |
| 15 | 3300010375 | Ga0105239_10454534 | Ga0105239_104545342 | 220 |
| 16 | 3300011119 | Ga0105246_10069559 | Ga0105246_100695593 | 220 |
| 17 | 3300013105 | Ga0157369_10721866 | Ga0157369_107218662 | 220 |
| 18 | 3300026142 | Ga0207698_10378080 | Ga0207698_103780802 | 220 |
| 19 | 3300046660 | Ga0495625_0119933 | Ga0495625_0119933_934_1596 | 220 |
| 20 | 3300047322 | Ga0495680_0152605 | Ga0495680_0152605_702_1376 | 220 |
| 21 | 3300049568 | Ga0501031_0006742 | Ga0501031_0006742_5092_5754 | 220 |
| 22 | 3300049569 | Ga0501032_0022091 | Ga0501032_0022091_2035_2697 | 220 |
| 23 | 3300049570 | Ga0501033_0039913 | Ga0501033_0039913_1514_2176 | 220 |
| 24 | 3300049571 | Ga0501034_0059273 | Ga0501034_0059273_1468_2130 | 220 |
| 25 | 3300049572 | Ga0501036_0002429 | Ga0501036_0002429_3464_4126 | 220 |
| 26 | 3300049573 | Ga0501037_0001974 | Ga0501037_0001974_6293_6955 | 220 |
| 27 | 3300049573 | Ga0501037_0153102 | Ga0501037_0153102_283_945 | 220 |
| 28 | 3300049574 | Ga0501038_0013929 | Ga0501038_0013929_5210_5872 | 220 |
| 29 | 3300049575 | Ga0501039_0016960 | Ga0501039_0016960_1215_1877 | 220 |
| 30 | 3300049576 | Ga0501040_0011494 | Ga0501040_0011494_2876_3538 | 220 |
| 31 | 3300049577 | Ga0501041_0003738 | Ga0501041_0003738_3555_4217 | 220 |
| 32 | 3300049578 | Ga0501042_0102903 | Ga0501042_0102903_50_712 | 220 |
| 33 | 3300049579 | Ga0501043_0000682 | Ga0501043_0000682_21806_22468 | 220 |
| 34 | 3300049580 | Ga0501046_0077015 | Ga0501046_0077015_50_712 | 220 |
| 35 | 3300049581 | Ga0501047_0000947 | Ga0501047_0000947_21719_22381 | 220 |
| 36 | 3300049581 | Ga0501047_0001051 | Ga0501047_0001051_10174_10836 | 220 |
| 37 | 3300049582 | Ga0501048_0093600 | Ga0501048_0093600_72_734 | 220 |
| 38 | 3300049583 | Ga0501067_0001352 | Ga0501067_0001352_5210_5872 | 220 |
| 39 | 3300049584 | Ga0501068_0019476 | Ga0501068_0019476_2066_2728 | 220 |
| 40 | 3300049585 | Ga0501069_0020661 | Ga0501069_0020661_961_1623 | 220 |
| 41 | 3300049586 | Ga0501070_0012956 | Ga0501070_0012956_1330_1992 | 220 |
| 42 | 3300049587 | Ga0501071_0001160 | Ga0501071_0001160_4959_5621 | 220 |
| 43 | 3300049588 | Ga0501072_0010818 | Ga0501072_0010818_4937_5599 | 220 |
| 44 | 3300049589 | Ga0501073_0039289 | Ga0501073_0039289_2414_3076 | 220 |
| 45 | 3300049590 | Ga0501074_0031695 | Ga0501074_0031695_2414_3076 | 220 |
| 46 | 3300049592 | Ga0501076_0003071 | Ga0501076_0003071_4663_5325 | 220 |
| 47 | 3300049593 | Ga0501077_0041741 | Ga0501077_0041741_1647_2309 | 220 |
| 48 | 3300049741 | Ga0501079_0006331 | Ga0501079_0006331_2040_2702 | 220 |
| 49 | 3300049742 | Ga0501080_0032629 | Ga0501080_0032629_2460_3122 | 220 |
| 50 | 3300049744 | Ga0501083_0003083 | Ga0501083_0003083_9605_10267 | 220 |
| 51 | 3300049822 | Ga0501035_0013124 | Ga0501035_0013124_1330_1992 | 220 |
| 52 | 3300049823 | Ga0501044_0012529 | Ga0501044_0012529_1458_2120 | 220 |
| 53 | 3300049823 | Ga0501044_0463456 | Ga0501044_0463456_405_1067 | 220 |
| 54 | 3300049824 | Ga0501045_0004098 | Ga0501045_0004098_2499_3161 | 220 |
| 55 | 3300053085 | Ga0495619_0176446 | Ga0495619_0176446_561_1232 | 220 |
| 56 | 3300054114 | Ga0501084_0013503 | Ga0501084_0013503_2876_3538 | 220 |
| 57 | 3300060353 | Ga0501082_0027263 | Ga0501082_0027263_1514_2176 | 220 |
| 58 | 3300061734 | Ga0530510_0117686 | Ga0530510_0117686_1231_1893 | 220 |
| 59 | iso_pu_bacteria | 2643221962 | 2645725371 | 220 |
| 60 | iso_pu_bacteria | 8056054917 | 8056058581 | 220 |
| 61 | 3300005367 | Ga0070667_100248145 | Ga0070667_1002481452 | 221 |
| 62 | 3300046690 | Ga0495624_0091791 | Ga0495624_0091791_505_1176 | 221 |
| 63 | 3300047317 | Ga0495604_0244591 | Ga0495604_0244591_113_784 | 221 |
| 64 | 3300047321 | Ga0495676_0339906 | Ga0495676_0339906_299_970 | 221 |
| 65 | 3300048917 | Ga0496114_0242584 | Ga0496114_0242584_515_1186 | 221 |
| 66 | 3300048929 | Ga0496126_0021449 | Ga0496126_0021449_1601_2284 | 221 |
| 67 | 3300053730 | Ga0500645_000075 | Ga0500645_000075_54853_55536 | 221 |
| 68 | iso_pu_bacteria | 2508501039 | 2508674091 | 221 |
| 69 | iso_pu_bacteria | 2547132424 | 2548697922 | 221 |
| 70 | iso_pu_bacteria | 2551306166 | 2552109590 | 221 |
| 71 | iso_pu_bacteria | 2643221601 | 2644017958 | 221 |
| 72 | iso_pu_bacteria | 2643221631 | 2644180754 | 221 |
| 73 | iso_pu_bacteria | 2643221692 | 2644513071 | 221 |
| 74 | iso_pu_bacteria | 2687453737 | 2689960108 | 221 |
| 75 | iso_pu_bacteria | 2738543005 | 2739203234 | 221 |
| 76 | iso_pu_bacteria | 2738543011 | 2739239694 | 221 |
| 77 | iso_pu_bacteria | 2889300758 | 2889300929 | 221 |
| 78 | iso_pu_bacteria | 2904770941 | 2904771012 | 221 |
| 79 | iso_pu_bacteria | 2908811453 | 2908815055 | 221 |
| 80 | iso_pu_bacteria | 2919420072 | 2919424461 | 221 |
| 81 | iso_pu_bacteria | 2919432681 | 2919436854 | 221 |
| 82 | iso_pu_bacteria | 2919713450 | 2919715902 | 221 |
| 83 | iso_pu_bacteria | 2928142448 | 2928142542 | 221 |
| 84 | iso_pu_bacteria | 2935390628 | 2935391360 | 221 |
| 85 | iso_pu_bacteria | 2939743619 | 2939744443 | 221 |
| 86 | iso_pu_bacteria | 3001119090 | 3001122199 | 221 |
| 87 | iso_pu_bacteria | 3006425503 | 3006428512 | 221 |
| 88 | iso_pu_bacteria | 3006486233 | 3006486746 | 221 |
| 89 | iso_pu_bacteria | 8054472261 | 8054474342 | 221 |
| 90 | 3300001990 | JGI24737J22298_10054851 | JGI24737J22298_100548512 | 222 |
| 91 | 3300003320 | rootH2_10078173 | rootH2_100781733 | 222 |
| 92 | 3300003320 | rootH2_10154633 | rootH2_101546333 | 222 |
| 93 | 3300003322 | rootL2_10064882 | rootL2_100648822 | 222 |
| 94 | 3300003323 | rootH1_10000259 | rootH1_100002594 | 222 |
| 95 | 3300005327 | Ga0070658_10273613 | Ga0070658_102736132 | 222 |
| 96 | 3300005327 | Ga0070658_10315635 | Ga0070658_103156352 | 222 |
| 97 | 3300005328 | Ga0070676_10090925 | Ga0070676_100909252 | 222 |
| 98 | 3300005328 | Ga0070676_10284737 | Ga0070676_102847371 | 222 |
| 99 | 3300005329 | Ga0070683_100349820 | Ga0070683_1003498202 | 222 |
| 100 | 3300005329 | Ga0070683_101152881 | Ga0070683_1011528811 | 222 |
| 101 | 3300005337 | Ga0070682_100138817 | Ga0070682_1001388173 | 222 |
| 102 | 3300005337 | Ga0070682_100399074 | Ga0070682_1003990741 | 222 |
| 103 | 3300005338 | Ga0068868_100280413 | Ga0068868_1002804131 | 222 |
| 104 | 3300005338 | Ga0068868_100329627 | Ga0068868_1003296271 | 222 |
| 105 | 3300005338 | Ga0068868_100555549 | Ga0068868_1005555492 | 222 |
| 106 | 3300005344 | Ga0070661_100119207 | Ga0070661_1001192074 | 222 |
| 107 | 3300005345 | Ga0070692_10205648 | Ga0070692_102056481 | 222 |
| 108 | 3300005347 | Ga0070668_100502719 | Ga0070668_1005027192 | 222 |
| 109 | 3300005354 | Ga0070675_100094864 | Ga0070675_1000948645 | 222 |
| 110 | 3300005355 | Ga0070671_100000412 | Ga0070671_10000041226 | 222 |
| 111 | 3300005355 | Ga0070671_100141970 | Ga0070671_1001419702 | 222 |
| 112 | 3300005356 | Ga0070674_100250145 | Ga0070674_1002501452 | 222 |
| 113 | 3300005356 | Ga0070674_100443684 | Ga0070674_1004436841 | 222 |
| 114 | 3300005356 | Ga0070674_100470224 | Ga0070674_1004702242 | 222 |
| 115 | 3300005366 | Ga0070659_100024271 | Ga0070659_1000242713 | 222 |
| 116 | 3300005366 | Ga0070659_100275667 | Ga0070659_1002756672 | 222 |
| 117 | 3300005367 | Ga0070667_100000063 | Ga0070667_10000006382 | 222 |
| 118 | 3300005367 | Ga0070667_100066231 | Ga0070667_1000662312 | 222 |
| 119 | 3300005367 | Ga0070667_100343974 | Ga0070667_1003439741 | 222 |
| 120 | 3300005435 | Ga0070714_100003703 | Ga0070714_1000037036 | 222 |
| 121 | 3300005435 | Ga0070714_100202674 | Ga0070714_1002026742 | 222 |
| 122 | 3300005435 | Ga0070714_100333367 | Ga0070714_1003333672 | 222 |
| 123 | 3300005436 | Ga0070713_100065734 | Ga0070713_1000657342 | 222 |
| 124 | 3300005437 | Ga0070710_10292177 | Ga0070710_102921772 | 222 |
| 125 | 3300005437 | Ga0070710_10340458 | Ga0070710_103404581 | 222 |
| 126 | 3300005455 | Ga0070663_100134044 | Ga0070663_1001340443 | 222 |
| 127 | 3300005455 | Ga0070663_100165363 | Ga0070663_1001653632 | 222 |
| 128 | 3300005455 | Ga0070663_100313277 | Ga0070663_1003132771 | 222 |
| 129 | 3300005457 | Ga0070662_100200027 | Ga0070662_1002000272 | 222 |
| 130 | 3300005458 | Ga0070681_10313913 | Ga0070681_103139132 | 222 |
| 131 | 3300005459 | Ga0068867_100093300 | Ga0068867_1000933003 | 222 |
| 132 | 3300005459 | Ga0068867_100393851 | Ga0068867_1003938511 | 222 |
| 133 | 3300005466 | Ga0070685_10065308 | Ga0070685_100653085 | 222 |
| 134 | 3300005471 | Ga0070698_100059764 | Ga0070698_1000597644 | 222 |
| 135 | 3300005535 | Ga0070684_100308254 | Ga0070684_1003082542 | 222 |
| 136 | 3300005539 | Ga0068853_100091299 | Ga0068853_1000912992 | 222 |
| 137 | 3300005543 | Ga0070672_100372170 | Ga0070672_1003721702 | 222 |
| 138 | 3300005546 | Ga0070696_100006628 | Ga0070696_1000066287 | 222 |
| 139 | 3300005548 | Ga0070665_100099962 | Ga0070665_1000999622 | 222 |
| 140 | 3300005548 | Ga0070665_100349692 | Ga0070665_1003496922 | 222 |
| 141 | 3300005563 | Ga0068855_100102803 | Ga0068855_1001028033 | 222 |
| 142 | 3300005564 | Ga0070664_100042117 | Ga0070664_1000421172 | 222 |
| 143 | 3300005577 | Ga0068857_100268183 | Ga0068857_1002681833 | 222 |
| 144 | 3300005578 | Ga0068854_100048597 | Ga0068854_1000485973 | 222 |
| 145 | 3300005614 | Ga0068856_100498678 | Ga0068856_1004986782 | 222 |
| 146 | 3300005615 | Ga0070702_100172161 | Ga0070702_1001721612 | 222 |
| 147 | 3300005616 | Ga0068852_100634905 | Ga0068852_1006349052 | 222 |
| 148 | 3300005617 | Ga0068859_100000777 | Ga0068859_10000077729 | 222 |
| 149 | 3300005617 | Ga0068859_100000944 | Ga0068859_1000009443 | 222 |
| 150 | 3300005617 | Ga0068859_100682276 | Ga0068859_1006822762 | 222 |
| 151 | 3300005618 | Ga0068864_100661970 | Ga0068864_1006619702 | 222 |
| 152 | 3300005718 | Ga0068866_10499300 | Ga0068866_104993001 | 222 |
| 153 | 3300005834 | Ga0068851_10052054 | Ga0068851_100520542 | 222 |
| 154 | 3300005834 | Ga0068851_10095684 | Ga0068851_100956842 | 222 |
| 155 | 3300005840 | Ga0068870_10356105 | Ga0068870_103561052 | 222 |
| 156 | 3300005841 | Ga0068863_100000159 | Ga0068863_10000015927 | 222 |
| 157 | 3300005841 | Ga0068863_100000648 | Ga0068863_1000006487 | 222 |
| 158 | 3300005841 | Ga0068863_100007113 | Ga0068863_1000071139 | 222 |
| 159 | 3300005841 | Ga0068863_100035863 | Ga0068863_1000358632 | 222 |
| 160 | 3300005842 | Ga0068858_100009162 | Ga0068858_1000091626 | 222 |
| 161 | 3300005842 | Ga0068858_100051255 | Ga0068858_1000512554 | 222 |
| 162 | 3300005842 | Ga0068858_100056127 | Ga0068858_1000561272 | 222 |
| 163 | 3300005843 | Ga0068860_100000065 | Ga0068860_10000006581 | 222 |
| 164 | 3300005844 | Ga0068862_100000028 | Ga0068862_100000028105 | 222 |
| 165 | 3300005844 | Ga0068862_100583839 | Ga0068862_1005838392 | 222 |
| 166 | 3300005983 | Ga0081540_1005051 | Ga0081540_10050514 | 222 |
| 167 | 3300006028 | Ga0070717_10205762 | Ga0070717_102057622 | 222 |
| 168 | 3300006028 | Ga0070717_10234957 | Ga0070717_102349572 | 222 |
| 169 | 3300006028 | Ga0070717_10543512 | Ga0070717_105435122 | 222 |
| 170 | 3300006051 | Ga0075364_10130295 | Ga0075364_101302952 | 222 |
| 171 | 3300006353 | Ga0075370_10117767 | Ga0075370_101177672 | 222 |
| 172 | 3300006844 | Ga0075428_100006048 | Ga0075428_1000060488 | 222 |
| 173 | 3300006844 | Ga0075428_100293330 | Ga0075428_1002933302 | 222 |
| 174 | 3300006846 | Ga0075430_100019963 | Ga0075430_1000199633 | 222 |
| 175 | 3300006931 | Ga0097620_100000777 | Ga0097620_10000077729 | 222 |
| 176 | 3300006931 | Ga0097620_100000944 | Ga0097620_1000009443 | 222 |
| 177 | 3300006931 | Ga0097620_100016788 | Ga0097620_1000167884 | 222 |
| 178 | 3300006931 | Ga0097620_100682290 | Ga0097620_1006822901 | 222 |
| 179 | 3300007265 | Ga0099794_10239930 | Ga0099794_102399301 | 222 |
| 180 | 3300009094 | Ga0111539_10587084 | Ga0111539_105870842 | 222 |
| 181 | 3300009094 | Ga0111539_10885408 | Ga0111539_108854082 | 222 |
| 182 | 3300009094 | Ga0111539_11266795 | Ga0111539_112667951 | 222 |
| 183 | 3300009098 | Ga0105245_10172177 | Ga0105245_101721774 | 222 |
| 184 | 3300009098 | Ga0105245_10554059 | Ga0105245_105540591 | 222 |
| 185 | 3300009101 | Ga0105247_10254600 | Ga0105247_102546002 | 222 |
| 186 | 3300009147 | Ga0114129_10001766 | Ga0114129_1000176626 | 222 |
| 187 | 3300009148 | Ga0105243_10017906 | Ga0105243_100179064 | 222 |
| 188 | 3300009148 | Ga0105243_10998772 | Ga0105243_109987721 | 222 |
| 189 | 3300009174 | Ga0105241_10118131 | Ga0105241_101181312 | 222 |
| 190 | 3300009176 | Ga0105242_10267051 | Ga0105242_102670513 | 222 |
| 191 | 3300009176 | Ga0105242_10632539 | Ga0105242_106325391 | 222 |
| 192 | 3300009177 | Ga0105248_10050782 | Ga0105248_100507826 | 222 |
| 193 | 3300009545 | Ga0105237_10351936 | Ga0105237_103519362 | 222 |
| 194 | 3300009545 | Ga0105237_10808241 | Ga0105237_108082411 | 222 |
| 195 | 3300009551 | Ga0105238_10979354 | Ga0105238_109793542 | 222 |
| 196 | 3300009553 | Ga0105249_10080852 | Ga0105249_100808523 | 222 |
| 197 | 3300009553 | Ga0105249_11123445 | Ga0105249_111234452 | 222 |
| 198 | 3300010375 | Ga0105239_10673605 | Ga0105239_106736052 | 222 |
| 199 | 3300010375 | Ga0105239_11197895 | Ga0105239_111978952 | 222 |
| 200 | 3300011119 | Ga0105246_10526913 | Ga0105246_105269132 | 222 |
| 201 | 3300013296 | Ga0157374_10922242 | Ga0157374_109222421 | 222 |
| 202 | 3300013296 | Ga0157374_11124584 | Ga0157374_111245842 | 222 |
| 203 | 3300013297 | Ga0157378_10205516 | Ga0157378_102055164 | 222 |
| 204 | 3300013306 | Ga0163162_11193323 | Ga0163162_111933232 | 222 |
| 205 | 3300013307 | Ga0157372_10634128 | Ga0157372_106341281 | 222 |
| 206 | 3300013308 | Ga0157375_10361858 | Ga0157375_103618582 | 222 |
| 207 | 3300014325 | Ga0163163_10567906 | Ga0163163_105679062 | 222 |
| 208 | 3300014325 | Ga0163163_10744957 | Ga0163163_107449572 | 222 |
| 209 | 3300014745 | Ga0157377_10187800 | Ga0157377_101878001 | 222 |
| 210 | 3300014968 | Ga0157379_10001387 | Ga0157379_1000138719 | 222 |
| 211 | 3300014968 | Ga0157379_10473616 | Ga0157379_104736161 | 222 |
| 212 | 3300020070 | Ga0206356_11257196 | Ga0206356_112571961 | 222 |
| 213 | 3300020081 | Ga0206354_10127114 | Ga0206354_101271142 | 222 |
| 214 | 3300020081 | Ga0206354_10547656 | Ga0206354_105476562 | 222 |
| 215 | 3300020081 | Ga0206354_11585944 | Ga0206354_115859442 | 222 |
| 216 | 3300020082 | Ga0206353_11490006 | Ga0206353_114900062 | 222 |
| 217 | 3300021384 | Ga0213876_10140919 | Ga0213876_101409192 | 222 |
| 218 | 3300022467 | Ga0224712_10001633 | Ga0224712_100016334 | 222 |
| 219 | 3300025321 | Ga0207656_10056297 | Ga0207656_100562971 | 222 |
| 220 | 3300025898 | Ga0207692_10191226 | Ga0207692_101912262 | 222 |
| 221 | 3300025900 | Ga0207710_10000014 | Ga0207710_1000001430 | 222 |
| 222 | 3300025903 | Ga0207680_10083273 | Ga0207680_100832732 | 222 |
| 223 | 3300025904 | Ga0207647_10010162 | Ga0207647_100101626 | 222 |
| 224 | 3300025904 | Ga0207647_10029890 | Ga0207647_100298903 | 222 |
| 225 | 3300025907 | Ga0207645_10005431 | Ga0207645_100054316 | 222 |
| 226 | 3300025908 | Ga0207643_10022720 | Ga0207643_100227203 | 222 |
| 227 | 3300025909 | Ga0207705_10511636 | Ga0207705_105116362 | 222 |
| 228 | 3300025910 | Ga0207684_10040070 | Ga0207684_100400703 | 222 |
| 229 | 3300025911 | Ga0207654_10275731 | Ga0207654_102757311 | 222 |
| 230 | 3300025912 | Ga0207707_10153234 | Ga0207707_101532342 | 222 |
| 231 | 3300025914 | Ga0207671_10201562 | Ga0207671_102015622 | 222 |
| 232 | 3300025918 | Ga0207662_10077997 | Ga0207662_100779973 | 222 |
| 233 | 3300025919 | Ga0207657_10038410 | Ga0207657_100384106 | 222 |
| 234 | 3300025922 | Ga0207646_10007353 | Ga0207646_100073538 | 222 |
| 235 | 3300025923 | Ga0207681_10008158 | Ga0207681_100081584 | 222 |
| 236 | 3300025923 | Ga0207681_10052825 | Ga0207681_100528255 | 222 |
| 237 | 3300025924 | Ga0207694_10280498 | Ga0207694_102804983 | 222 |
| 238 | 3300025928 | Ga0207700_10040749 | Ga0207700_100407491 | 222 |
| 239 | 3300025928 | Ga0207700_10759554 | Ga0207700_107595541 | 222 |
| 240 | 3300025929 | Ga0207664_10019741 | Ga0207664_100197411 | 222 |
| 241 | 3300025929 | Ga0207664_10021809 | Ga0207664_100218091 | 222 |
| 242 | 3300025931 | Ga0207644_10000973 | Ga0207644_1000097312 | 222 |
| 243 | 3300025932 | Ga0207690_10397641 | Ga0207690_103976412 | 222 |
| 244 | 3300025933 | Ga0207706_10028187 | Ga0207706_100281873 | 222 |
| 245 | 3300025935 | Ga0207709_10018663 | Ga0207709_100186636 | 222 |
| 246 | 3300025941 | Ga0207711_10000373 | Ga0207711_100003734 | 222 |
| 247 | 3300025944 | Ga0207661_10212631 | Ga0207661_102126312 | 222 |
| 248 | 3300025944 | Ga0207661_10442651 | Ga0207661_104426512 | 222 |
| 249 | 3300025944 | Ga0207661_10614303 | Ga0207661_106143032 | 222 |
| 250 | 3300025944 | Ga0207661_11036715 | Ga0207661_110367151 | 222 |
| 251 | 3300025945 | Ga0207679_10853935 | Ga0207679_108539351 | 222 |
| 252 | 3300025961 | Ga0207712_10000020 | Ga0207712_1000002086 | 222 |
| 253 | 3300025961 | Ga0207712_10156740 | Ga0207712_101567402 | 222 |
| 254 | 3300025981 | Ga0207640_10021935 | Ga0207640_100219354 | 222 |
| 255 | 3300025986 | Ga0207658_10002515 | Ga0207658_100025155 | 222 |
| 256 | 3300025986 | Ga0207658_10468518 | Ga0207658_104685181 | 222 |
| 257 | 3300026023 | Ga0207677_10362973 | Ga0207677_103629732 | 222 |
| 258 | 3300026023 | Ga0207677_10412387 | Ga0207677_104123871 | 222 |
| 259 | 3300026023 | Ga0207677_10422772 | Ga0207677_104227722 | 222 |
| 260 | 3300026067 | Ga0207678_10042928 | Ga0207678_100429284 | 222 |
| 261 | 3300026067 | Ga0207678_10209556 | Ga0207678_102095562 | 222 |
| 262 | 3300026067 | Ga0207678_10351524 | Ga0207678_103515241 | 222 |
| 263 | 3300026078 | Ga0207702_10519405 | Ga0207702_105194052 | 222 |
| 264 | 3300026078 | Ga0207702_10533345 | Ga0207702_105333452 | 222 |
| 265 | 3300026088 | Ga0207641_10000156 | Ga0207641_1000015640 | 222 |
| 266 | 3300026088 | Ga0207641_10006370 | Ga0207641_100063702 | 222 |
| 267 | 3300026088 | Ga0207641_10010166 | Ga0207641_100101669 | 222 |
| 268 | 3300026088 | Ga0207641_10452737 | Ga0207641_104527372 | 222 |
| 269 | 3300026088 | Ga0207641_10563431 | Ga0207641_105634312 | 222 |
| 270 | 3300026089 | Ga0207648_10028113 | Ga0207648_100281133 | 222 |
| 271 | 3300026116 | Ga0207674_10140376 | Ga0207674_101403763 | 222 |
| 272 | 3300026116 | Ga0207674_10248874 | Ga0207674_102488742 | 222 |
| 273 | 3300026116 | Ga0207674_10271064 | Ga0207674_102710642 | 222 |
| 274 | 3300026116 | Ga0207674_10273547 | Ga0207674_102735473 | 222 |
| 275 | 3300026118 | Ga0207675_100096500 | Ga0207675_1000965001 | 222 |
| 276 | 3300026121 | Ga0207683_10058309 | Ga0207683_100583094 | 222 |
| 277 | 3300026121 | Ga0207683_10119659 | Ga0207683_101196593 | 222 |
| 278 | 3300026121 | Ga0207683_10683255 | Ga0207683_106832551 | 222 |
| 279 | 3300026142 | Ga0207698_10174278 | Ga0207698_101742782 | 222 |
| 280 | 3300026142 | Ga0207698_10525772 | Ga0207698_105257722 | 222 |
| 281 | 3300027907 | Ga0207428_10078385 | Ga0207428_100783854 | 222 |
| 282 | 3300028379 | Ga0268266_10021318 | Ga0268266_100213182 | 222 |
| 283 | 3300028380 | Ga0268265_10000004 | Ga0268265_10000004371 | 222 |
| 284 | 3300028381 | Ga0268264_10000024 | Ga0268264_10000024351 | 222 |
| 285 | 3300028381 | Ga0268264_10127816 | Ga0268264_101278164 | 222 |
| 286 | 3300028381 | Ga0268264_10628197 | Ga0268264_106281972 | 222 |
| 287 | 3300028563 | Ga0265319_1000773 | Ga0265319_10007737 | 222 |
| 288 | 3300028573 | Ga0265334_10005961 | Ga0265334_100059611 | 222 |
| 289 | 3300028653 | Ga0265323_10005739 | Ga0265323_100057391 | 222 |
| 290 | 3300028654 | Ga0265322_10002763 | Ga0265322_100027633 | 222 |
| 291 | 3300028800 | Ga0265338_10000755 | Ga0265338_1000075516 | 222 |
| 292 | 3300028800 | Ga0265338_10002435 | Ga0265338_1000243514 | 222 |
| 293 | 3300029957 | Ga0265324_10000222 | Ga0265324_1000022222 | 222 |
| 294 | 3300029957 | Ga0265324_10005107 | Ga0265324_100051074 | 222 |
| 295 | 3300030745 | Ga0316182_1326249 | Ga0316182_13262492 | 222 |
| 296 | 3300031238 | Ga0265332_10001370 | Ga0265332_100013704 | 222 |
| 297 | 3300031240 | Ga0265320_10031179 | Ga0265320_100311792 | 222 |
| 298 | 3300031241 | Ga0265325_10027514 | Ga0265325_100275144 | 222 |
| 299 | 3300031456 | Ga0307513_10128345 | Ga0307513_101283452 | 222 |
| 300 | 3300031456 | Ga0307513_10297614 | Ga0307513_102976142 | 222 |
| 301 | 3300031730 | Ga0307516_10330947 | Ga0307516_103309471 | 222 |
| 302 | 3300032002 | Ga0307416_100541720 | Ga0307416_1005417201 | 222 |
| 303 | 3300035092 | Ga0373952_0032421 | Ga0373952_0032421_465_1145 | 222 |
| 304 | 3300035112 | Ga0373932_0078812 | Ga0373932_0078812_101_781 | 222 |
| 305 | 3300035119 | Ga0373956_0003565 | Ga0373956_0003565_1747_2424 | 222 |
| 306 | 3300035725 | Ga0373947_0127998 | Ga0373947_0127998_602_1294 | 222 |
| 307 | 3300036647 | Ga0316582_0123477 | Ga0316582_0123477_527_1225 | 222 |
| 308 | 3300036712 | Ga0316584_0110382 | Ga0316584_0110382_763_1461 | 222 |
| 309 | 3300041443 | Ga0451789_0149872 | Ga0451789_0149872_73_756 | 222 |
| 310 | 3300041452 | Ga0451793_0586671 | Ga0451793_0586671_1158_1841 | 222 |
| 311 | 3300042007 | Ga0439449_0041648 | Ga0439449_0041648_901_1590 | 222 |
| 312 | 3300042437 | Ga0439444_0042162 | Ga0439444_0042162_176_856 | 222 |
| 313 | 3300044656 | Ga0466969_0000386 | Ga0466969_0000386_15478_16176 | 222 |
| 314 | 3300044656 | Ga0466969_0044445 | Ga0466969_0044445_522_1205 | 222 |
| 315 | 3300044683 | Ga0466965_0035620 | Ga0466965_0035620_1667_2350 | 222 |
| 316 | 3300044683 | Ga0466965_0047415 | Ga0466965_0047415_1423_2103 | 222 |
| 317 | 3300044684 | Ga0466966_0106717 | Ga0466966_0106717_875_1552 | 222 |
| 318 | 3300044693 | Ga0466961_0015101 | Ga0466961_0015101_3330_4019 | 222 |
| 319 | 3300044694 | Ga0466963_0124736 | Ga0466963_0124736_215_883 | 222 |
| 320 | 3300044694 | Ga0466963_0187707 | Ga0466963_0187707_393_1097 | 222 |
| 321 | 3300044694 | Ga0466963_0405643 | Ga0466963_0405643_136_834 | 222 |
| 322 | 3300044719 | Ga0466971_0002410 | Ga0466971_0002410_6009_6689 | 222 |
| 323 | 3300044765 | Ga0466970_0149293 | Ga0466970_0149293_507_1187 | 222 |
| 324 | 3300044842 | Ga0466957_0014665 | Ga0466957_0014665_32_754 | 222 |
| 325 | 3300044842 | Ga0466957_0057863 | Ga0466957_0057863_821_1501 | 222 |
| 326 | 3300044842 | Ga0466957_0172952 | Ga0466957_0172952_244_921 | 222 |
| 327 | 3300044842 | Ga0466957_0301215 | Ga0466957_0301215_253_951 | 222 |
| 328 | 3300044901 | Ga0466960_0000108 | Ga0466960_0000108_26408_27091 | 222 |
| 329 | 3300044901 | Ga0466960_0014121 | Ga0466960_0014121_2662_3342 | 222 |
| 330 | 3300045049 | Ga0466959_0001180 | Ga0466959_0001180_7345_8025 | 222 |
| 331 | 3300045049 | Ga0466959_0224221 | Ga0466959_0224221_305_985 | 222 |
| 332 | 3300045049 | Ga0466959_0312294 | Ga0466959_0312294_311_988 | 222 |
| 333 | 3300045049 | Ga0466959_0328691 | Ga0466959_0328691_66_788 | 222 |
| 334 | 3300045049 | Ga0466959_0454727 | Ga0466959_0454727_41_718 | 222 |
| 335 | 3300045836 | Ga0466958_0114096 | Ga0466958_0114096_977_1657 | 222 |
| 336 | 3300045836 | Ga0466958_0117484 | Ga0466958_0117484_30_707 | 222 |
| 337 | 3300045976 | Ga0466967_0028784 | Ga0466967_0028784_1809_2486 | 222 |
| 338 | 3300045976 | Ga0466967_0085802 | Ga0466967_0085802_195_872 | 222 |
| 339 | 3300045976 | Ga0466967_0096688 | Ga0466967_0096688_1273_1995 | 222 |
| 340 | 3300045976 | Ga0466967_0215740 | Ga0466967_0215740_877_1581 | 222 |
| 341 | 3300045976 | Ga0466967_0278964 | Ga0466967_0278964_104_781 | 222 |
| 342 | 3300046454 | Ga0495592_0009158 | Ga0495592_0009158_2919_3596 | 222 |
| 343 | 3300046455 | Ga0495603_0029187 | Ga0495603_0029187_469_1161 | 222 |
| 344 | 3300046462 | Ga0495651_0100043 | Ga0495651_0100043_941_1618 | 222 |
| 345 | 3300046463 | Ga0495653_0067394 | Ga0495653_0067394_812_1489 | 222 |
| 346 | 3300046463 | Ga0495653_0128051 | Ga0495653_0128051_715_1392 | 222 |
| 347 | 3300046472 | Ga0495580_0174055 | Ga0495580_0174055_607_1284 | 222 |
| 348 | 3300046477 | Ga0495664_0008865 | Ga0495664_0008865_3882_4559 | 222 |
| 349 | 3300046511 | Ga0495608_0007435 | Ga0495608_0007435_6016_6693 | 222 |
| 350 | 3300046516 | Ga0495628_0010260 | Ga0495628_0010260_2997_3677 | 222 |
| 351 | 3300046526 | Ga0495666_0049966 | Ga0495666_0049966_1244_1921 | 222 |
| 352 | 3300046529 | Ga0495652_0001620 | Ga0495652_0001620_17167_17847 | 222 |
| 353 | 3300046531 | Ga0495665_0008244 | Ga0495665_0008244_1603_2280 | 222 |
| 354 | 3300046533 | Ga0495640_0053358 | Ga0495640_0053358_289_966 | 222 |
| 355 | 3300046542 | Ga0495597_0147059 | Ga0495597_0147059_251_928 | 222 |
| 356 | 3300046559 | Ga0495667_0056514 | Ga0495667_0056514_270_947 | 222 |
| 357 | 3300046559 | Ga0495667_0369029 | Ga0495667_0369029_117_794 | 222 |
| 358 | 3300046642 | Ga0495634_0132515 | Ga0495634_0132515_801_1481 | 222 |
| 359 | 3300046642 | Ga0495634_0167054 | Ga0495634_0167054_310_987 | 222 |
| 360 | 3300046663 | Ga0495635_0004216 | Ga0495635_0004216_6062_6742 | 222 |
| 361 | 3300046675 | Ga0495657_0039313 | Ga0495657_0039313_941_1618 | 222 |
| 362 | 3300046678 | Ga0495599_0120302 | Ga0495599_0120302_558_1235 | 222 |
| 363 | 3300046679 | Ga0495623_0159350 | Ga0495623_0159350_108_785 | 222 |
| 364 | 3300046680 | Ga0495646_0123080 | Ga0495646_0123080_249_929 | 222 |
| 365 | 3300046680 | Ga0495646_0236636 | Ga0495646_0236636_23_700 | 222 |
| 366 | 3300046689 | Ga0495613_0002970 | Ga0495613_0002970_9874_10551 | 222 |
| 367 | 3300046809 | Ga0495600_0038112 | Ga0495600_0038112_2193_2873 | 222 |
| 368 | 3300046809 | Ga0495600_0119978 | Ga0495600_0119978_108_785 | 222 |
| 369 | 3300047315 | Ga0495581_0088263 | Ga0495581_0088263_986_1663 | 222 |
| 370 | 3300047317 | Ga0495604_0016869 | Ga0495604_0016869_4529_5206 | 222 |
| 371 | 3300047323 | Ga0495683_0002207 | Ga0495683_0002207_9723_10400 | 222 |
| 372 | 3300047444 | Ga0495675_0004200 | Ga0495675_0004200_6064_6741 | 222 |
| 373 | 3300047444 | Ga0495675_0016253 | Ga0495675_0016253_1029_1706 | 222 |
| 374 | 3300047471 | Ga0495684_0049796 | Ga0495684_0049796_1280_1957 | 222 |
| 375 | 3300047673 | Ga0495593_0027202 | Ga0495593_0027202_726_1403 | 222 |
| 376 | 3300048088 | Ga0495602_0150691 | Ga0495602_0150691_108_785 | 222 |
| 377 | 3300048903 | Ga0496100_0077030 | Ga0496100_0077030_248_937 | 222 |
| 378 | 3300048903 | Ga0496100_0083631 | Ga0496100_0083631_746_1426 | 222 |
| 379 | 3300048903 | Ga0496100_0474858 | Ga0496100_0474858_181_855 | 222 |
| 380 | 3300048904 | Ga0496101_0003689 | Ga0496101_0003689_767_1447 | 222 |
| 381 | 3300048904 | Ga0496101_0362901 | Ga0496101_0362901_387_1067 | 222 |
| 382 | 3300048905 | Ga0496102_0000042 | Ga0496102_0000042_103651_104331 | 222 |
| 383 | 3300048905 | Ga0496102_0000164 | Ga0496102_0000164_5933_6607 | 222 |
| 384 | 3300048906 | Ga0496103_0000063 | Ga0496103_0000063_89543_90217 | 222 |
| 385 | 3300048906 | Ga0496103_0000194 | Ga0496103_0000194_59898_60578 | 222 |
| 386 | 3300048907 | Ga0496104_0038838 | Ga0496104_0038838_3625_4305 | 222 |
| 387 | 3300048907 | Ga0496104_0481239 | Ga0496104_0481239_393_1085 | 222 |
| 388 | 3300048907 | Ga0496104_0909601 | Ga0496104_0909601_95_775 | 222 |
| 389 | 3300048908 | Ga0496105_0026455 | Ga0496105_0026455_421_1101 | 222 |
| 390 | 3300048910 | Ga0496107_0233890 | Ga0496107_0233890_608_1288 | 222 |
| 391 | 3300048910 | Ga0496107_0438060 | Ga0496107_0438060_142_831 | 222 |
| 392 | 3300048911 | Ga0496108_0135393 | Ga0496108_0135393_1163_1843 | 222 |
| 393 | 3300048912 | Ga0496109_0281969 | Ga0496109_0281969_289_978 | 222 |
| 394 | 3300048912 | Ga0496109_0444941 | Ga0496109_0444941_279_959 | 222 |
| 395 | 3300048912 | Ga0496109_0567241 | Ga0496109_0567241_113_793 | 222 |
| 396 | 3300048912 | Ga0496109_0855132 | Ga0496109_0855132_92_772 | 222 |
| 397 | 3300048913 | Ga0496110_0207856 | Ga0496110_0207856_84_764 | 222 |
| 398 | 3300048916 | Ga0496113_0303403 | Ga0496113_0303403_384_1094 | 222 |
| 399 | 3300048917 | Ga0496114_0668389 | Ga0496114_0668389_122_802 | 222 |
| 400 | 3300048919 | Ga0496116_0024448 | Ga0496116_0024448_3706_4386 | 222 |
| 401 | 3300048920 | Ga0496117_0000261 | Ga0496117_0000261_13204_13884 | 222 |
| 402 | 3300048921 | Ga0496118_0000241 | Ga0496118_0000241_95723_96403 | 222 |
| 403 | 3300048921 | Ga0496118_0006546 | Ga0496118_0006546_1199_1873 | 222 |
| 404 | 3300048921 | Ga0496118_0161118 | Ga0496118_0161118_549_1235 | 222 |
| 405 | 3300048922 | Ga0496119_0000210 | Ga0496119_0000210_11383_12063 | 222 |
| 406 | 3300048922 | Ga0496119_0039783 | Ga0496119_0039783_117_791 | 222 |
| 407 | 3300048923 | Ga0496120_0019006 | Ga0496120_0019006_1289_1969 | 222 |
| 408 | 3300048924 | Ga0496121_0068582 | Ga0496121_0068582_1116_1790 | 222 |
| 409 | 3300048924 | Ga0496121_0092923 | Ga0496121_0092923_376_1056 | 222 |
| 410 | 3300048926 | Ga0496123_0219412 | Ga0496123_0219412_62_742 | 222 |
| 411 | 3300048929 | Ga0496126_0000255 | Ga0496126_0000255_21882_22562 | 222 |
| 412 | 3300049568 | Ga0501031_0295865 | Ga0501031_0295865_139_825 | 222 |
| 413 | 3300049568 | Ga0501031_0366968 | Ga0501031_0366968_41_742 | 222 |
| 414 | 3300049569 | Ga0501032_0019953 | Ga0501032_0019953_1477_2169 | 222 |
| 415 | 3300049571 | Ga0501034_0117469 | Ga0501034_0117469_702_1385 | 222 |
| 416 | 3300049579 | Ga0501043_0081667 | Ga0501043_0081667_518_1210 | 222 |
| 417 | 3300049580 | Ga0501046_0032542 | Ga0501046_0032542_1560_2252 | 222 |
| 418 | 3300049581 | Ga0501047_0000031 | Ga0501047_0000031_40729_41433 | 222 |
| 419 | 3300049581 | Ga0501047_0008300 | Ga0501047_0008300_2290_2982 | 222 |
| 420 | 3300049582 | Ga0501048_0000085 | Ga0501048_0000085_41912_42604 | 222 |
| 421 | 3300049582 | Ga0501048_0338400 | Ga0501048_0338400_183_872 | 222 |
| 422 | 3300049583 | Ga0501067_0042268 | Ga0501067_0042268_987_1679 | 222 |
| 423 | 3300049586 | Ga0501070_0020999 | Ga0501070_0020999_3270_3962 | 222 |
| 424 | 3300049586 | Ga0501070_0124903 | Ga0501070_0124903_668_1351 | 222 |
| 425 | 3300049590 | Ga0501074_0129179 | Ga0501074_0129179_246_923 | 222 |
| 426 | 3300049823 | Ga0501044_0046879 | Ga0501044_0046879_768_1460 | 222 |
| 427 | 3300050491 | nmdc:mga00v17_114444_c1 | nmdc:mga00v17_114444_c1_731_1411 | 222 |
| 428 | 3300050496 | nmdc:mga07m45_115896_c1 | nmdc:mga07m45_115896_c1_582_1262 | 222 |
| 429 | 3300050507 | nmdc:mga05p37_554887_c1 | nmdc:mga05p37_554887_c1_429_1118 | 222 |
| 430 | 3300050508 | nmdc:mga09592_40051_c1 | nmdc:mga09592_40051_c1_2933_3622 | 222 |
| 431 | 3300050509 | nmdc:mga0qj67_5984_c1 | nmdc:mga0qj67_5984_c1_839_1528 | 222 |
| 432 | 3300050510 | nmdc:mga06r32_97529_c1 | nmdc:mga06r32_97529_c1_1350_2039 | 222 |
| 433 | 3300050511 | nmdc:mga08y16_195828_c1 | nmdc:mga08y16_195828_c1_1295_1990 | 222 |
| 434 | 3300050511 | nmdc:mga08y16_277452_c1 | nmdc:mga08y16_277452_c1_585_1286 | 222 |
| 435 | 3300053077 | Ga0495601_0004422 | Ga0495601_0004422_6886_7566 | 222 |
| 436 | 3300053077 | Ga0495601_0037885 | Ga0495601_0037885_1224_1901 | 222 |
| 437 | 3300053077 | Ga0495601_0058957 | Ga0495601_0058957_397_1077 | 222 |
| 438 | 3300053078 | Ga0495612_0008859 | Ga0495612_0008859_1798_2478 | 222 |
| 439 | 3300053083 | Ga0495655_0070294 | Ga0495655_0070294_114_803 | 222 |
| 440 | 3300053085 | Ga0495619_0407797 | Ga0495619_0407797_94_774 | 222 |
| 441 | 3300061719 | Ga0466962_0084125 | Ga0466962_0084125_760_1437 | 222 |
| 442 | iso_pu_bacteria | 2643221679 | 2644444900 | 222 |
| 443 | iso_pu_bacteria | 2751185725 | 2753038336 | 222 |
| 444 | iso_pu_bacteria | 2751185792 | 2753326847 | 222 |
| 445 | iso_pu_bacteria | 2816332119 | 2816423517 | 222 |
| 446 | iso_pu_bacteria | 2868088558 | 2868093527 | 222 |
| 447 | iso_pu_bacteria | 2956939328 | 2956939415 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8i6d-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with 5-hydroxy-2,4(1h,3h)-pyrimidinedione, form vi | 0.9552 | 3 | 222 |
| 8i63-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with barbituric acid, form iii | 0.9317 | 3 | 222 |
| 3tr7-assembly1.cif.gz_A | structure of a uracil-dna glycosylase (ung) from coxiella burnetii | 0.9246 | 11 | 222 |
| 8i63-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with barbituric acid, form iii | 0.9236 | 3 | 222 |
| 1eug-assembly1.cif.gz_A | crystal structure of escherichia coli uracil dna glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited | 0.9192 | 11 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3a7nA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9546 | 2 | 222 | 3.40.470.10 |
| 3a7nA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9464 | 2 | 222 | 3.40.470.10 |
| 1okbB00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9117 | 5 | 222 | 3.40.470.10 |
| af_Q1ZXM2_175_429_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.907 | 4 | 221 | 3.40.470.10 |
| 1okbB00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8924 | 5 | 222 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W1VK98-F1-model_v4 | uracil-DNA glycosylase (EC 3.2.2.27) | 0.9813 | 88 | 222 |
GO:0004844
GO:0097510 |
| AF-A0A251XHV8-F1-model_v4 | Uracil-DNA glycosylase | 0.9765 | 128 | 221 |
GO:0004844
GO:0097510 |
| AF-A0A7K1A052-F1-model_v4 | Uracil-DNA glycosylase (EC 3.2.2.27) | 0.9731 | 101 | 222 |
GO:0004844
GO:0097510 |
| AF-A0A7I8ANC8-F1-model_v4 | deleted | 0.9663 | 75 | 221 |
|
| AF-A0A7J9YAY4-F1-model_v4 | Uracil-DNA glycosylase (EC 3.2.2.27) | 0.9647 | 1 | 222 |
GO:0004844
GO:0005737 GO:0097510 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar