F445909

General Info

Members Datasets Scaffolds Average Seq Length
447 295 416 226

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10234957|Ga0070717_102349572
Length 226
Sequence MRPLTDSCEAGWARALEPVAAQISAMGDFLREEITQGRTYLPSGDNVLRAFKQPFDEVRVLIVGQDPYPTPGHPIGLSFSVAPTVKRIPGSLLNIFKEYTADLGYPRPATGDLTPWAENGVLLLNRVLTVQPGKPGSHRGKGWEAVTEQAIKALAERNDRGNPLVAILWGRDARNLAPLLGGVPKIESAHPSPMVANGDFFGSRPFSRANQLLEAHGGTAVDWKLP

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
5 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
6 2643221679 Angustibacter sp. Root456 Isolate Unclassified
7 2643221692 Nocardia sp. Root136 Isolate Unclassified
8 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
9 2687453737 Frankia sp. BMG5.36 Isolate Nodule
10 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
11 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
12 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
13 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
14 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
15 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
16 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
17 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
18 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
19 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
20 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
21 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
22 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
23 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
24 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
25 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
26 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
27 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
28 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
29 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
159 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
178 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
294 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
295 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.72
Metatranscriptomes 1.34
Isolates 6.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0.45
Rhizoplane 6.26
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 7.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10054851 3300001990 Bacteria 1205
2 rootH2_10078173 3300003320 Bacteria 7058
3 rootH2_10154633 3300003320 Bacteria 2278
4 rootL2_10064882 3300003322 Bacteria 5965
5 rootH1_10000259 3300003323 Bacteria 5285
6 Ga0070658_10273613 3300005327 Bacteria 1437
7 Ga0070658_10315635 3300005327 Bacteria 1334
8 Ga0070676_10090925 3300005328 Bacteria 1869
9 Ga0070676_10284737 3300005328 Bacteria 1115
10 Ga0070683_100349820 3300005329 Bacteria 1407
11 Ga0070683_101152881 3300005329 Bacteria 745
12 Ga0070682_100138817 3300005337 Bacteria 1654
13 Ga0070682_100399074 3300005337 Bacteria 1039
14 Ga0068868_100280413 3300005338 Bacteria 1410
15 Ga0068868_100329627 3300005338 Bacteria 1302
16 Ga0068868_100555549 3300005338 Bacteria 1012
17 Ga0070661_100119207 3300005344 Bacteria 1975
18 Ga0070692_10205648 3300005345 Bacteria 1155
19 Ga0070668_100502719 3300005347 Bacteria 1049
20 Ga0070675_100094864 3300005354 Bacteria 2504
21 Ga0070671_100000412 3300005355 Bacteria 29645
22 Ga0070671_100141970 3300005355 Bacteria 2026
23 Ga0070674_100250145 3300005356 Bacteria 1392
24 Ga0070674_100443684 3300005356 Bacteria 1070
25 Ga0070674_100470224 3300005356 Bacteria 1041
26 Ga0070659_100024271 3300005366 Bacteria 4647
27 Ga0070659_100275667 3300005366 Bacteria 1398
28 Ga0070667_100000063 3300005367 Bacteria 138777
29 Ga0070667_100066231 3300005367 Bacteria 3069
30 Ga0070667_100248145 3300005367 Bacteria 1591
31 Ga0070667_100343974 3300005367 Bacteria 1349
32 Ga0070714_100003703 3300005435 Bacteria 11447
33 Ga0070714_100202674 3300005435 Bacteria 1815
34 Ga0070714_100333367 3300005435 Bacteria 1421
35 Ga0070713_100065734 3300005436 Bacteria 3048
36 Ga0070710_10292177 3300005437 Bacteria 1061
37 Ga0070710_10340458 3300005437 Bacteria 990
38 Ga0070663_100134044 3300005455 Bacteria 1884
39 Ga0070663_100165363 3300005455 Bacteria 1706
40 Ga0070663_100313277 3300005455 Bacteria 1260
41 Ga0070662_100200027 3300005457 Bacteria 1585
42 Ga0070681_10313913 3300005458 Bacteria 1477
43 Ga0068867_100093300 3300005459 Bacteria 2288
44 Ga0068867_100393851 3300005459 Bacteria 1167
45 Ga0070685_10065308 3300005466 Bacteria 2141
46 Ga0070698_100059764 3300005471 Bacteria 3849
47 Ga0070684_100308254 3300005535 Bacteria 1453
48 Ga0068853_100091299 3300005539 Bacteria 2678
49 Ga0070672_100372170 3300005543 Bacteria 1221
50 Ga0070696_100006628 3300005546 Bacteria 7736
51 Ga0070665_100099962 3300005548 Bacteria 2905
52 Ga0070665_100349692 3300005548 Bacteria 1483
53 Ga0068855_100102803 3300005563 Bacteria 3288
54 Ga0070664_100042117 3300005564 Bacteria 3855
55 Ga0068857_100268183 3300005577 Bacteria 1568
56 Ga0068854_100048597 3300005578 Bacteria 3027
57 Ga0068856_100498678 3300005614 Bacteria 1238
58 Ga0070702_100172161 3300005615 Bacteria 1409
59 Ga0068852_100634905 3300005616 Bacteria 1074
60 Ga0068859_100000777 3300005617 Bacteria 32236
61 Ga0068859_100000944 3300005617 Bacteria 29749
62 Ga0068859_100682276 3300005617 Bacteria 1119
63 Ga0068864_100661970 3300005618 Bacteria 1017
64 Ga0068866_10499300 3300005718 Bacteria 805
65 Ga0068851_10052054 3300005834 Bacteria 2082
66 Ga0068851_10095684 3300005834 Bacteria 1569
67 Ga0068870_10356105 3300005840 Bacteria 940
68 Ga0068863_100000159 3300005841 Bacteria 71831
69 Ga0068863_100000648 3300005841 Bacteria 35309
70 Ga0068863_100007113 3300005841 Bacteria 10973
71 Ga0068863_100035863 3300005841 Bacteria 4723
72 Ga0068858_100009162 3300005842 Bacteria 9462
73 Ga0068858_100051255 3300005842 Bacteria 3818
74 Ga0068858_100056127 3300005842 Bacteria 3641
75 Ga0068860_100000065 3300005843 Bacteria 186634
76 Ga0068862_100000028 3300005844 Bacteria 184197
77 Ga0068862_100583839 3300005844 Bacteria 1071
78 Ga0081540_1005051 3300005983 Bacteria 9898
79 Ga0070717_10205762 3300006028 Bacteria 1725
80 Ga0070717_10234957 3300006028 Bacteria 1615
81 Ga0070717_10543512 3300006028 Bacteria 1052
82 Ga0075365_10091417 3300006038 Bacteria 2074
83 Ga0075364_10130295 3300006051 Bacteria 1688
84 Ga0075370_10117767 3300006353 Bacteria 1545
85 Ga0075428_100006048 3300006844 Bacteria 13445
86 Ga0075428_100293330 3300006844 Bacteria 1749
87 Ga0075430_100019963 3300006846 Bacteria 5702
88 Ga0097620_100000777 3300006931 Bacteria 32236
89 Ga0097620_100000944 3300006931 Bacteria 29749
90 Ga0097620_100016788 3300006931 Bacteria 7351
91 Ga0097620_100682290 3300006931 Bacteria 1119
92 Ga0099794_10239930 3300007265 Bacteria 934
93 Ga0111539_10587084 3300009094 Bacteria 1297
94 Ga0111539_10885408 3300009094 Bacteria 1038
95 Ga0111539_11266795 3300009094 Bacteria 856
96 Ga0105245_10172177 3300009098 Bacteria 2062
97 Ga0105245_10554059 3300009098 Bacteria 1172
98 Ga0105247_10254600 3300009101 Bacteria 1201
99 Ga0114129_10001766 3300009147 Bacteria 29481
100 Ga0105243_10017906 3300009148 Bacteria 5361
101 Ga0105243_10998772 3300009148 Bacteria 839
102 Ga0105241_10118131 3300009174 Bacteria 2132
103 Ga0105242_10267051 3300009176 Bacteria 1548
104 Ga0105242_10632539 3300009176 Bacteria 1038
105 Ga0105248_10050782 3300009177 Bacteria 4652
106 Ga0105237_10351936 3300009545 Bacteria 1477
107 Ga0105237_10808241 3300009545 Bacteria 944
108 Ga0105238_10979354 3300009551 Bacteria 866
109 Ga0105249_10080852 3300009553 Bacteria 3020
110 Ga0105249_10108052 3300009553 Bacteria 2626
111 Ga0105249_11123445 3300009553 Bacteria 856
112 Ga0105239_10454534 3300010375 Bacteria 1453
113 Ga0105239_10673605 3300010375 Bacteria 1182
114 Ga0105239_11197895 3300010375 Bacteria 875
115 Ga0105246_10069559 3300011119 Bacteria 2473
116 Ga0105246_10526913 3300011119 Bacteria 1008
117 Ga0157369_10721866 3300013105 Bacteria 1026
118 Ga0157374_10922242 3300013296 Bacteria 891
119 Ga0157374_11124584 3300013296 Bacteria 806
120 Ga0157378_10205516 3300013297 Bacteria 1865
121 Ga0163162_11193323 3300013306 Bacteria 863
122 Ga0157372_10634128 3300013307 Bacteria 1245
123 Ga0157375_10361858 3300013308 Bacteria 1617
124 Ga0163163_10567906 3300014325 Bacteria 1197
125 Ga0163163_10744957 3300014325 Bacteria 1043
126 Ga0163163_10834937 3300014325 Bacteria 985
127 Ga0157377_10187800 3300014745 Bacteria 1304
128 Ga0157379_10001387 3300014968 Bacteria 19820
129 Ga0157379_10473616 3300014968 Bacteria 1158
130 Ga0206356_11257196 3300020070 Bacteria 758
131 Ga0206354_10127114 3300020081 Bacteria 1097
132 Ga0206354_10547656 3300020081 Bacteria 1366
133 Ga0206354_11585944 3300020081 Bacteria 2151
134 Ga0206353_11490006 3300020082 Bacteria 5780
135 Ga0213876_10140919 3300021384 Bacteria 1282
136 Ga0224712_10001633 3300022467 Bacteria 5269
137 Ga0207656_10056297 3300025321 Bacteria 1714
138 Ga0207692_10191226 3300025898 Bacteria 1198
139 Ga0207710_10000014 3300025900 Bacteria 408072
140 Ga0207680_10083273 3300025903 Bacteria 2016
141 Ga0207647_10010162 3300025904 Bacteria 6652
142 Ga0207647_10029890 3300025904 Bacteria 3520
143 Ga0207645_10005431 3300025907 Bacteria 9240
144 Ga0207643_10022720 3300025908 Bacteria 3456
145 Ga0207705_10511636 3300025909 Bacteria 933
146 Ga0207684_10040070 3300025910 Bacteria 3971
147 Ga0207654_10275731 3300025911 Bacteria 1136
148 Ga0207707_10153234 3300025912 Bacteria 2015
149 Ga0207671_10201562 3300025914 Bacteria 1554
150 Ga0207662_10077997 3300025918 Bacteria 2016
151 Ga0207657_10038410 3300025919 Bacteria 4262
152 Ga0207657_10165552 3300025919 Bacteria 1794
153 Ga0207646_10007353 3300025922 Bacteria 11218
154 Ga0207681_10008158 3300025923 Bacteria 6403
155 Ga0207681_10052825 3300025923 Bacteria 2757
156 Ga0207694_10280498 3300025924 Bacteria 1368
157 Ga0207700_10040749 3300025928 Bacteria 3392
158 Ga0207700_10759554 3300025928 Bacteria 866
159 Ga0207664_10019741 3300025929 Bacteria 4988
160 Ga0207664_10021809 3300025929 Bacteria 4772
161 Ga0207644_10000973 3300025931 Bacteria 18301
162 Ga0207690_10397641 3300025932 Bacteria 1098
163 Ga0207706_10028187 3300025933 Bacteria 5017
164 Ga0207709_10018663 3300025935 Bacteria 3888
165 Ga0207711_10000373 3300025941 Bacteria 47596
166 Ga0207661_10212631 3300025944 Bacteria 1705
167 Ga0207661_10442651 3300025944 Bacteria 1183
168 Ga0207661_10614303 3300025944 Bacteria 998
169 Ga0207661_11036715 3300025944 Bacteria 755
170 Ga0207679_10853935 3300025945 Bacteria 831
171 Ga0207712_10000020 3300025961 Bacteria 292796
172 Ga0207712_10156740 3300025961 Bacteria 1765
173 Ga0207640_10021935 3300025981 Bacteria 3814
174 Ga0207658_10002515 3300025986 Bacteria 13345
175 Ga0207658_10468518 3300025986 Bacteria 1118
176 Ga0207677_10362973 3300026023 Bacteria 1217
177 Ga0207677_10412387 3300026023 Bacteria 1148
178 Ga0207677_10422772 3300026023 Bacteria 1135
179 Ga0207678_10042928 3300026067 Bacteria 3914
180 Ga0207678_10209556 3300026067 Bacteria 1667
181 Ga0207678_10351524 3300026067 Bacteria 1271
182 Ga0207702_10519405 3300026078 Bacteria 1162
183 Ga0207702_10533345 3300026078 Bacteria 1147
184 Ga0207641_10000156 3300026088 Bacteria 97171
185 Ga0207641_10006370 3300026088 Bacteria 9964
186 Ga0207641_10010166 3300026088 Bacteria 7738
187 Ga0207641_10452737 3300026088 Bacteria 1241
188 Ga0207641_10563431 3300026088 Bacteria 1112
189 Ga0207648_10028113 3300026089 Bacteria 4988
190 Ga0207674_10140376 3300026116 Bacteria 2375
191 Ga0207674_10248874 3300026116 Bacteria 1724
192 Ga0207674_10271064 3300026116 Bacteria 1645
193 Ga0207674_10273547 3300026116 Bacteria 1637
194 Ga0207675_100096500 3300026118 Bacteria 2783
195 Ga0207683_10058309 3300026121 Bacteria 3390
196 Ga0207683_10119659 3300026121 Bacteria 2363
197 Ga0207683_10683255 3300026121 Bacteria 951
198 Ga0207698_10174278 3300026142 Bacteria 1898
199 Ga0207698_10378080 3300026142 Bacteria 1346
200 Ga0207698_10525772 3300026142 Bacteria 1155
201 Ga0207428_10078385 3300027907 Bacteria 2585
202 Ga0268266_10021318 3300028379 Bacteria 5521
203 Ga0268265_10000004 3300028380 Bacteria 648376
204 Ga0268264_10000024 3300028381 Bacteria 470081
205 Ga0268264_10127816 3300028381 Bacteria 2249
206 Ga0268264_10628197 3300028381 Bacteria 1061
207 Ga0265319_1000773 3300028563 Bacteria 20790
208 Ga0265334_10005961 3300028573 Bacteria 5301
209 Ga0265318_10050946 3300028577 Bacteria 1555
210 Ga0265323_10005739 3300028653 Bacteria 5259
211 Ga0265322_10002763 3300028654 Bacteria 5366
212 Ga0265338_10000755 3300028800 Bacteria 55199
213 Ga0265338_10002435 3300028800 Bacteria 27969
214 Ga0265338_10563380 3300028800 Bacteria 797
215 Ga0265324_10000222 3300029957 Bacteria 43679
216 Ga0265324_10005107 3300029957 Bacteria 5745
217 Ga0316182_1326249 3300030745 Bacteria 1193
218 Ga0265332_10001370 3300031238 Bacteria 13798
219 Ga0265320_10031179 3300031240 Bacteria 2740
220 Ga0265320_10064379 3300031240 Bacteria 1742
221 Ga0265325_10027514 3300031241 Bacteria 3073
222 Ga0307513_10128345 3300031456 Bacteria 2486
223 Ga0307513_10297614 3300031456 Bacteria 1382
224 Ga0307516_10330947 3300031730 Bacteria 1192
225 Ga0307416_100541720 3300032002 Bacteria 1236
226 Ga0373926_0000330 3300035083 Bacteria 11877
227 Ga0373952_0032421 3300035092 Bacteria 1167
228 Ga0373932_0078812 3300035112 Bacteria 1037
229 Ga0373956_0003565 3300035119 Bacteria 6275
230 Ga0373935_0001562 3300035692 Bacteria 12768
231 Ga0373947_0000002 3300035725 Bacteria 383924
232 Ga0373947_0127998 3300035725 Bacteria 1619
233 Ga0316582_0123477 3300036647 Bacteria 1735
234 Ga0316584_0110382 3300036712 Bacteria 2058
235 Ga0451789_0149872 3300041443 Bacteria 788
236 Ga0451789_0935306 3300041443 Bacteria 1184
237 Ga0451793_0586671 3300041452 Bacteria 2667
238 Ga0439449_0041648 3300042007 Bacteria 1708
239 Ga0439444_0042162 3300042437 Bacteria 900
240 Ga0466969_0000386 3300044656 Bacteria 24220
241 Ga0466969_0044445 3300044656 Bacteria 2209
242 Ga0466965_0035620 3300044683 Bacteria 2438
243 Ga0466965_0047415 3300044683 Bacteria 2127
244 Ga0466966_0106717 3300044684 Bacteria 1728
245 Ga0466961_0015101 3300044693 Bacteria 4958
246 Ga0466963_0124736 3300044694 Bacteria 1775
247 Ga0466963_0187707 3300044694 Bacteria 1444
248 Ga0466963_0405643 3300044694 Bacteria 961
249 Ga0466971_0002410 3300044719 Bacteria 7890
250 Ga0466970_0149293 3300044765 Bacteria 1290
251 Ga0466957_0014665 3300044842 Bacteria 4566
252 Ga0466957_0057863 3300044842 Bacteria 2374
253 Ga0466957_0172952 3300044842 Bacteria 1408
254 Ga0466957_0301215 3300044842 Bacteria 1077
255 Ga0466960_0000108 3300044901 Bacteria 27686
256 Ga0466960_0014121 3300044901 Bacteria 3409
257 Ga0466959_0001180 3300045049 Bacteria 15747
258 Ga0466959_0224221 3300045049 Bacteria 1303
259 Ga0466959_0312294 3300045049 Bacteria 1076
260 Ga0466959_0328691 3300045049 Bacteria 1044
261 Ga0466959_0454727 3300045049 Bacteria 868
262 Ga0466958_0114096 3300045836 Bacteria 1688
263 Ga0466958_0117484 3300045836 Bacteria 1663
264 Ga0466967_0028784 3300045976 Bacteria 4643
265 Ga0466967_0085802 3300045976 Bacteria 2851
266 Ga0466967_0096688 3300045976 Bacteria 2694
267 Ga0466967_0215740 3300045976 Bacteria 1821
268 Ga0466967_0278964 3300045976 Bacteria 1603
269 Ga0495592_0009158 3300046454 Bacteria 7450
270 Ga0495603_0029187 3300046455 Bacteria 3327
271 Ga0495651_0100043 3300046462 Bacteria 2160
272 Ga0495653_0067394 3300046463 Bacteria 2688
273 Ga0495653_0128051 3300046463 Bacteria 1801
274 Ga0495580_0174055 3300046472 Bacteria 1487
275 Ga0495664_0008865 3300046477 Bacteria 5620
276 Ga0495608_0007435 3300046511 Bacteria 7739
277 Ga0495628_0010260 3300046516 Bacteria 7967
278 Ga0495666_0049966 3300046526 Bacteria 2010
279 Ga0495652_0001620 3300046529 Bacteria 24570
280 Ga0495665_0008244 3300046531 Bacteria 5649
281 Ga0495640_0053358 3300046533 Bacteria 2771
282 Ga0495597_0147059 3300046542 Bacteria 969
283 Ga0495667_0056514 3300046559 Bacteria 2580
284 Ga0495667_0369029 3300046559 Bacteria 906
285 Ga0495634_0132515 3300046642 Bacteria 1588
286 Ga0495634_0167054 3300046642 Bacteria 1384
287 Ga0495625_0119933 3300046660 Bacteria 1791
288 Ga0495635_0004216 3300046663 Bacteria 9972
289 Ga0495657_0039313 3300046675 Bacteria 3251
290 Ga0495599_0120302 3300046678 Bacteria 1632
291 Ga0495623_0159350 3300046679 Bacteria 1327
292 Ga0495646_0123080 3300046680 Bacteria 1466
293 Ga0495646_0236636 3300046680 Bacteria 982
294 Ga0495613_0002970 3300046689 Bacteria 12699
295 Ga0495624_0091791 3300046690 Bacteria 1873
296 Ga0495600_0038112 3300046809 Bacteria 3127
297 Ga0495600_0119978 3300046809 Bacteria 1710
298 Ga0495581_0088263 3300047315 Bacteria 1798
299 Ga0495604_0016869 3300047317 Bacteria 5838
300 Ga0495604_0244591 3300047317 Bacteria 1225
301 Ga0495676_0339906 3300047321 Bacteria 1005
302 Ga0495680_0152605 3300047322 Bacteria 1683
303 Ga0495683_0002207 3300047323 Bacteria 11926
304 Ga0495675_0004200 3300047444 Bacteria 8719
305 Ga0495675_0016253 3300047444 Bacteria 4706
306 Ga0495684_0049796 3300047471 Bacteria 3200
307 Ga0495593_0027202 3300047673 Bacteria 3150
308 Ga0495602_0150691 3300048088 Bacteria 1828
309 Ga0496100_0077030 3300048903 Bacteria 2241
310 Ga0496100_0083631 3300048903 Bacteria 2161
311 Ga0496100_0474858 3300048903 Bacteria 961
312 Ga0496101_0003689 3300048904 Bacteria 9558
313 Ga0496101_0359974 3300048904 Bacteria 1144
314 Ga0496101_0362901 3300048904 Bacteria 1139
315 Ga0496102_0000042 3300048905 Bacteria 196538
316 Ga0496102_0000164 3300048905 Bacteria 89355
317 Ga0496103_0000063 3300048906 Bacteria 128503
318 Ga0496103_0000194 3300048906 Bacteria 60666
319 Ga0496104_0038838 3300048907 Bacteria 4456
320 Ga0496104_0481239 3300048907 Bacteria 1153
321 Ga0496104_0909601 3300048907 Bacteria 785
322 Ga0496105_0026455 3300048908 Bacteria 4732
323 Ga0496107_0233890 3300048910 Bacteria 1367
324 Ga0496107_0438060 3300048910 Bacteria 971
325 Ga0496108_0135393 3300048911 Bacteria 2119
326 Ga0496109_0281969 3300048912 Bacteria 1566
327 Ga0496109_0444941 3300048912 Bacteria 1224
328 Ga0496109_0567241 3300048912 Bacteria 1070
329 Ga0496109_0855132 3300048912 Bacteria 847
330 Ga0496110_0207856 3300048913 Bacteria 1779
331 Ga0496113_0303403 3300048916 Bacteria 1279
332 Ga0496114_0242584 3300048917 Bacteria 1585
333 Ga0496114_0668389 3300048917 Bacteria 913
334 Ga0496116_0024448 3300048919 Bacteria 4468
335 Ga0496117_0000261 3300048920 Bacteria 99625
336 Ga0496118_0000241 3300048921 Bacteria 96484
337 Ga0496118_0006546 3300048921 Bacteria 12745
338 Ga0496118_0161118 3300048921 Bacteria 1387
339 Ga0496119_0000210 3300048922 Bacteria 83492
340 Ga0496119_0039783 3300048922 Bacteria 3019
341 Ga0496120_0019006 3300048923 Bacteria 4411
342 Ga0496121_0068582 3300048924 Bacteria 2868
343 Ga0496121_0092923 3300048924 Bacteria 2350
344 Ga0496123_0219412 3300048926 Bacteria 960
345 Ga0496126_0000255 3300048929 Bacteria 114737
346 Ga0496126_0021449 3300048929 Bacteria 6308
347 Ga0501031_0006742 3300049568 Bacteria 7489
348 Ga0501031_0295865 3300049568 Bacteria 1049
349 Ga0501031_0366968 3300049568 Bacteria 932
350 Ga0501032_0019953 3300049569 Bacteria 4678
351 Ga0501032_0022091 3300049569 Bacteria 4416
352 Ga0501033_0039913 3300049570 Bacteria 3505
353 Ga0501034_0059273 3300049571 Bacteria 3845
354 Ga0501034_0117469 3300049571 Bacteria 2647
355 Ga0501036_0002429 3300049572 Bacteria 14586
356 Ga0501037_0001974 3300049573 Bacteria 14840
357 Ga0501037_0153102 3300049573 Bacteria 1647
358 Ga0501038_0013929 3300049574 Bacteria 7329
359 Ga0501039_0016960 3300049575 Bacteria 5582
360 Ga0501040_0011494 3300049576 Bacteria 5794
361 Ga0501041_0003738 3300049577 Bacteria 8753
362 Ga0501042_0102903 3300049578 Bacteria 2054
363 Ga0501043_0000682 3300049579 Bacteria 29934
364 Ga0501043_0081667 3300049579 Bacteria 2540
365 Ga0501046_0032542 3300049580 Bacteria 4223
366 Ga0501046_0077015 3300049580 Bacteria 2582
367 Ga0501047_0000031 3300049581 Bacteria 215903
368 Ga0501047_0000947 3300049581 Bacteria 29395
369 Ga0501047_0001051 3300049581 Bacteria 27524
370 Ga0501047_0008300 3300049581 Bacteria 9803
371 Ga0501048_0000085 3300049582 Bacteria 48910
372 Ga0501048_0093600 3300049582 Bacteria 2119
373 Ga0501048_0338400 3300049582 Bacteria 1073
374 Ga0501067_0001352 3300049583 Bacteria 13275
375 Ga0501067_0042268 3300049583 Bacteria 2530
376 Ga0501068_0019476 3300049584 Bacteria 3942
377 Ga0501069_0020661 3300049585 Bacteria 3568
378 Ga0501070_0012956 3300049586 Bacteria 7027
379 Ga0501070_0020999 3300049586 Bacteria 5478
380 Ga0501070_0124903 3300049586 Bacteria 2127
381 Ga0501071_0001160 3300049587 Bacteria 14757
382 Ga0501072_0010818 3300049588 Bacteria 6952
383 Ga0501073_0039289 3300049589 Bacteria 3352
384 Ga0501074_0031695 3300049590 Bacteria 3829
385 Ga0501074_0129179 3300049590 Bacteria 1808
386 Ga0501076_0003071 3300049592 Bacteria 11624
387 Ga0501077_0041741 3300049593 Bacteria 2919
388 Ga0501079_0006331 3300049741 Bacteria 8882
389 Ga0501080_0032629 3300049742 Bacteria 4857
390 Ga0501083_0003083 3300049744 Bacteria 11583
391 Ga0501035_0013124 3300049822 Bacteria 7645
392 Ga0501044_0012529 3300049823 Bacteria 9184
393 Ga0501044_0046879 3300049823 Bacteria 4473
394 Ga0501044_0463456 3300049823 Bacteria 1172
395 Ga0501045_0004098 3300049824 Bacteria 10060
396 nmdc:mga00v17_114444_c1 3300050491 Bacteria 1713
397 nmdc:mga0yw44_75362_c1 3300050492 Bacteria 2103
398 nmdc:mga07m45_115896_c1 3300050496 Bacteria 1545
399 nmdc:mga05p37_554887_c1 3300050507 Bacteria 1307
400 nmdc:mga09592_40051_c1 3300050508 Bacteria 3937
401 nmdc:mga0qj67_5984_c1 3300050509 Bacteria 8912
402 nmdc:mga06r32_97529_c1 3300050510 Bacteria 2881
403 nmdc:mga08y16_195828_c1 3300050511 Bacteria 2095
404 nmdc:mga08y16_277452_c1 3300050511 Bacteria 1729
405 Ga0495601_0004422 3300053077 Bacteria 8117
406 Ga0495601_0037885 3300053077 Bacteria 3014
407 Ga0495601_0058957 3300053077 Bacteria 2433
408 Ga0495612_0008859 3300053078 Bacteria 4076
409 Ga0495655_0070294 3300053083 Bacteria 977
410 Ga0495619_0176446 3300053085 Bacteria 1478
411 Ga0495619_0407797 3300053085 Bacteria 938
412 Ga0500645_000075 3300053730 Bacteria 78736
413 Ga0501084_0013503 3300054114 Bacteria 6759
414 Ga0501082_0027263 3300060353 Bacteria 4919
415 Ga0466962_0084125 3300061719 Bacteria 1522
416 Ga0530510_0117686 3300061734 Bacteria 1949

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10563380 Ga0265338_105633801 209
2 3300035083 Ga0373926_0000330 Ga0373926_0000330_10264_10893 209
3 3300035692 Ga0373935_0001562 Ga0373935_0001562_10978_11607 209
4 3300035725 Ga0373947_0000002 Ga0373947_0000002_269344_269973 209
5 3300025919 Ga0207657_10165552 Ga0207657_101655523 210
6 iso_pu_bacteria 2818991463 2819698625 212
7 3300028577 Ga0265318_10050946 Ga0265318_100509462 213
8 3300031240 Ga0265320_10064379 Ga0265320_100643793 213
9 3300006038 Ga0075365_10091417 Ga0075365_100914172 216
10 3300014325 Ga0163163_10834937 Ga0163163_108349372 216
11 3300041443 Ga0451789_0935306 Ga0451789_0935306_247_897 216
12 3300050492 nmdc:mga0yw44_75362_c1 nmdc:mga0yw44_75362_c1_1222_1878 216
13 3300048904 Ga0496101_0359974 Ga0496101_0359974_397_1056 217
14 3300009553 Ga0105249_10108052 Ga0105249_101080523 220
15 3300010375 Ga0105239_10454534 Ga0105239_104545342 220
16 3300011119 Ga0105246_10069559 Ga0105246_100695593 220
17 3300013105 Ga0157369_10721866 Ga0157369_107218662 220
18 3300026142 Ga0207698_10378080 Ga0207698_103780802 220
19 3300046660 Ga0495625_0119933 Ga0495625_0119933_934_1596 220
20 3300047322 Ga0495680_0152605 Ga0495680_0152605_702_1376 220
21 3300049568 Ga0501031_0006742 Ga0501031_0006742_5092_5754 220
22 3300049569 Ga0501032_0022091 Ga0501032_0022091_2035_2697 220
23 3300049570 Ga0501033_0039913 Ga0501033_0039913_1514_2176 220
24 3300049571 Ga0501034_0059273 Ga0501034_0059273_1468_2130 220
25 3300049572 Ga0501036_0002429 Ga0501036_0002429_3464_4126 220
26 3300049573 Ga0501037_0001974 Ga0501037_0001974_6293_6955 220
27 3300049573 Ga0501037_0153102 Ga0501037_0153102_283_945 220
28 3300049574 Ga0501038_0013929 Ga0501038_0013929_5210_5872 220
29 3300049575 Ga0501039_0016960 Ga0501039_0016960_1215_1877 220
30 3300049576 Ga0501040_0011494 Ga0501040_0011494_2876_3538 220
31 3300049577 Ga0501041_0003738 Ga0501041_0003738_3555_4217 220
32 3300049578 Ga0501042_0102903 Ga0501042_0102903_50_712 220
33 3300049579 Ga0501043_0000682 Ga0501043_0000682_21806_22468 220
34 3300049580 Ga0501046_0077015 Ga0501046_0077015_50_712 220
35 3300049581 Ga0501047_0000947 Ga0501047_0000947_21719_22381 220
36 3300049581 Ga0501047_0001051 Ga0501047_0001051_10174_10836 220
37 3300049582 Ga0501048_0093600 Ga0501048_0093600_72_734 220
38 3300049583 Ga0501067_0001352 Ga0501067_0001352_5210_5872 220
39 3300049584 Ga0501068_0019476 Ga0501068_0019476_2066_2728 220
40 3300049585 Ga0501069_0020661 Ga0501069_0020661_961_1623 220
41 3300049586 Ga0501070_0012956 Ga0501070_0012956_1330_1992 220
42 3300049587 Ga0501071_0001160 Ga0501071_0001160_4959_5621 220
43 3300049588 Ga0501072_0010818 Ga0501072_0010818_4937_5599 220
44 3300049589 Ga0501073_0039289 Ga0501073_0039289_2414_3076 220
45 3300049590 Ga0501074_0031695 Ga0501074_0031695_2414_3076 220
46 3300049592 Ga0501076_0003071 Ga0501076_0003071_4663_5325 220
47 3300049593 Ga0501077_0041741 Ga0501077_0041741_1647_2309 220
48 3300049741 Ga0501079_0006331 Ga0501079_0006331_2040_2702 220
49 3300049742 Ga0501080_0032629 Ga0501080_0032629_2460_3122 220
50 3300049744 Ga0501083_0003083 Ga0501083_0003083_9605_10267 220
51 3300049822 Ga0501035_0013124 Ga0501035_0013124_1330_1992 220
52 3300049823 Ga0501044_0012529 Ga0501044_0012529_1458_2120 220
53 3300049823 Ga0501044_0463456 Ga0501044_0463456_405_1067 220
54 3300049824 Ga0501045_0004098 Ga0501045_0004098_2499_3161 220
55 3300053085 Ga0495619_0176446 Ga0495619_0176446_561_1232 220
56 3300054114 Ga0501084_0013503 Ga0501084_0013503_2876_3538 220
57 3300060353 Ga0501082_0027263 Ga0501082_0027263_1514_2176 220
58 3300061734 Ga0530510_0117686 Ga0530510_0117686_1231_1893 220
59 iso_pu_bacteria 2643221962 2645725371 220
60 iso_pu_bacteria 8056054917 8056058581 220
61 3300005367 Ga0070667_100248145 Ga0070667_1002481452 221
62 3300046690 Ga0495624_0091791 Ga0495624_0091791_505_1176 221
63 3300047317 Ga0495604_0244591 Ga0495604_0244591_113_784 221
64 3300047321 Ga0495676_0339906 Ga0495676_0339906_299_970 221
65 3300048917 Ga0496114_0242584 Ga0496114_0242584_515_1186 221
66 3300048929 Ga0496126_0021449 Ga0496126_0021449_1601_2284 221
67 3300053730 Ga0500645_000075 Ga0500645_000075_54853_55536 221
68 iso_pu_bacteria 2508501039 2508674091 221
69 iso_pu_bacteria 2547132424 2548697922 221
70 iso_pu_bacteria 2551306166 2552109590 221
71 iso_pu_bacteria 2643221601 2644017958 221
72 iso_pu_bacteria 2643221631 2644180754 221
73 iso_pu_bacteria 2643221692 2644513071 221
74 iso_pu_bacteria 2687453737 2689960108 221
75 iso_pu_bacteria 2738543005 2739203234 221
76 iso_pu_bacteria 2738543011 2739239694 221
77 iso_pu_bacteria 2889300758 2889300929 221
78 iso_pu_bacteria 2904770941 2904771012 221
79 iso_pu_bacteria 2908811453 2908815055 221
80 iso_pu_bacteria 2919420072 2919424461 221
81 iso_pu_bacteria 2919432681 2919436854 221
82 iso_pu_bacteria 2919713450 2919715902 221
83 iso_pu_bacteria 2928142448 2928142542 221
84 iso_pu_bacteria 2935390628 2935391360 221
85 iso_pu_bacteria 2939743619 2939744443 221
86 iso_pu_bacteria 3001119090 3001122199 221
87 iso_pu_bacteria 3006425503 3006428512 221
88 iso_pu_bacteria 3006486233 3006486746 221
89 iso_pu_bacteria 8054472261 8054474342 221
90 3300001990 JGI24737J22298_10054851 JGI24737J22298_100548512 222
91 3300003320 rootH2_10078173 rootH2_100781733 222
92 3300003320 rootH2_10154633 rootH2_101546333 222
93 3300003322 rootL2_10064882 rootL2_100648822 222
94 3300003323 rootH1_10000259 rootH1_100002594 222
95 3300005327 Ga0070658_10273613 Ga0070658_102736132 222
96 3300005327 Ga0070658_10315635 Ga0070658_103156352 222
97 3300005328 Ga0070676_10090925 Ga0070676_100909252 222
98 3300005328 Ga0070676_10284737 Ga0070676_102847371 222
99 3300005329 Ga0070683_100349820 Ga0070683_1003498202 222
100 3300005329 Ga0070683_101152881 Ga0070683_1011528811 222
101 3300005337 Ga0070682_100138817 Ga0070682_1001388173 222
102 3300005337 Ga0070682_100399074 Ga0070682_1003990741 222
103 3300005338 Ga0068868_100280413 Ga0068868_1002804131 222
104 3300005338 Ga0068868_100329627 Ga0068868_1003296271 222
105 3300005338 Ga0068868_100555549 Ga0068868_1005555492 222
106 3300005344 Ga0070661_100119207 Ga0070661_1001192074 222
107 3300005345 Ga0070692_10205648 Ga0070692_102056481 222
108 3300005347 Ga0070668_100502719 Ga0070668_1005027192 222
109 3300005354 Ga0070675_100094864 Ga0070675_1000948645 222
110 3300005355 Ga0070671_100000412 Ga0070671_10000041226 222
111 3300005355 Ga0070671_100141970 Ga0070671_1001419702 222
112 3300005356 Ga0070674_100250145 Ga0070674_1002501452 222
113 3300005356 Ga0070674_100443684 Ga0070674_1004436841 222
114 3300005356 Ga0070674_100470224 Ga0070674_1004702242 222
115 3300005366 Ga0070659_100024271 Ga0070659_1000242713 222
116 3300005366 Ga0070659_100275667 Ga0070659_1002756672 222
117 3300005367 Ga0070667_100000063 Ga0070667_10000006382 222
118 3300005367 Ga0070667_100066231 Ga0070667_1000662312 222
119 3300005367 Ga0070667_100343974 Ga0070667_1003439741 222
120 3300005435 Ga0070714_100003703 Ga0070714_1000037036 222
121 3300005435 Ga0070714_100202674 Ga0070714_1002026742 222
122 3300005435 Ga0070714_100333367 Ga0070714_1003333672 222
123 3300005436 Ga0070713_100065734 Ga0070713_1000657342 222
124 3300005437 Ga0070710_10292177 Ga0070710_102921772 222
125 3300005437 Ga0070710_10340458 Ga0070710_103404581 222
126 3300005455 Ga0070663_100134044 Ga0070663_1001340443 222
127 3300005455 Ga0070663_100165363 Ga0070663_1001653632 222
128 3300005455 Ga0070663_100313277 Ga0070663_1003132771 222
129 3300005457 Ga0070662_100200027 Ga0070662_1002000272 222
130 3300005458 Ga0070681_10313913 Ga0070681_103139132 222
131 3300005459 Ga0068867_100093300 Ga0068867_1000933003 222
132 3300005459 Ga0068867_100393851 Ga0068867_1003938511 222
133 3300005466 Ga0070685_10065308 Ga0070685_100653085 222
134 3300005471 Ga0070698_100059764 Ga0070698_1000597644 222
135 3300005535 Ga0070684_100308254 Ga0070684_1003082542 222
136 3300005539 Ga0068853_100091299 Ga0068853_1000912992 222
137 3300005543 Ga0070672_100372170 Ga0070672_1003721702 222
138 3300005546 Ga0070696_100006628 Ga0070696_1000066287 222
139 3300005548 Ga0070665_100099962 Ga0070665_1000999622 222
140 3300005548 Ga0070665_100349692 Ga0070665_1003496922 222
141 3300005563 Ga0068855_100102803 Ga0068855_1001028033 222
142 3300005564 Ga0070664_100042117 Ga0070664_1000421172 222
143 3300005577 Ga0068857_100268183 Ga0068857_1002681833 222
144 3300005578 Ga0068854_100048597 Ga0068854_1000485973 222
145 3300005614 Ga0068856_100498678 Ga0068856_1004986782 222
146 3300005615 Ga0070702_100172161 Ga0070702_1001721612 222
147 3300005616 Ga0068852_100634905 Ga0068852_1006349052 222
148 3300005617 Ga0068859_100000777 Ga0068859_10000077729 222
149 3300005617 Ga0068859_100000944 Ga0068859_1000009443 222
150 3300005617 Ga0068859_100682276 Ga0068859_1006822762 222
151 3300005618 Ga0068864_100661970 Ga0068864_1006619702 222
152 3300005718 Ga0068866_10499300 Ga0068866_104993001 222
153 3300005834 Ga0068851_10052054 Ga0068851_100520542 222
154 3300005834 Ga0068851_10095684 Ga0068851_100956842 222
155 3300005840 Ga0068870_10356105 Ga0068870_103561052 222
156 3300005841 Ga0068863_100000159 Ga0068863_10000015927 222
157 3300005841 Ga0068863_100000648 Ga0068863_1000006487 222
158 3300005841 Ga0068863_100007113 Ga0068863_1000071139 222
159 3300005841 Ga0068863_100035863 Ga0068863_1000358632 222
160 3300005842 Ga0068858_100009162 Ga0068858_1000091626 222
161 3300005842 Ga0068858_100051255 Ga0068858_1000512554 222
162 3300005842 Ga0068858_100056127 Ga0068858_1000561272 222
163 3300005843 Ga0068860_100000065 Ga0068860_10000006581 222
164 3300005844 Ga0068862_100000028 Ga0068862_100000028105 222
165 3300005844 Ga0068862_100583839 Ga0068862_1005838392 222
166 3300005983 Ga0081540_1005051 Ga0081540_10050514 222
167 3300006028 Ga0070717_10205762 Ga0070717_102057622 222
168 3300006028 Ga0070717_10234957 Ga0070717_102349572 222
169 3300006028 Ga0070717_10543512 Ga0070717_105435122 222
170 3300006051 Ga0075364_10130295 Ga0075364_101302952 222
171 3300006353 Ga0075370_10117767 Ga0075370_101177672 222
172 3300006844 Ga0075428_100006048 Ga0075428_1000060488 222
173 3300006844 Ga0075428_100293330 Ga0075428_1002933302 222
174 3300006846 Ga0075430_100019963 Ga0075430_1000199633 222
175 3300006931 Ga0097620_100000777 Ga0097620_10000077729 222
176 3300006931 Ga0097620_100000944 Ga0097620_1000009443 222
177 3300006931 Ga0097620_100016788 Ga0097620_1000167884 222
178 3300006931 Ga0097620_100682290 Ga0097620_1006822901 222
179 3300007265 Ga0099794_10239930 Ga0099794_102399301 222
180 3300009094 Ga0111539_10587084 Ga0111539_105870842 222
181 3300009094 Ga0111539_10885408 Ga0111539_108854082 222
182 3300009094 Ga0111539_11266795 Ga0111539_112667951 222
183 3300009098 Ga0105245_10172177 Ga0105245_101721774 222
184 3300009098 Ga0105245_10554059 Ga0105245_105540591 222
185 3300009101 Ga0105247_10254600 Ga0105247_102546002 222
186 3300009147 Ga0114129_10001766 Ga0114129_1000176626 222
187 3300009148 Ga0105243_10017906 Ga0105243_100179064 222
188 3300009148 Ga0105243_10998772 Ga0105243_109987721 222
189 3300009174 Ga0105241_10118131 Ga0105241_101181312 222
190 3300009176 Ga0105242_10267051 Ga0105242_102670513 222
191 3300009176 Ga0105242_10632539 Ga0105242_106325391 222
192 3300009177 Ga0105248_10050782 Ga0105248_100507826 222
193 3300009545 Ga0105237_10351936 Ga0105237_103519362 222
194 3300009545 Ga0105237_10808241 Ga0105237_108082411 222
195 3300009551 Ga0105238_10979354 Ga0105238_109793542 222
196 3300009553 Ga0105249_10080852 Ga0105249_100808523 222
197 3300009553 Ga0105249_11123445 Ga0105249_111234452 222
198 3300010375 Ga0105239_10673605 Ga0105239_106736052 222
199 3300010375 Ga0105239_11197895 Ga0105239_111978952 222
200 3300011119 Ga0105246_10526913 Ga0105246_105269132 222
201 3300013296 Ga0157374_10922242 Ga0157374_109222421 222
202 3300013296 Ga0157374_11124584 Ga0157374_111245842 222
203 3300013297 Ga0157378_10205516 Ga0157378_102055164 222
204 3300013306 Ga0163162_11193323 Ga0163162_111933232 222
205 3300013307 Ga0157372_10634128 Ga0157372_106341281 222
206 3300013308 Ga0157375_10361858 Ga0157375_103618582 222
207 3300014325 Ga0163163_10567906 Ga0163163_105679062 222
208 3300014325 Ga0163163_10744957 Ga0163163_107449572 222
209 3300014745 Ga0157377_10187800 Ga0157377_101878001 222
210 3300014968 Ga0157379_10001387 Ga0157379_1000138719 222
211 3300014968 Ga0157379_10473616 Ga0157379_104736161 222
212 3300020070 Ga0206356_11257196 Ga0206356_112571961 222
213 3300020081 Ga0206354_10127114 Ga0206354_101271142 222
214 3300020081 Ga0206354_10547656 Ga0206354_105476562 222
215 3300020081 Ga0206354_11585944 Ga0206354_115859442 222
216 3300020082 Ga0206353_11490006 Ga0206353_114900062 222
217 3300021384 Ga0213876_10140919 Ga0213876_101409192 222
218 3300022467 Ga0224712_10001633 Ga0224712_100016334 222
219 3300025321 Ga0207656_10056297 Ga0207656_100562971 222
220 3300025898 Ga0207692_10191226 Ga0207692_101912262 222
221 3300025900 Ga0207710_10000014 Ga0207710_1000001430 222
222 3300025903 Ga0207680_10083273 Ga0207680_100832732 222
223 3300025904 Ga0207647_10010162 Ga0207647_100101626 222
224 3300025904 Ga0207647_10029890 Ga0207647_100298903 222
225 3300025907 Ga0207645_10005431 Ga0207645_100054316 222
226 3300025908 Ga0207643_10022720 Ga0207643_100227203 222
227 3300025909 Ga0207705_10511636 Ga0207705_105116362 222
228 3300025910 Ga0207684_10040070 Ga0207684_100400703 222
229 3300025911 Ga0207654_10275731 Ga0207654_102757311 222
230 3300025912 Ga0207707_10153234 Ga0207707_101532342 222
231 3300025914 Ga0207671_10201562 Ga0207671_102015622 222
232 3300025918 Ga0207662_10077997 Ga0207662_100779973 222
233 3300025919 Ga0207657_10038410 Ga0207657_100384106 222
234 3300025922 Ga0207646_10007353 Ga0207646_100073538 222
235 3300025923 Ga0207681_10008158 Ga0207681_100081584 222
236 3300025923 Ga0207681_10052825 Ga0207681_100528255 222
237 3300025924 Ga0207694_10280498 Ga0207694_102804983 222
238 3300025928 Ga0207700_10040749 Ga0207700_100407491 222
239 3300025928 Ga0207700_10759554 Ga0207700_107595541 222
240 3300025929 Ga0207664_10019741 Ga0207664_100197411 222
241 3300025929 Ga0207664_10021809 Ga0207664_100218091 222
242 3300025931 Ga0207644_10000973 Ga0207644_1000097312 222
243 3300025932 Ga0207690_10397641 Ga0207690_103976412 222
244 3300025933 Ga0207706_10028187 Ga0207706_100281873 222
245 3300025935 Ga0207709_10018663 Ga0207709_100186636 222
246 3300025941 Ga0207711_10000373 Ga0207711_100003734 222
247 3300025944 Ga0207661_10212631 Ga0207661_102126312 222
248 3300025944 Ga0207661_10442651 Ga0207661_104426512 222
249 3300025944 Ga0207661_10614303 Ga0207661_106143032 222
250 3300025944 Ga0207661_11036715 Ga0207661_110367151 222
251 3300025945 Ga0207679_10853935 Ga0207679_108539351 222
252 3300025961 Ga0207712_10000020 Ga0207712_1000002086 222
253 3300025961 Ga0207712_10156740 Ga0207712_101567402 222
254 3300025981 Ga0207640_10021935 Ga0207640_100219354 222
255 3300025986 Ga0207658_10002515 Ga0207658_100025155 222
256 3300025986 Ga0207658_10468518 Ga0207658_104685181 222
257 3300026023 Ga0207677_10362973 Ga0207677_103629732 222
258 3300026023 Ga0207677_10412387 Ga0207677_104123871 222
259 3300026023 Ga0207677_10422772 Ga0207677_104227722 222
260 3300026067 Ga0207678_10042928 Ga0207678_100429284 222
261 3300026067 Ga0207678_10209556 Ga0207678_102095562 222
262 3300026067 Ga0207678_10351524 Ga0207678_103515241 222
263 3300026078 Ga0207702_10519405 Ga0207702_105194052 222
264 3300026078 Ga0207702_10533345 Ga0207702_105333452 222
265 3300026088 Ga0207641_10000156 Ga0207641_1000015640 222
266 3300026088 Ga0207641_10006370 Ga0207641_100063702 222
267 3300026088 Ga0207641_10010166 Ga0207641_100101669 222
268 3300026088 Ga0207641_10452737 Ga0207641_104527372 222
269 3300026088 Ga0207641_10563431 Ga0207641_105634312 222
270 3300026089 Ga0207648_10028113 Ga0207648_100281133 222
271 3300026116 Ga0207674_10140376 Ga0207674_101403763 222
272 3300026116 Ga0207674_10248874 Ga0207674_102488742 222
273 3300026116 Ga0207674_10271064 Ga0207674_102710642 222
274 3300026116 Ga0207674_10273547 Ga0207674_102735473 222
275 3300026118 Ga0207675_100096500 Ga0207675_1000965001 222
276 3300026121 Ga0207683_10058309 Ga0207683_100583094 222
277 3300026121 Ga0207683_10119659 Ga0207683_101196593 222
278 3300026121 Ga0207683_10683255 Ga0207683_106832551 222
279 3300026142 Ga0207698_10174278 Ga0207698_101742782 222
280 3300026142 Ga0207698_10525772 Ga0207698_105257722 222
281 3300027907 Ga0207428_10078385 Ga0207428_100783854 222
282 3300028379 Ga0268266_10021318 Ga0268266_100213182 222
283 3300028380 Ga0268265_10000004 Ga0268265_10000004371 222
284 3300028381 Ga0268264_10000024 Ga0268264_10000024351 222
285 3300028381 Ga0268264_10127816 Ga0268264_101278164 222
286 3300028381 Ga0268264_10628197 Ga0268264_106281972 222
287 3300028563 Ga0265319_1000773 Ga0265319_10007737 222
288 3300028573 Ga0265334_10005961 Ga0265334_100059611 222
289 3300028653 Ga0265323_10005739 Ga0265323_100057391 222
290 3300028654 Ga0265322_10002763 Ga0265322_100027633 222
291 3300028800 Ga0265338_10000755 Ga0265338_1000075516 222
292 3300028800 Ga0265338_10002435 Ga0265338_1000243514 222
293 3300029957 Ga0265324_10000222 Ga0265324_1000022222 222
294 3300029957 Ga0265324_10005107 Ga0265324_100051074 222
295 3300030745 Ga0316182_1326249 Ga0316182_13262492 222
296 3300031238 Ga0265332_10001370 Ga0265332_100013704 222
297 3300031240 Ga0265320_10031179 Ga0265320_100311792 222
298 3300031241 Ga0265325_10027514 Ga0265325_100275144 222
299 3300031456 Ga0307513_10128345 Ga0307513_101283452 222
300 3300031456 Ga0307513_10297614 Ga0307513_102976142 222
301 3300031730 Ga0307516_10330947 Ga0307516_103309471 222
302 3300032002 Ga0307416_100541720 Ga0307416_1005417201 222
303 3300035092 Ga0373952_0032421 Ga0373952_0032421_465_1145 222
304 3300035112 Ga0373932_0078812 Ga0373932_0078812_101_781 222
305 3300035119 Ga0373956_0003565 Ga0373956_0003565_1747_2424 222
306 3300035725 Ga0373947_0127998 Ga0373947_0127998_602_1294 222
307 3300036647 Ga0316582_0123477 Ga0316582_0123477_527_1225 222
308 3300036712 Ga0316584_0110382 Ga0316584_0110382_763_1461 222
309 3300041443 Ga0451789_0149872 Ga0451789_0149872_73_756 222
310 3300041452 Ga0451793_0586671 Ga0451793_0586671_1158_1841 222
311 3300042007 Ga0439449_0041648 Ga0439449_0041648_901_1590 222
312 3300042437 Ga0439444_0042162 Ga0439444_0042162_176_856 222
313 3300044656 Ga0466969_0000386 Ga0466969_0000386_15478_16176 222
314 3300044656 Ga0466969_0044445 Ga0466969_0044445_522_1205 222
315 3300044683 Ga0466965_0035620 Ga0466965_0035620_1667_2350 222
316 3300044683 Ga0466965_0047415 Ga0466965_0047415_1423_2103 222
317 3300044684 Ga0466966_0106717 Ga0466966_0106717_875_1552 222
318 3300044693 Ga0466961_0015101 Ga0466961_0015101_3330_4019 222
319 3300044694 Ga0466963_0124736 Ga0466963_0124736_215_883 222
320 3300044694 Ga0466963_0187707 Ga0466963_0187707_393_1097 222
321 3300044694 Ga0466963_0405643 Ga0466963_0405643_136_834 222
322 3300044719 Ga0466971_0002410 Ga0466971_0002410_6009_6689 222
323 3300044765 Ga0466970_0149293 Ga0466970_0149293_507_1187 222
324 3300044842 Ga0466957_0014665 Ga0466957_0014665_32_754 222
325 3300044842 Ga0466957_0057863 Ga0466957_0057863_821_1501 222
326 3300044842 Ga0466957_0172952 Ga0466957_0172952_244_921 222
327 3300044842 Ga0466957_0301215 Ga0466957_0301215_253_951 222
328 3300044901 Ga0466960_0000108 Ga0466960_0000108_26408_27091 222
329 3300044901 Ga0466960_0014121 Ga0466960_0014121_2662_3342 222
330 3300045049 Ga0466959_0001180 Ga0466959_0001180_7345_8025 222
331 3300045049 Ga0466959_0224221 Ga0466959_0224221_305_985 222
332 3300045049 Ga0466959_0312294 Ga0466959_0312294_311_988 222
333 3300045049 Ga0466959_0328691 Ga0466959_0328691_66_788 222
334 3300045049 Ga0466959_0454727 Ga0466959_0454727_41_718 222
335 3300045836 Ga0466958_0114096 Ga0466958_0114096_977_1657 222
336 3300045836 Ga0466958_0117484 Ga0466958_0117484_30_707 222
337 3300045976 Ga0466967_0028784 Ga0466967_0028784_1809_2486 222
338 3300045976 Ga0466967_0085802 Ga0466967_0085802_195_872 222
339 3300045976 Ga0466967_0096688 Ga0466967_0096688_1273_1995 222
340 3300045976 Ga0466967_0215740 Ga0466967_0215740_877_1581 222
341 3300045976 Ga0466967_0278964 Ga0466967_0278964_104_781 222
342 3300046454 Ga0495592_0009158 Ga0495592_0009158_2919_3596 222
343 3300046455 Ga0495603_0029187 Ga0495603_0029187_469_1161 222
344 3300046462 Ga0495651_0100043 Ga0495651_0100043_941_1618 222
345 3300046463 Ga0495653_0067394 Ga0495653_0067394_812_1489 222
346 3300046463 Ga0495653_0128051 Ga0495653_0128051_715_1392 222
347 3300046472 Ga0495580_0174055 Ga0495580_0174055_607_1284 222
348 3300046477 Ga0495664_0008865 Ga0495664_0008865_3882_4559 222
349 3300046511 Ga0495608_0007435 Ga0495608_0007435_6016_6693 222
350 3300046516 Ga0495628_0010260 Ga0495628_0010260_2997_3677 222
351 3300046526 Ga0495666_0049966 Ga0495666_0049966_1244_1921 222
352 3300046529 Ga0495652_0001620 Ga0495652_0001620_17167_17847 222
353 3300046531 Ga0495665_0008244 Ga0495665_0008244_1603_2280 222
354 3300046533 Ga0495640_0053358 Ga0495640_0053358_289_966 222
355 3300046542 Ga0495597_0147059 Ga0495597_0147059_251_928 222
356 3300046559 Ga0495667_0056514 Ga0495667_0056514_270_947 222
357 3300046559 Ga0495667_0369029 Ga0495667_0369029_117_794 222
358 3300046642 Ga0495634_0132515 Ga0495634_0132515_801_1481 222
359 3300046642 Ga0495634_0167054 Ga0495634_0167054_310_987 222
360 3300046663 Ga0495635_0004216 Ga0495635_0004216_6062_6742 222
361 3300046675 Ga0495657_0039313 Ga0495657_0039313_941_1618 222
362 3300046678 Ga0495599_0120302 Ga0495599_0120302_558_1235 222
363 3300046679 Ga0495623_0159350 Ga0495623_0159350_108_785 222
364 3300046680 Ga0495646_0123080 Ga0495646_0123080_249_929 222
365 3300046680 Ga0495646_0236636 Ga0495646_0236636_23_700 222
366 3300046689 Ga0495613_0002970 Ga0495613_0002970_9874_10551 222
367 3300046809 Ga0495600_0038112 Ga0495600_0038112_2193_2873 222
368 3300046809 Ga0495600_0119978 Ga0495600_0119978_108_785 222
369 3300047315 Ga0495581_0088263 Ga0495581_0088263_986_1663 222
370 3300047317 Ga0495604_0016869 Ga0495604_0016869_4529_5206 222
371 3300047323 Ga0495683_0002207 Ga0495683_0002207_9723_10400 222
372 3300047444 Ga0495675_0004200 Ga0495675_0004200_6064_6741 222
373 3300047444 Ga0495675_0016253 Ga0495675_0016253_1029_1706 222
374 3300047471 Ga0495684_0049796 Ga0495684_0049796_1280_1957 222
375 3300047673 Ga0495593_0027202 Ga0495593_0027202_726_1403 222
376 3300048088 Ga0495602_0150691 Ga0495602_0150691_108_785 222
377 3300048903 Ga0496100_0077030 Ga0496100_0077030_248_937 222
378 3300048903 Ga0496100_0083631 Ga0496100_0083631_746_1426 222
379 3300048903 Ga0496100_0474858 Ga0496100_0474858_181_855 222
380 3300048904 Ga0496101_0003689 Ga0496101_0003689_767_1447 222
381 3300048904 Ga0496101_0362901 Ga0496101_0362901_387_1067 222
382 3300048905 Ga0496102_0000042 Ga0496102_0000042_103651_104331 222
383 3300048905 Ga0496102_0000164 Ga0496102_0000164_5933_6607 222
384 3300048906 Ga0496103_0000063 Ga0496103_0000063_89543_90217 222
385 3300048906 Ga0496103_0000194 Ga0496103_0000194_59898_60578 222
386 3300048907 Ga0496104_0038838 Ga0496104_0038838_3625_4305 222
387 3300048907 Ga0496104_0481239 Ga0496104_0481239_393_1085 222
388 3300048907 Ga0496104_0909601 Ga0496104_0909601_95_775 222
389 3300048908 Ga0496105_0026455 Ga0496105_0026455_421_1101 222
390 3300048910 Ga0496107_0233890 Ga0496107_0233890_608_1288 222
391 3300048910 Ga0496107_0438060 Ga0496107_0438060_142_831 222
392 3300048911 Ga0496108_0135393 Ga0496108_0135393_1163_1843 222
393 3300048912 Ga0496109_0281969 Ga0496109_0281969_289_978 222
394 3300048912 Ga0496109_0444941 Ga0496109_0444941_279_959 222
395 3300048912 Ga0496109_0567241 Ga0496109_0567241_113_793 222
396 3300048912 Ga0496109_0855132 Ga0496109_0855132_92_772 222
397 3300048913 Ga0496110_0207856 Ga0496110_0207856_84_764 222
398 3300048916 Ga0496113_0303403 Ga0496113_0303403_384_1094 222
399 3300048917 Ga0496114_0668389 Ga0496114_0668389_122_802 222
400 3300048919 Ga0496116_0024448 Ga0496116_0024448_3706_4386 222
401 3300048920 Ga0496117_0000261 Ga0496117_0000261_13204_13884 222
402 3300048921 Ga0496118_0000241 Ga0496118_0000241_95723_96403 222
403 3300048921 Ga0496118_0006546 Ga0496118_0006546_1199_1873 222
404 3300048921 Ga0496118_0161118 Ga0496118_0161118_549_1235 222
405 3300048922 Ga0496119_0000210 Ga0496119_0000210_11383_12063 222
406 3300048922 Ga0496119_0039783 Ga0496119_0039783_117_791 222
407 3300048923 Ga0496120_0019006 Ga0496120_0019006_1289_1969 222
408 3300048924 Ga0496121_0068582 Ga0496121_0068582_1116_1790 222
409 3300048924 Ga0496121_0092923 Ga0496121_0092923_376_1056 222
410 3300048926 Ga0496123_0219412 Ga0496123_0219412_62_742 222
411 3300048929 Ga0496126_0000255 Ga0496126_0000255_21882_22562 222
412 3300049568 Ga0501031_0295865 Ga0501031_0295865_139_825 222
413 3300049568 Ga0501031_0366968 Ga0501031_0366968_41_742 222
414 3300049569 Ga0501032_0019953 Ga0501032_0019953_1477_2169 222
415 3300049571 Ga0501034_0117469 Ga0501034_0117469_702_1385 222
416 3300049579 Ga0501043_0081667 Ga0501043_0081667_518_1210 222
417 3300049580 Ga0501046_0032542 Ga0501046_0032542_1560_2252 222
418 3300049581 Ga0501047_0000031 Ga0501047_0000031_40729_41433 222
419 3300049581 Ga0501047_0008300 Ga0501047_0008300_2290_2982 222
420 3300049582 Ga0501048_0000085 Ga0501048_0000085_41912_42604 222
421 3300049582 Ga0501048_0338400 Ga0501048_0338400_183_872 222
422 3300049583 Ga0501067_0042268 Ga0501067_0042268_987_1679 222
423 3300049586 Ga0501070_0020999 Ga0501070_0020999_3270_3962 222
424 3300049586 Ga0501070_0124903 Ga0501070_0124903_668_1351 222
425 3300049590 Ga0501074_0129179 Ga0501074_0129179_246_923 222
426 3300049823 Ga0501044_0046879 Ga0501044_0046879_768_1460 222
427 3300050491 nmdc:mga00v17_114444_c1 nmdc:mga00v17_114444_c1_731_1411 222
428 3300050496 nmdc:mga07m45_115896_c1 nmdc:mga07m45_115896_c1_582_1262 222
429 3300050507 nmdc:mga05p37_554887_c1 nmdc:mga05p37_554887_c1_429_1118 222
430 3300050508 nmdc:mga09592_40051_c1 nmdc:mga09592_40051_c1_2933_3622 222
431 3300050509 nmdc:mga0qj67_5984_c1 nmdc:mga0qj67_5984_c1_839_1528 222
432 3300050510 nmdc:mga06r32_97529_c1 nmdc:mga06r32_97529_c1_1350_2039 222
433 3300050511 nmdc:mga08y16_195828_c1 nmdc:mga08y16_195828_c1_1295_1990 222
434 3300050511 nmdc:mga08y16_277452_c1 nmdc:mga08y16_277452_c1_585_1286 222
435 3300053077 Ga0495601_0004422 Ga0495601_0004422_6886_7566 222
436 3300053077 Ga0495601_0037885 Ga0495601_0037885_1224_1901 222
437 3300053077 Ga0495601_0058957 Ga0495601_0058957_397_1077 222
438 3300053078 Ga0495612_0008859 Ga0495612_0008859_1798_2478 222
439 3300053083 Ga0495655_0070294 Ga0495655_0070294_114_803 222
440 3300053085 Ga0495619_0407797 Ga0495619_0407797_94_774 222
441 3300061719 Ga0466962_0084125 Ga0466962_0084125_760_1437 222
442 iso_pu_bacteria 2643221679 2644444900 222
443 iso_pu_bacteria 2751185725 2753038336 222
444 iso_pu_bacteria 2751185792 2753326847 222
445 iso_pu_bacteria 2816332119 2816423517 222
446 iso_pu_bacteria 2868088558 2868093527 222
447 iso_pu_bacteria 2956939328 2956939415 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

51

214

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i6d-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with 5-hydroxy-2,4(1h,3h)-pyrimidinedione, form vi 0.9552 3 222
8i63-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with barbituric acid, form iii 0.9317 3 222
3tr7-assembly1.cif.gz_A structure of a uracil-dna glycosylase (ung) from coxiella burnetii 0.9246 11 222
8i63-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with barbituric acid, form iii 0.9236 3 222
1eug-assembly1.cif.gz_A crystal structure of escherichia coli uracil dna glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited 0.9192 11 220
ID Description Score Start End Superfamily
3a7nA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9546 2 222 3.40.470.10
3a7nA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9464 2 222 3.40.470.10
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9117 5 222 3.40.470.10
af_Q1ZXM2_175_429_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.907 4 221 3.40.470.10
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8924 5 222 3.40.470.10
ID Description Score Start End GO Terms
AF-W1VK98-F1-model_v4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9813 88 222 GO:0004844
GO:0097510
AF-A0A251XHV8-F1-model_v4 Uracil-DNA glycosylase 0.9765 128 221 GO:0004844
GO:0097510
AF-A0A7K1A052-F1-model_v4 Uracil-DNA glycosylase (EC 3.2.2.27) 0.9731 101 222 GO:0004844
GO:0097510
AF-A0A7I8ANC8-F1-model_v4 deleted 0.9663 75 221
AF-A0A7J9YAY4-F1-model_v4 Uracil-DNA glycosylase (EC 3.2.2.27) 0.9647 1 222 GO:0004844
GO:0005737
GO:0097510

Feature Viewer

pLDDT pTM Quality
87.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map