F445927

General Info

Members Datasets Scaffolds Average Seq Length
447 266 447 139

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10000269|Ga0114129_1000026935
Length 163
Sequence VAFLDGLGADELLEHAGASLPYNPRGMSTRFHVAHLAGAKFSRRGLRGYFEYRDLGIRRATRGKVVAHVIRARPQKAPHGEWHAHDCKLQFVYVLKGWALFEYEGVGKVMMKAGSCFYQPPGIRHREIRHSKNLELIEIVAPANFKTRASPGARKSPGRRSRG

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
140 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
147 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
180 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
181 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
182 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
222 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.22
Rhizosphere 99.33
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10871890 3300005295 Bacteria 575
2 Ga0070683_100106251 3300005329 Bacteria 2647
3 Ga0070690_100000293 3300005330 Bacteria 25713
4 Ga0070690_100526752 3300005330 Bacteria 888
5 Ga0070677_10668409 3300005333 Bacteria 582
6 Ga0068869_100000080 3300005334 Bacteria 43806
7 Ga0070666_10249553 3300005335 Bacteria 1256
8 Ga0070680_100002861 3300005336 Bacteria 12815
9 Ga0070680_101008535 3300005336 Unclassified 719
10 Ga0070682_100005076 3300005337 Bacteria 7318
11 Ga0068868_100000803 3300005338 Bacteria 21290
12 Ga0070689_100278681 3300005340 Bacteria 1386
13 Ga0070691_10000051 3300005341 Bacteria 32669
14 Ga0070691_10110013 3300005341 Bacteria 1377
15 Ga0070687_100000101 3300005343 Bacteria 28605
16 Ga0070692_10083270 3300005345 Bacteria 1727
17 Ga0070692_10987393 3300005345 Bacteria 588
18 Ga0070675_100375071 3300005354 Bacteria 1265
19 Ga0070671_100311522 3300005355 Bacteria 1341
20 Ga0070674_100396903 3300005356 Bacteria 1126
21 Ga0070673_101274140 3300005364 Bacteria 690
22 Ga0070673_101713245 3300005364 Bacteria 595
23 Ga0070688_100086281 3300005365 Bacteria 2042
24 Ga0070659_100301201 3300005366 Bacteria 1337
25 Ga0070667_100419362 3300005367 Bacteria 1220
26 Ga0070701_10000203 3300005438 Bacteria 18534
27 Ga0070705_100000124 3300005440 Bacteria 44901
28 Ga0070705_100037154 3300005440 Bacteria 2745
29 Ga0070700_100001714 3300005441 Bacteria 11004
30 Ga0070694_100000042 3300005444 Bacteria 58862
31 Ga0070694_100431494 3300005444 Bacteria 1037
32 Ga0070708_100167144 3300005445 Bacteria 2052
33 Ga0070708_100178723 3300005445 Bacteria 1983
34 Ga0070708_100491176 3300005445 Bacteria 1158
35 Ga0070662_100323336 3300005457 Bacteria 1258
36 Ga0070681_10190119 3300005458 Bacteria 1973
37 Ga0068867_100000903 3300005459 Bacteria 20137
38 Ga0070706_100866480 3300005467 Bacteria 835
39 Ga0070707_100211720 3300005468 Bacteria 1889
40 Ga0070707_100553429 3300005468 Bacteria 1113
41 Ga0070699_100103253 3300005518 Bacteria 2500
42 Ga0070699_100208535 3300005518 Bacteria 1739
43 Ga0070697_100009219 3300005536 Bacteria 7711
44 Ga0070697_100034249 3300005536 Bacteria 4094
45 Ga0070697_100368479 3300005536 Bacteria 1243
46 Ga0068853_100021480 3300005539 Bacteria 5384
47 Ga0070686_100002277 3300005544 Bacteria 10599
48 Ga0070686_100027538 3300005544 Bacteria 3440
49 Ga0070695_100000429 3300005545 Bacteria 21745
50 Ga0070695_100004981 3300005545 Bacteria 7831
51 Ga0070695_100059437 3300005545 Bacteria 2475
52 Ga0070696_100000134 3300005546 Bacteria 40135
53 Ga0070696_100221702 3300005546 Bacteria 1419
54 Ga0070696_100452169 3300005546 Bacteria 1014
55 Ga0070693_100001012 3300005547 Bacteria 12541
56 Ga0070693_100130599 3300005547 Bacteria 1570
57 Ga0070704_100000424 3300005549 Bacteria 19654
58 Ga0070704_100149181 3300005549 Bacteria 1836
59 Ga0068855_100246401 3300005563 Bacteria 1994
60 Ga0068854_100003551 3300005578 Bacteria 9751
61 Ga0068854_100397918 3300005578 Bacteria 1139
62 Ga0068856_100017573 3300005614 Bacteria 6930
63 Ga0068856_101915938 3300005614 Bacteria 604
64 Ga0070702_100000313 3300005615 Bacteria 16795
65 Ga0068859_100001948 3300005617 Bacteria 21041
66 Ga0068859_100036991 3300005617 Bacteria 4900
67 Ga0068864_100182394 3300005618 Bacteria 1920
68 Ga0068864_100269461 3300005618 Bacteria 1586
69 Ga0068866_10000088 3300005718 Bacteria 38021
70 Ga0068861_100000378 3300005719 Bacteria 25713
71 Ga0068851_10733488 3300005834 Bacteria 610
72 Ga0068870_10129322 3300005840 Bacteria 1465
73 Ga0068863_100317946 3300005841 Bacteria 1512
74 Ga0068858_100005112 3300005842 Bacteria 12858
75 Ga0068860_100001078 3300005843 Bacteria 30066
76 Ga0068860_101003516 3300005843 Bacteria 853
77 Ga0068862_100113228 3300005844 Bacteria 2383
78 Ga0081539_10026137 3300005985 Bacteria 3737
79 Ga0097621_100002948 3300006237 Bacteria 11695
80 Ga0097621_100019839 3300006237 Bacteria 5170
81 Ga0068871_100002591 3300006358 Bacteria 12334
82 Ga0068871_100004129 3300006358 Bacteria 10043
83 Ga0075428_100001073 3300006844 Bacteria 29071
84 Ga0075428_100068497 3300006844 Bacteria 3882
85 Ga0075428_100391450 3300006844 Bacteria 1490
86 Ga0075430_100041998 3300006846 Bacteria 3867
87 Ga0075430_100369543 3300006846 Bacteria 1184
88 Ga0075431_100705443 3300006847 Bacteria 986
89 Ga0075433_10001631 3300006852 Bacteria 16653
90 Ga0075433_10009551 3300006852 Bacteria 7755
91 Ga0075433_10135846 3300006852 Bacteria 2186
92 Ga0075433_10136212 3300006852 Bacteria 2183
93 Ga0075433_10353369 3300006852 Bacteria 1299
94 Ga0075433_10518286 3300006852 Bacteria 1049
95 Ga0075434_100001366 3300006871 Bacteria 20483
96 Ga0075434_100003932 3300006871 Bacteria 13315
97 Ga0075434_100209362 3300006871 Bacteria 1970
98 Ga0075434_101161667 3300006871 Bacteria 784
99 Ga0075434_101317673 3300006871 Bacteria 733
100 Ga0075429_100000434 3300006880 Bacteria 31200
101 Ga0075429_100048252 3300006880 Bacteria 3703
102 Ga0068865_100000589 3300006881 Bacteria 20385
103 Ga0075436_100008052 3300006914 Bacteria 7216
104 Ga0075436_100013970 3300006914 Bacteria 5494
105 Ga0075436_100022977 3300006914 Bacteria 4284
106 Ga0075436_100283554 3300006914 Bacteria 1185
107 Ga0097620_100001948 3300006931 Bacteria 21041
108 Ga0097620_100036991 3300006931 Bacteria 4900
109 Ga0075435_100002163 3300007076 Bacteria 12949
110 Ga0075435_100012367 3300007076 Bacteria 6316
111 Ga0075435_100037797 3300007076 Bacteria 3846
112 Ga0075435_100278060 3300007076 Bacteria 1429
113 Ga0075435_100392054 3300007076 Bacteria 1193
114 Ga0075435_100673553 3300007076 Bacteria 898
115 Ga0099794_10053759 3300007265 Bacteria 1942
116 Ga0105250_10147047 3300009092 Bacteria 979
117 Ga0111539_10227778 3300009094 Bacteria 2171
118 Ga0111539_10350794 3300009094 Bacteria 1717
119 Ga0111539_10416268 3300009094 Bacteria 1565
120 Ga0111539_10822571 3300009094 Bacteria 1081
121 Ga0105245_10000978 3300009098 Bacteria 26082
122 Ga0114129_10000269 3300009147 Bacteria 58970
123 Ga0114129_10107505 3300009147 Bacteria 3853
124 Ga0114129_10139312 3300009147 Bacteria 3327
125 Ga0114129_10392767 3300009147 Bacteria 1829
126 Ga0114129_10445126 3300009147 Bacteria 1700
127 Ga0114129_10712519 3300009147 Bacteria 1289
128 Ga0105243_10012318 3300009148 Bacteria 6468
129 Ga0105243_11626966 3300009148 Bacteria 673
130 Ga0105241_10022185 3300009174 Bacteria 4700
131 Ga0105242_10000436 3300009176 Bacteria 33306
132 Ga0105242_10023767 3300009176 Bacteria 4834
133 Ga0105242_12426019 3300009176 Bacteria 572
134 Ga0105248_10268584 3300009177 Bacteria 1921
135 Ga0105248_10881442 3300009177 Bacteria 1010
136 Ga0105238_10974037 3300009551 Bacteria 868
137 Ga0105249_10029271 3300009553 Bacteria 4973
138 Ga0105249_10072985 3300009553 Bacteria 3174
139 Ga0105239_10122928 3300010375 Bacteria 2884
140 Ga0157378_10000939 3300013297 Bacteria 26779
141 Ga0163162_10513782 3300013306 Bacteria 1328
142 Ga0157380_10012874 3300014326 Bacteria 6080
143 Ga0157380_10122260 3300014326 Bacteria 2207
144 Ga0157380_11359201 3300014326 Bacteria 759
145 Ga0157376_10155188 3300014969 Bacteria 2069
146 Ga0207653_10001122 3300025885 Bacteria 8768
147 Ga0207682_10376114 3300025893 Bacteria 670
148 Ga0207642_10001716 3300025899 Bacteria 6764
149 Ga0207688_10018210 3300025901 Bacteria 3823
150 Ga0207680_10745599 3300025903 Bacteria 702
151 Ga0207647_10070944 3300025904 Bacteria 2103
152 Ga0207685_10179148 3300025905 Bacteria 981
153 Ga0207684_11269323 3300025910 Bacteria 607
154 Ga0207707_10130925 3300025912 Bacteria 2194
155 Ga0207663_10293045 3300025916 Bacteria 1213
156 Ga0207660_10001445 3300025917 Bacteria 15937
157 Ga0207660_10301860 3300025917 Bacteria 1275
158 Ga0207660_10416133 3300025917 Bacteria 1084
159 Ga0207662_10000062 3300025918 Bacteria 46768
160 Ga0207652_10308174 3300025921 Bacteria 1429
161 Ga0207646_11154563 3300025922 Bacteria 680
162 Ga0207694_10659279 3300025924 Bacteria 882
163 Ga0207659_10254469 3300025926 Bacteria 1426
164 Ga0207687_10005809 3300025927 Bacteria 8165
165 Ga0207687_10030053 3300025927 Bacteria 3660
166 Ga0207644_10180040 3300025931 Bacteria 1656
167 Ga0207706_10358879 3300025933 Bacteria 1266
168 Ga0207686_10008776 3300025934 Bacteria 5461
169 Ga0207686_10039516 3300025934 Bacteria 2863
170 Ga0207709_10001006 3300025935 Bacteria 20894
171 Ga0207670_10002788 3300025936 Bacteria 9210
172 Ga0207704_10007241 3300025938 Bacteria 5226
173 Ga0207689_10000884 3300025942 Bacteria 28807
174 Ga0207689_10213351 3300025942 Bacteria 1595
175 Ga0207667_10017964 3300025949 Bacteria 7947
176 Ga0207712_10036607 3300025961 Bacteria 3344
177 Ga0207668_10739325 3300025972 Bacteria 867
178 Ga0207640_10010256 3300025981 Bacteria 5272
179 Ga0207658_10245662 3300025986 Bacteria 1519
180 Ga0207677_10002316 3300026023 Bacteria 9999
181 Ga0207703_10004853 3300026035 Bacteria 10942
182 Ga0207703_10031051 3300026035 Bacteria 4223
183 Ga0207639_10329693 3300026041 Bacteria 1358
184 Ga0207708_10000355 3300026075 Bacteria 35955
185 Ga0207708_11266935 3300026075 Unclassified 645
186 Ga0207702_10052798 3300026078 Bacteria 3441
187 Ga0207702_10301828 3300026078 Bacteria 1520
188 Ga0207641_10452967 3300026088 Bacteria 1240
189 Ga0207648_10000229 3300026089 Bacteria 59998
190 Ga0207676_10049841 3300026095 Bacteria 3261
191 Ga0207675_100000297 3300026118 Bacteria 47904
192 Ga0209969_1008268 3300027360 Bacteria 1474
193 Ga0209967_1005892 3300027364 Bacteria 1656
194 Ga0209967_1018592 3300027364 Bacteria 1007
195 Ga0209981_1000708 3300027378 Bacteria 4228
196 Ga0209981_1030945 3300027378 Bacteria 785
197 Ga0210000_1002385 3300027462 Bacteria 2673
198 Ga0209995_1001772 3300027471 Bacteria 3359
199 Ga0209968_1013531 3300027526 Bacteria 1281
200 Ga0209968_1015813 3300027526 Bacteria 1196
201 Ga0209999_1004799 3300027543 Bacteria 2431
202 Ga0209982_1052307 3300027552 Bacteria 659
203 Ga0209971_1004410 3300027682 Bacteria 3343
204 Ga0209966_1005157 3300027695 Bacteria 2236
205 Ga0209998_10018468 3300027717 Bacteria 1481
206 Ga0209974_10213778 3300027876 Bacteria 716
207 Ga0207428_10000539 3300027907 Bacteria 45217
208 Ga0268265_10008674 3300028380 Bacteria 6872
209 Ga0268265_10678017 3300028380 Bacteria 993
210 Ga0268265_10775786 3300028380 Bacteria 932
211 Ga0268264_10001494 3300028381 Bacteria 21812
212 Ga0307408_100963914 3300031548 Bacteria 784
213 Ga0307409_102299789 3300031995 Bacteria 568
214 Ga0307416_100397192 3300032002 Bacteria 1415
215 Ga0307416_103064487 3300032002 Bacteria 559
216 Ga0307411_10683002 3300032005 Bacteria 892
217 Ga0316583_10009924 3300032133 Bacteria 3430
218 Ga0373948_0004516 3300034817 Bacteria 2207
219 Ga0373950_0134014 3300034818 Bacteria 557
220 Ga0373958_0034076 3300034819 Bacteria 1013
221 Ga0373926_0010220 3300035083 Bacteria 3142
222 Ga0373929_0012783 3300035085 Bacteria 1600
223 Ga0373934_0052268 3300035086 Bacteria 1620
224 Ga0373940_0003063 3300035088 Bacteria 3356
225 Ga0373944_0004949 3300035089 Bacteria 3494
226 Ga0373949_0005508 3300035090 Bacteria 2824
227 Ga0373949_0027746 3300035090 Bacteria 1333
228 Ga0373952_0011130 3300035092 Bacteria 1750
229 Ga0373952_0037504 3300035092 Bacteria 1106
230 Ga0373923_0225383 3300035111 Bacteria 872
231 Ga0373932_0002659 3300035112 Bacteria 4453
232 Ga0373932_0022848 3300035112 Bacteria 1666
233 Ga0373936_0028461 3300035113 Bacteria 2196
234 Ga0373936_0090683 3300035113 Unclassified 1281
235 Ga0373939_0001840 3300035114 Bacteria 5102
236 Ga0373941_0028491 3300035115 Bacteria 1640
237 Ga0373941_0488886 3300035115 Bacteria 522
238 Ga0373945_0015354 3300035116 Bacteria 2575
239 Ga0373953_0049597 3300035117 Bacteria 1694
240 Ga0373953_0163491 3300035117 Bacteria 957
241 Ga0373954_0000109 3300035118 Bacteria 27796
242 Ga0373956_0116489 3300035119 Bacteria 1246
243 Ga0373956_0418143 3300035119 Bacteria 640
244 Ga0373957_0349386 3300035120 Bacteria 631
245 Ga0373943_0006067 3300035170 Bacteria 5426
246 Ga0373946_0032547 3300035171 Bacteria 2094
247 Ga0373946_0316515 3300035171 Unclassified 774
248 Ga0373955_0076998 3300035172 Bacteria 1877
249 Ga0373942_0035652 3300035207 Bacteria 1335
250 Ga0373961_0005129 3300035241 Bacteria 3150
251 Ga0373962_0122048 3300035242 Bacteria 832
252 Ga0373924_0376113 3300035410 Bacteria 634
253 Ga0373931_0000415 3300035691 Bacteria 17438
254 Ga0373931_0001677 3300035691 Bacteria 9590
255 Ga0373931_0010888 3300035691 Bacteria 4379
256 Ga0373931_0979344 3300035691 Unclassified 571
257 Ga0373935_0020755 3300035692 Bacteria 4016
258 Ga0373935_0920871 3300035692 Bacteria 648
259 Ga0373935_1044201 3300035692 Unclassified 607
260 Ga0373927_0051941 3300035695 Bacteria 2651
261 Ga0373933_0001756 3300035724 Bacteria 12578
262 Ga0373933_0040754 3300035724 Bacteria 2737
263 Ga0373933_0432101 3300035724 Bacteria 860
264 Ga0373947_0007724 3300035725 Bacteria 6215
265 Ga0373947_0124605 3300035725 Bacteria 1639
266 Ga0373937_0001384 3300036401 Bacteria 20270
267 Ga0373937_1270921 3300036401 Bacteria 684
268 Ga0373925_0059402 3300037068 Bacteria 2868
269 Ga0373925_0455831 3300037068 Bacteria 1047
270 Ga0436360_0806681 3300039438 Bacteria 2166
271 Ga0439436_0082844 3300041404 Bacteria 893
272 Ga0451807_2429998 3300041486 Bacteria 1602
273 Ga0451839_0021116 3300041496 Bacteria 542
274 Ga0451853_0599676 3300041512 Bacteria 1957
275 Ga0439441_000509 3300042001 Bacteria 4259
276 Ga0439441_000588 3300042001 Bacteria 4078
277 Ga0439443_002660 3300042003 Unclassified 2162
278 Ga0439443_008974 3300042003 Bacteria 1424
279 Ga0439463_049204 3300042016 Bacteria 1075
280 Ga0450912_018813 3300042116 Unclassified 655
281 Ga0439435_0017060 3300042436 Unclassified 1830
282 Ga0439435_0071840 3300042436 Bacteria 1025
283 Ga0439444_0006533 3300042437 Bacteria 1764
284 Ga0439460_0000454 3300042461 Bacteria 8823
285 Ga0451577_0007752 3300042876 Bacteria 10523
286 Ga0451576_0023730 3300045051 Bacteria 6636
287 Ga0451576_0054992 3300045051 Bacteria 4165
288 Ga0451576_0145113 3300045051 Bacteria 2474
289 Ga0451576_1080505 3300045051 Bacteria 840
290 Ga0451576_1496533 3300045051 Bacteria 701
291 Ga0451576_1989466 3300045051 Bacteria 599
292 Ga0495603_0000491 3300046455 Bacteria 21884
293 Ga0495629_0238240 3300046459 Bacteria 1253
294 Ga0495580_0003893 3300046472 Bacteria 12617
295 Ga0495582_0011283 3300046473 Bacteria 4924
296 Ga0495662_0003940 3300046476 Bacteria 7485
297 Ga0495628_0101743 3300046516 Bacteria 2217
298 Ga0495630_0074262 3300046517 Bacteria 2561
299 Ga0495630_0263987 3300046517 Bacteria 1315
300 Ga0495630_0265852 3300046517 Bacteria 1310
301 Ga0495666_0021725 3300046526 Bacteria 3176
302 Ga0495642_0017690 3300046528 Bacteria 2785
303 Ga0495652_0158798 3300046529 Bacteria 1758
304 Ga0495665_0008919 3300046531 Bacteria 5442
305 Ga0495640_0059465 3300046533 Bacteria 2603
306 Ga0495586_0005331 3300046535 Bacteria 6877
307 Ga0495586_0071777 3300046535 Bacteria 1893
308 Ga0495609_0235763 3300046538 Bacteria 757
309 Ga0495621_0245682 3300046539 Bacteria 730
310 Ga0495621_0299692 3300046539 Bacteria 666
311 Ga0495667_0384084 3300046559 Bacteria 885
312 Ga0495635_0160476 3300046663 Bacteria 1530
313 Ga0495635_0190780 3300046663 Bacteria 1391
314 Ga0495588_0010027 3300046674 Bacteria 4392
315 Ga0495599_0005056 3300046678 Bacteria 7849
316 Ga0495623_0179326 3300046679 Bacteria 1232
317 Ga0495623_0374363 3300046679 Bacteria 771
318 Ga0495647_0000988 3300046681 Bacteria 8642
319 Ga0495647_0142442 3300046681 Bacteria 1023
320 Ga0495658_0397835 3300046683 Bacteria 878
321 Ga0495669_0030786 3300046684 Bacteria 2355
322 Ga0495624_0130156 3300046690 Bacteria 1543
323 Ga0495600_0794810 3300046809 Bacteria 564
324 Ga0495581_0019844 3300047315 Bacteria 3903
325 Ga0495581_0070319 3300047315 Bacteria 2024
326 Ga0495604_0199310 3300047317 Bacteria 1390
327 Ga0495674_0097528 3300047319 Bacteria 2503
328 Ga0495674_0315603 3300047319 Bacteria 1274
329 Ga0495676_0424164 3300047321 Bacteria 880
330 Ga0495680_0055835 3300047322 Bacteria 3061
331 Ga0495675_0081115 3300047444 Bacteria 2043
332 Ga0495675_0780112 3300047444 Bacteria 530
333 Ga0495684_0387195 3300047471 Bacteria 985
334 Ga0495684_0721017 3300047471 Bacteria 659
335 Ga0495593_0029421 3300047673 Bacteria 3012
336 Ga0495615_0252727 3300048090 Bacteria 559
337 Ga0501300_038621 3300049523 Bacteria 716
338 Ga0501031_0263453 3300049568 Bacteria 1120
339 Ga0501032_0174413 3300049569 Bacteria 1409
340 Ga0501033_0240577 3300049570 Bacteria 1284
341 Ga0501033_0496666 3300049570 Bacteria 844
342 Ga0501036_0018626 3300049572 Bacteria 5821
343 Ga0501036_0219961 3300049572 Bacteria 1595
344 Ga0501037_0120348 3300049573 Bacteria 1888
345 Ga0501037_0238012 3300049573 Bacteria 1276
346 Ga0501038_0120570 3300049574 Bacteria 2163
347 Ga0501038_0380071 3300049574 Bacteria 1096
348 Ga0501038_0414287 3300049574 Bacteria 1040
349 Ga0501039_0008272 3300049575 Bacteria 7929
350 Ga0501039_0082370 3300049575 Bacteria 2505
351 Ga0501040_0016522 3300049576 Bacteria 4887
352 Ga0501040_0041838 3300049576 Bacteria 3121
353 Ga0501040_0092152 3300049576 Bacteria 2107
354 Ga0501040_0112677 3300049576 Bacteria 1903
355 Ga0501041_0026045 3300049577 Bacteria 3515
356 Ga0501041_0154254 3300049577 Bacteria 1435
357 Ga0501041_0178726 3300049577 Bacteria 1328
358 Ga0501041_0205404 3300049577 Bacteria 1235
359 Ga0501042_0000949 3300049578 Bacteria 16341
360 Ga0501042_0012747 3300049578 Bacteria 5704
361 Ga0501042_0492673 3300049578 Bacteria 890
362 Ga0501043_0592899 3300049579 Bacteria 819
363 Ga0501046_0042891 3300049580 Bacteria 3605
364 Ga0501046_0512271 3300049580 Bacteria 858
365 Ga0501048_0016791 3300049582 Bacteria 5396
366 Ga0501048_0058633 3300049582 Bacteria 2729
367 Ga0501048_0440376 3300049582 Bacteria 933
368 Ga0501048_0626395 3300049582 Bacteria 772
369 Ga0501068_0124108 3300049584 Bacteria 1612
370 Ga0501068_0145490 3300049584 Bacteria 1487
371 Ga0501070_0572144 3300049586 Bacteria 903
372 Ga0501071_0023619 3300049587 Bacteria 4294
373 Ga0501071_0105289 3300049587 Bacteria 2082
374 Ga0501071_0805723 3300049587 Bacteria 724
375 Ga0501072_0015596 3300049588 Bacteria 5824
376 Ga0501072_0057297 3300049588 Bacteria 3070
377 Ga0501072_0122802 3300049588 Bacteria 2069
378 Ga0501073_1136576 3300049589 Bacteria 537
379 Ga0501075_0012032 3300049591 Bacteria 6142
380 Ga0501075_0020527 3300049591 Bacteria 4808
381 Ga0501075_0020948 3300049591 Bacteria 4764
382 Ga0501076_0005337 3300049592 Bacteria 9229
383 Ga0501076_0014111 3300049592 Bacteria 6007
384 Ga0501076_0131035 3300049592 Bacteria 2033
385 Ga0501076_0268079 3300049592 Bacteria 1398
386 Ga0501076_1407627 3300049592 Unclassified 573
387 Ga0501077_0096053 3300049593 Bacteria 1878
388 Ga0501079_0005656 3300049741 Bacteria 9329
389 Ga0501079_0032011 3300049741 Bacteria 4042
390 Ga0501080_0066852 3300049742 Bacteria 3343
391 Ga0501080_0135802 3300049742 Bacteria 2276
392 Ga0501081_0016507 3300049743 Bacteria 4882
393 Ga0501081_0026910 3300049743 Bacteria 3881
394 Ga0501081_0029235 3300049743 Bacteria 3723
395 Ga0501083_0183492 3300049744 Bacteria 1366
396 Ga0501273_021299 3300049770 Bacteria 879
397 Ga0501035_0113079 3300049822 Bacteria 2378
398 Ga0501035_0356857 3300049822 Bacteria 1222
399 Ga0501044_1369125 3300049823 Bacteria 573
400 Ga0501045_0058209 3300049824 Bacteria 2829
401 Ga0501045_0105501 3300049824 Bacteria 2088
402 Ga0501045_0198202 3300049824 Bacteria 1496
403 nmdc:mga05p37_1022055_c1 3300050507 Bacteria 875
404 nmdc:mga05p37_1066_c1 3300050507 Bacteria 31380
405 nmdc:mga05p37_356454_c1 3300050507 Bacteria 1721
406 nmdc:mga09592_125091_c1 3300050508 Bacteria 2210
407 nmdc:mga09592_216586_c1 3300050508 Bacteria 1659
408 nmdc:mga09592_313_c1 3300050508 Bacteria 35329
409 nmdc:mga0qj67_171165_c1 3300050509 Bacteria 1763
410 nmdc:mga0qj67_232850_c1 3300050509 Bacteria 1495
411 nmdc:mga0qj67_26974_c1 3300050509 Bacteria 4449
412 nmdc:mga0qj67_4781_c1 3300050509 Bacteria 9845
413 nmdc:mga06r32_1088410_c1 3300050510 Bacteria 749
414 nmdc:mga06r32_296571_c1 3300050510 Bacteria 1603
415 nmdc:mga08y16_172347_c1 3300050511 Bacteria 2248
416 nmdc:mga08y16_2461_c1 3300050511 Bacteria 19008
417 nmdc:mga08y16_70160_c1 3300050511 Bacteria 3652
418 nmdc:mga08y16_78136_c1 3300050511 Bacteria 3450
419 nmdc:mga08y16_98775_c1 3300050511 Bacteria 3040
420 nmdc:mga0n895_1596880_c1 3300050512 Bacteria 617
421 nmdc:mga0n895_4760_c1 3300050512 Bacteria 11220
422 nmdc:mga0n895_919178_c1 3300050512 Bacteria 860
423 nmdc:mga0rr50_1144188_c1 3300050513 Bacteria 662
424 nmdc:mga0rr50_176156_c1 3300050513 Bacteria 1746
425 nmdc:mga0rr50_852_c1 3300050513 Bacteria 16412
426 nmdc:mga0rr50_912729_c1 3300050513 Bacteria 749
427 nmdc:mga08x19_22547_c1 3300050514 Bacteria 3900
428 nmdc:mga08x19_61269_c1 3300050514 Bacteria 2438
429 nmdc:mga08x19_61505_c1 3300050514 Bacteria 2434
430 nmdc:mga08x19_76535_c1 3300050514 Bacteria 2190
431 nmdc:mga0a205_103253_c1 3300050515 Bacteria 2749
432 nmdc:mga0a205_338_c1 3300050515 Bacteria 35225
433 nmdc:mga0a205_73885_c1 3300050515 Bacteria 3294
434 nmdc:mga0a205_902009_c1 3300050515 Bacteria 731
435 nmdc:mga0a205_93096_c1 3300050515 Bacteria 2912
436 Ga0495601_0182521 3300053077 Bacteria 1372
437 Ga0495595_0108559 3300053084 Bacteria 1344
438 Ga0495619_0150116 3300053085 Bacteria 1608
439 Ga0501084_0090880 3300054114 Bacteria 2563
440 Ga0501084_0094251 3300054114 Bacteria 2514
441 Ga0501084_0231583 3300054114 Bacteria 1559
442 Ga0501084_1652152 3300054114 Bacteria 535
443 Ga0501082_0003025 3300060353 Bacteria 14696
444 Ga0501082_0182472 3300060353 Bacteria 1825
445 Ga0501082_0269767 3300060353 Bacteria 1481
446 Ga0530510_0180680 3300061734 Bacteria 1564
447 Ga0530510_0306663 3300061734 Bacteria 1188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_101008535 Ga0070680_1010085351 124
2 3300005444 Ga0070694_100431494 Ga0070694_1004314942 124
3 3300009094 Ga0111539_10416268 Ga0111539_104162682 124
4 3300050511 nmdc:mga08y16_70160_c1 nmdc:mga08y16_70160_c1_1079_1516 124
5 3300009177 Ga0105248_10881442 Ga0105248_108814422 125
6 3300042001 Ga0439441_000509 Ga0439441_000509_2162_2590 127
7 3300042003 Ga0439443_002660 Ga0439443_002660_1280_1711 127
8 3300042116 Ga0450912_018813 Ga0450912_018813_82_510 127
9 3300042436 Ga0439435_0017060 Ga0439435_0017060_100_528 127
10 3300042461 Ga0439460_0000454 Ga0439460_0000454_84_512 127
11 3300049592 Ga0501076_1407627 Ga0501076_1407627_77_505 127
12 3300006852 Ga0075433_10353369 Ga0075433_103533692 128
13 3300006914 Ga0075436_100013970 Ga0075436_1000139709 128
14 3300007076 Ga0075435_100392054 Ga0075435_1003920543 128
15 3300009147 Ga0114129_10392767 Ga0114129_103927673 128
16 3300027695 Ga0209966_1005157 Ga0209966_10051572 132
17 3300005329 Ga0070683_100106251 Ga0070683_1001062512 133
18 3300005440 Ga0070705_100037154 Ga0070705_1000371544 133
19 3300005445 Ga0070708_100167144 Ga0070708_1001671445 133
20 3300005536 Ga0070697_100034249 Ga0070697_1000342493 133
21 3300005545 Ga0070695_100004981 Ga0070695_10000498113 133
22 3300049574 Ga0501038_0380071 Ga0501038_0380071_40_444 133
23 3300050514 nmdc:mga08x19_22547_c1 nmdc:mga08x19_22547_c1_1389_1790 133
24 3300005546 Ga0070696_100452169 Ga0070696_1004521691 134
25 3300005549 Ga0070704_100149181 Ga0070704_1001491813 134
26 3300005518 Ga0070699_100103253 Ga0070699_1001032533 135
27 3300027360 Ga0209969_1008268 Ga0209969_10082682 135
28 3300027364 Ga0209967_1005892 Ga0209967_10058922 135
29 3300027378 Ga0209981_1000708 Ga0209981_10007084 135
30 3300027462 Ga0210000_1002385 Ga0210000_10023854 135
31 3300027471 Ga0209995_1001772 Ga0209995_10017724 135
32 3300027526 Ga0209968_1013531 Ga0209968_10135312 135
33 3300027543 Ga0209999_1004799 Ga0209999_10047993 135
34 3300027552 Ga0209982_1052307 Ga0209982_10523072 135
35 3300035113 Ga0373936_0090683 Ga0373936_0090683_778_1185 135
36 3300035170 Ga0373943_0006067 Ga0373943_0006067_2134_2541 135
37 3300035171 Ga0373946_0316515 Ga0373946_0316515_243_650 135
38 3300035692 Ga0373935_1044201 Ga0373935_1044201_71_478 135
39 3300035695 Ga0373927_0051941 Ga0373927_0051941_2138_2545 135
40 3300035725 Ga0373947_0007724 Ga0373947_0007724_2973_3380 135
41 3300037068 Ga0373925_0059402 Ga0373925_0059402_2143_2550 135
42 3300047321 Ga0495676_0424164 Ga0495676_0424164_307_714 135
43 3300049578 Ga0501042_0492673 Ga0501042_0492673_21_428 135
44 3300054114 Ga0501084_1652152 Ga0501084_1652152_33_446 135
45 3300005330 Ga0070690_100526752 Ga0070690_1005267522 136
46 3300005341 Ga0070691_10110013 Ga0070691_101100132 136
47 3300005345 Ga0070692_10987393 Ga0070692_109873932 136
48 3300005364 Ga0070673_101274140 Ga0070673_1012741401 136
49 3300005364 Ga0070673_101713245 Ga0070673_1017132451 136
50 3300005445 Ga0070708_100491176 Ga0070708_1004911762 136
51 3300005545 Ga0070695_100059437 Ga0070695_1000594373 136
52 3300005546 Ga0070696_100221702 Ga0070696_1002217021 136
53 3300005547 Ga0070693_100130599 Ga0070693_1001305992 136
54 3300005578 Ga0068854_100397918 Ga0068854_1003979182 136
55 3300005614 Ga0068856_101915938 Ga0068856_1019159381 136
56 3300005617 Ga0068859_100036991 Ga0068859_1000369914 136
57 3300005834 Ga0068851_10733488 Ga0068851_107334882 136
58 3300006237 Ga0097621_100019839 Ga0097621_1000198393 136
59 3300006358 Ga0068871_100004129 Ga0068871_1000041296 136
60 3300006844 Ga0075428_100068497 Ga0075428_1000684974 136
61 3300006847 Ga0075431_100705443 Ga0075431_1007054432 136
62 3300006880 Ga0075429_100048252 Ga0075429_1000482523 136
63 3300006931 Ga0097620_100036991 Ga0097620_1000369914 136
64 3300009147 Ga0114129_10107505 Ga0114129_101075055 136
65 3300009148 Ga0105243_11626966 Ga0105243_116269661 136
66 3300009177 Ga0105248_10268584 Ga0105248_102685843 136
67 3300009551 Ga0105238_10974037 Ga0105238_109740372 136
68 3300014969 Ga0157376_10155188 Ga0157376_101551882 136
69 3300025916 Ga0207663_10293045 Ga0207663_102930453 136
70 3300025924 Ga0207694_10659279 Ga0207694_106592792 136
71 3300031995 Ga0307409_102299789 Ga0307409_1022997892 136
72 3300032002 Ga0307416_103064487 Ga0307416_1030644872 136
73 3300032133 Ga0316583_10009924 Ga0316583_100099242 136
74 3300035086 Ga0373934_0052268 Ga0373934_0052268_1182_1595 136
75 3300035117 Ga0373953_0049597 Ga0373953_0049597_848_1261 136
76 3300035118 Ga0373954_0000109 Ga0373954_0000109_20891_21304 136
77 3300035119 Ga0373956_0116489 Ga0373956_0116489_785_1198 136
78 3300035120 Ga0373957_0349386 Ga0373957_0349386_16_429 136
79 3300035172 Ga0373955_0076998 Ga0373955_0076998_683_1096 136
80 3300035691 Ga0373931_0010888 Ga0373931_0010888_482_895 136
81 3300035692 Ga0373935_0920871 Ga0373935_0920871_191_604 136
82 3300035724 Ga0373933_0001756 Ga0373933_0001756_3456_3869 136
83 3300035724 Ga0373933_0040754 Ga0373933_0040754_2271_2684 136
84 3300036401 Ga0373937_0001384 Ga0373937_0001384_11933_12346 136
85 3300041486 Ga0451807_2429998 Ga0451807_2429998_885_1301 136
86 3300041512 Ga0451853_0599676 Ga0451853_0599676_116_532 136
87 3300046529 Ga0495652_0158798 Ga0495652_0158798_131_544 136
88 3300046559 Ga0495667_0384084 Ga0495667_0384084_115_528 136
89 3300046663 Ga0495635_0160476 Ga0495635_0160476_270_683 136
90 3300046679 Ga0495623_0179326 Ga0495623_0179326_195_608 136
91 3300046679 Ga0495623_0374363 Ga0495623_0374363_40_453 136
92 3300047322 Ga0495680_0055835 Ga0495680_0055835_1700_2113 136
93 3300047444 Ga0495675_0081115 Ga0495675_0081115_171_584 136
94 3300047444 Ga0495675_0780112 Ga0495675_0780112_102_515 136
95 3300047471 Ga0495684_0721017 Ga0495684_0721017_65_478 136
96 3300047673 Ga0495593_0029421 Ga0495593_0029421_2455_2868 136
97 3300048090 Ga0495615_0252727 Ga0495615_0252727_133_549 136
98 3300049570 Ga0501033_0496666 Ga0501033_0496666_174_596 136
99 3300049572 Ga0501036_0018626 Ga0501036_0018626_3933_4355 136
100 3300049573 Ga0501037_0120348 Ga0501037_0120348_1303_1725 136
101 3300049574 Ga0501038_0414287 Ga0501038_0414287_345_767 136
102 3300049575 Ga0501039_0008272 Ga0501039_0008272_3689_4111 136
103 3300049576 Ga0501040_0041838 Ga0501040_0041838_1795_2217 136
104 3300049577 Ga0501041_0026045 Ga0501041_0026045_1340_1762 136
105 3300049578 Ga0501042_0000949 Ga0501042_0000949_9415_9837 136
106 3300049580 Ga0501046_0512271 Ga0501046_0512271_105_527 136
107 3300049582 Ga0501048_0016791 Ga0501048_0016791_1116_1538 136
108 3300049584 Ga0501068_0145490 Ga0501068_0145490_798_1220 136
109 3300049588 Ga0501072_0057297 Ga0501072_0057297_2451_2873 136
110 3300049589 Ga0501073_1136576 Ga0501073_1136576_107_526 136
111 3300049591 Ga0501075_0012032 Ga0501075_0012032_3058_3480 136
112 3300049592 Ga0501076_0014111 Ga0501076_0014111_629_1051 136
113 3300049593 Ga0501077_0096053 Ga0501077_0096053_1388_1810 136
114 3300049741 Ga0501079_0005656 Ga0501079_0005656_8882_9304 136
115 3300049742 Ga0501080_0066852 Ga0501080_0066852_1350_1772 136
116 3300049742 Ga0501080_0135802 Ga0501080_0135802_1643_2065 136
117 3300049743 Ga0501081_0016507 Ga0501081_0016507_3432_3854 136
118 3300049744 Ga0501083_0183492 Ga0501083_0183492_719_1141 136
119 3300049770 Ga0501273_021299 Ga0501273_021299_240_665 136
120 3300049822 Ga0501035_0113079 Ga0501035_0113079_717_1139 136
121 3300049824 Ga0501045_0058209 Ga0501045_0058209_798_1220 136
122 3300050507 nmdc:mga05p37_356454_c1 nmdc:mga05p37_356454_c1_172_594 136
123 3300050508 nmdc:mga09592_125091_c1 nmdc:mga09592_125091_c1_573_995 136
124 3300053084 Ga0495595_0108559 Ga0495595_0108559_701_1114 136
125 3300053085 Ga0495619_0150116 Ga0495619_0150116_50_463 136
126 3300054114 Ga0501084_0090880 Ga0501084_0090880_1469_1891 136
127 3300060353 Ga0501082_0003025 Ga0501082_0003025_12508_12930 136
128 3300061734 Ga0530510_0180680 Ga0530510_0180680_798_1220 136
129 3300005330 Ga0070690_100000293 Ga0070690_10000029314 137
130 3300005334 Ga0068869_100000080 Ga0068869_10000008017 137
131 3300005335 Ga0070666_10249553 Ga0070666_102495532 137
132 3300005336 Ga0070680_100002861 Ga0070680_1000028612 137
133 3300005337 Ga0070682_100005076 Ga0070682_1000050766 137
134 3300005338 Ga0068868_100000803 Ga0068868_10000080317 137
135 3300005340 Ga0070689_100278681 Ga0070689_1002786813 137
136 3300005341 Ga0070691_10000051 Ga0070691_1000005134 137
137 3300005343 Ga0070687_100000101 Ga0070687_10000010116 137
138 3300005345 Ga0070692_10083270 Ga0070692_100832702 137
139 3300005354 Ga0070675_100375071 Ga0070675_1003750712 137
140 3300005355 Ga0070671_100311522 Ga0070671_1003115222 137
141 3300005356 Ga0070674_100396903 Ga0070674_1003969032 137
142 3300005365 Ga0070688_100086281 Ga0070688_1000862812 137
143 3300005366 Ga0070659_100301201 Ga0070659_1003012013 137
144 3300005367 Ga0070667_100419362 Ga0070667_1004193621 137
145 3300005438 Ga0070701_10000203 Ga0070701_1000020312 137
146 3300005440 Ga0070705_100000124 Ga0070705_10000012436 137
147 3300005441 Ga0070700_100001714 Ga0070700_1000017142 137
148 3300005444 Ga0070694_100000042 Ga0070694_10000004226 137
149 3300005445 Ga0070708_100178723 Ga0070708_1001787233 137
150 3300005457 Ga0070662_100323336 Ga0070662_1003233362 137
151 3300005458 Ga0070681_10190119 Ga0070681_101901194 137
152 3300005459 Ga0068867_100000903 Ga0068867_1000009039 137
153 3300005468 Ga0070707_100211720 Ga0070707_1002117202 137
154 3300005518 Ga0070699_100208535 Ga0070699_1002085352 137
155 3300005536 Ga0070697_100368479 Ga0070697_1003684792 137
156 3300005539 Ga0068853_100021480 Ga0068853_1000214802 137
157 3300005544 Ga0070686_100002277 Ga0070686_10000227714 137
158 3300005545 Ga0070695_100000429 Ga0070695_10000042914 137
159 3300005546 Ga0070696_100000134 Ga0070696_10000013416 137
160 3300005547 Ga0070693_100001012 Ga0070693_1000010122 137
161 3300005549 Ga0070704_100000424 Ga0070704_10000042410 137
162 3300005563 Ga0068855_100246401 Ga0068855_1002464013 137
163 3300005578 Ga0068854_100003551 Ga0068854_1000035512 137
164 3300005614 Ga0068856_100017573 Ga0068856_1000175732 137
165 3300005615 Ga0070702_100000313 Ga0070702_1000003137 137
166 3300005617 Ga0068859_100001948 Ga0068859_10000194810 137
167 3300005618 Ga0068864_100269461 Ga0068864_1002694614 137
168 3300005718 Ga0068866_10000088 Ga0068866_1000008826 137
169 3300005719 Ga0068861_100000378 Ga0068861_10000037814 137
170 3300005840 Ga0068870_10129322 Ga0068870_101293223 137
171 3300005841 Ga0068863_100317946 Ga0068863_1003179463 137
172 3300005842 Ga0068858_100005112 Ga0068858_1000051123 137
173 3300005843 Ga0068860_100001078 Ga0068860_10000107840 137
174 3300005843 Ga0068860_101003516 Ga0068860_1010035161 137
175 3300005844 Ga0068862_100113228 Ga0068862_1001132284 137
176 3300006237 Ga0097621_100002948 Ga0097621_1000029482 137
177 3300006358 Ga0068871_100002591 Ga0068871_10000259115 137
178 3300006844 Ga0075428_100001073 Ga0075428_10000107314 137
179 3300006844 Ga0075428_100391450 Ga0075428_1003914502 137
180 3300006846 Ga0075430_100041998 Ga0075430_1000419984 137
181 3300006846 Ga0075430_100369543 Ga0075430_1003695432 137
182 3300006852 Ga0075433_10001631 Ga0075433_100016319 137
183 3300006852 Ga0075433_10518286 Ga0075433_105182862 137
184 3300006871 Ga0075434_100001366 Ga0075434_1000013664 137
185 3300006871 Ga0075434_100209362 Ga0075434_1002093621 137
186 3300006871 Ga0075434_101317673 Ga0075434_1013176732 137
187 3300006880 Ga0075429_100000434 Ga0075429_10000043411 137
188 3300006881 Ga0068865_100000589 Ga0068865_10000058917 137
189 3300006914 Ga0075436_100008052 Ga0075436_1000080522 137
190 3300006914 Ga0075436_100022977 Ga0075436_1000229773 137
191 3300006914 Ga0075436_100283554 Ga0075436_1002835543 137
192 3300006931 Ga0097620_100001948 Ga0097620_10000194810 137
193 3300007076 Ga0075435_100012367 Ga0075435_1000123677 137
194 3300007076 Ga0075435_100037797 Ga0075435_1000377972 137
195 3300007076 Ga0075435_100673553 Ga0075435_1006735532 137
196 3300009092 Ga0105250_10147047 Ga0105250_101470472 137
197 3300009094 Ga0111539_10227778 Ga0111539_102277782 137
198 3300009094 Ga0111539_10350794 Ga0111539_103507943 137
199 3300009098 Ga0105245_10000978 Ga0105245_1000097815 137
200 3300009147 Ga0114129_10000269 Ga0114129_1000026935 137
201 3300009148 Ga0105243_10012318 Ga0105243_100123188 137
202 3300009174 Ga0105241_10022185 Ga0105241_100221853 137
203 3300009176 Ga0105242_10000436 Ga0105242_1000043626 137
204 3300009176 Ga0105242_12426019 Ga0105242_124260192 137
205 3300009553 Ga0105249_10029271 Ga0105249_100292713 137
206 3300010375 Ga0105239_10122928 Ga0105239_101229282 137
207 3300013297 Ga0157378_10000939 Ga0157378_1000093914 137
208 3300013306 Ga0163162_10513782 Ga0163162_105137822 137
209 3300014326 Ga0157380_10012874 Ga0157380_100128744 137
210 3300025885 Ga0207653_10001122 Ga0207653_100011223 137
211 3300025899 Ga0207642_10001716 Ga0207642_100017166 137
212 3300025901 Ga0207688_10018210 Ga0207688_100182104 137
213 3300025903 Ga0207680_10745599 Ga0207680_107455992 137
214 3300025904 Ga0207647_10070944 Ga0207647_100709444 137
215 3300025912 Ga0207707_10130925 Ga0207707_101309254 137
216 3300025917 Ga0207660_10001445 Ga0207660_1000144513 137
217 3300025918 Ga0207662_10000062 Ga0207662_1000006235 137
218 3300025921 Ga0207652_10308174 Ga0207652_103081742 137
219 3300025926 Ga0207659_10254469 Ga0207659_102544692 137
220 3300025927 Ga0207687_10005809 Ga0207687_100058093 137
221 3300025931 Ga0207644_10180040 Ga0207644_101800403 137
222 3300025933 Ga0207706_10358879 Ga0207706_103588792 137
223 3300025934 Ga0207686_10008776 Ga0207686_100087768 137
224 3300025935 Ga0207709_10001006 Ga0207709_100010067 137
225 3300025936 Ga0207670_10002788 Ga0207670_1000278810 137
226 3300025938 Ga0207704_10007241 Ga0207704_100072416 137
227 3300025942 Ga0207689_10000884 Ga0207689_100008843 137
228 3300025942 Ga0207689_10213351 Ga0207689_102133512 137
229 3300025949 Ga0207667_10017964 Ga0207667_100179648 137
230 3300025961 Ga0207712_10036607 Ga0207712_100366075 137
231 3300025981 Ga0207640_10010256 Ga0207640_100102568 137
232 3300025986 Ga0207658_10245662 Ga0207658_102456621 137
233 3300026023 Ga0207677_10002316 Ga0207677_100023166 137
234 3300026035 Ga0207703_10004853 Ga0207703_1000485311 137
235 3300026035 Ga0207703_10031051 Ga0207703_100310513 137
236 3300026041 Ga0207639_10329693 Ga0207639_103296931 137
237 3300026075 Ga0207708_10000355 Ga0207708_1000035515 137
238 3300026075 Ga0207708_11266935 Ga0207708_112669352 137
239 3300026078 Ga0207702_10052798 Ga0207702_100527984 137
240 3300026078 Ga0207702_10301828 Ga0207702_103018282 137
241 3300026088 Ga0207641_10452967 Ga0207641_104529672 137
242 3300026089 Ga0207648_10000229 Ga0207648_1000022942 137
243 3300026095 Ga0207676_10049841 Ga0207676_100498413 137
244 3300026118 Ga0207675_100000297 Ga0207675_10000029736 137
245 3300027907 Ga0207428_10000539 Ga0207428_1000053936 137
246 3300028380 Ga0268265_10008674 Ga0268265_100086743 137
247 3300028380 Ga0268265_10775786 Ga0268265_107757862 137
248 3300028381 Ga0268264_10001494 Ga0268264_1000149417 137
249 3300032002 Ga0307416_100397192 Ga0307416_1003971922 137
250 3300032005 Ga0307411_10683002 Ga0307411_106830022 137
251 3300034817 Ga0373948_0004516 Ga0373948_0004516_90_503 137
252 3300034818 Ga0373950_0134014 Ga0373950_0134014_72_485 137
253 3300034819 Ga0373958_0034076 Ga0373958_0034076_70_483 137
254 3300035083 Ga0373926_0010220 Ga0373926_0010220_884_1297 137
255 3300035085 Ga0373929_0012783 Ga0373929_0012783_658_1071 137
256 3300035088 Ga0373940_0003063 Ga0373940_0003063_1408_1821 137
257 3300035089 Ga0373944_0004949 Ga0373944_0004949_1413_1826 137
258 3300035090 Ga0373949_0005508 Ga0373949_0005508_652_1065 137
259 3300035090 Ga0373949_0027746 Ga0373949_0027746_316_729 137
260 3300035092 Ga0373952_0011130 Ga0373952_0011130_930_1343 137
261 3300035092 Ga0373952_0037504 Ga0373952_0037504_275_688 137
262 3300035112 Ga0373932_0002659 Ga0373932_0002659_1353_1766 137
263 3300035112 Ga0373932_0022848 Ga0373932_0022848_528_941 137
264 3300035113 Ga0373936_0028461 Ga0373936_0028461_1234_1647 137
265 3300035114 Ga0373939_0001840 Ga0373939_0001840_652_1065 137
266 3300035115 Ga0373941_0028491 Ga0373941_0028491_722_1135 137
267 3300035116 Ga0373945_0015354 Ga0373945_0015354_550_963 137
268 3300035119 Ga0373956_0418143 Ga0373956_0418143_195_611 137
269 3300035171 Ga0373946_0032547 Ga0373946_0032547_1557_1970 137
270 3300035207 Ga0373942_0035652 Ga0373942_0035652_720_1133 137
271 3300035241 Ga0373961_0005129 Ga0373961_0005129_2696_3109 137
272 3300035242 Ga0373962_0122048 Ga0373962_0122048_296_709 137
273 3300035410 Ga0373924_0376113 Ga0373924_0376113_145_561 137
274 3300035691 Ga0373931_0000415 Ga0373931_0000415_9180_9593 137
275 3300035691 Ga0373931_0001677 Ga0373931_0001677_2894_3307 137
276 3300035691 Ga0373931_0979344 Ga0373931_0979344_89_502 137
277 3300035692 Ga0373935_0020755 Ga0373935_0020755_735_1148 137
278 3300035725 Ga0373947_0124605 Ga0373947_0124605_514_927 137
279 3300036401 Ga0373937_1270921 Ga0373937_1270921_238_654 137
280 3300037068 Ga0373925_0455831 Ga0373925_0455831_530_943 137
281 3300042003 Ga0439443_008974 Ga0439443_008974_98_511 137
282 3300042876 Ga0451577_0007752 Ga0451577_0007752_3652_4065 137
283 3300045051 Ga0451576_0023730 Ga0451576_0023730_3634_4047 137
284 3300045051 Ga0451576_0054992 Ga0451576_0054992_3149_3562 137
285 3300045051 Ga0451576_0145113 Ga0451576_0145113_1558_1971 137
286 3300045051 Ga0451576_1496533 Ga0451576_1496533_196_609 137
287 3300046455 Ga0495603_0000491 Ga0495603_0000491_14443_14856 137
288 3300046472 Ga0495580_0003893 Ga0495580_0003893_10967_11380 137
289 3300046473 Ga0495582_0011283 Ga0495582_0011283_2399_2812 137
290 3300046517 Ga0495630_0263987 Ga0495630_0263987_386_802 137
291 3300046517 Ga0495630_0265852 Ga0495630_0265852_64_555 137
292 3300046526 Ga0495666_0021725 Ga0495666_0021725_2641_3054 137
293 3300046531 Ga0495665_0008919 Ga0495665_0008919_2549_2962 137
294 3300046535 Ga0495586_0005331 Ga0495586_0005331_1006_1419 137
295 3300046539 Ga0495621_0299692 Ga0495621_0299692_128_541 137
296 3300046674 Ga0495588_0010027 Ga0495588_0010027_1746_2159 137
297 3300046681 Ga0495647_0000988 Ga0495647_0000988_1200_1613 137
298 3300046683 Ga0495658_0397835 Ga0495658_0397835_214_627 137
299 3300047315 Ga0495581_0019844 Ga0495581_0019844_1389_1802 137
300 3300047317 Ga0495604_0199310 Ga0495604_0199310_714_1130 137
301 3300049523 Ga0501300_038621 Ga0501300_038621_276_701 137
302 3300049572 Ga0501036_0219961 Ga0501036_0219961_796_1209 137
303 3300049576 Ga0501040_0092152 Ga0501040_0092152_1258_1671 137
304 3300049577 Ga0501041_0154254 Ga0501041_0154254_318_731 137
305 3300049579 Ga0501043_0592899 Ga0501043_0592899_119_532 137
306 3300049580 Ga0501046_0042891 Ga0501046_0042891_2345_2758 137
307 3300049582 Ga0501048_0440376 Ga0501048_0440376_286_699 137
308 3300049584 Ga0501068_0124108 Ga0501068_0124108_755_1168 137
309 3300049586 Ga0501070_0572144 Ga0501070_0572144_12_425 137
310 3300049587 Ga0501071_0023619 Ga0501071_0023619_625_1038 137
311 3300049587 Ga0501071_0105289 Ga0501071_0105289_1104_1529 137
312 3300049588 Ga0501072_0122802 Ga0501072_0122802_1240_1665 137
313 3300049591 Ga0501075_0020527 Ga0501075_0020527_1776_2201 137
314 3300049591 Ga0501075_0020948 Ga0501075_0020948_2244_2657 137
315 3300049592 Ga0501076_0131035 Ga0501076_0131035_1434_1859 137
316 3300049592 Ga0501076_0268079 Ga0501076_0268079_483_896 137
317 3300049741 Ga0501079_0032011 Ga0501079_0032011_882_1307 137
318 3300049743 Ga0501081_0026910 Ga0501081_0026910_883_1296 137
319 3300049824 Ga0501045_0198202 Ga0501045_0198202_99_512 137
320 3300050507 nmdc:mga05p37_1066_c1 nmdc:mga05p37_1066_c1_3991_4404 137
321 3300050508 nmdc:mga09592_313_c1 nmdc:mga09592_313_c1_2930_3343 137
322 3300050509 nmdc:mga0qj67_171165_c1 nmdc:mga0qj67_171165_c1_38_451 137
323 3300050509 nmdc:mga0qj67_4781_c1 nmdc:mga0qj67_4781_c1_5417_5842 137
324 3300050510 nmdc:mga06r32_296571_c1 nmdc:mga06r32_296571_c1_30_443 137
325 3300050511 nmdc:mga08y16_2461_c1 nmdc:mga08y16_2461_c1_15818_16231 137
326 3300050511 nmdc:mga08y16_78136_c1 nmdc:mga08y16_78136_c1_1548_1961 137
327 3300050512 nmdc:mga0n895_1596880_c1 nmdc:mga0n895_1596880_c1_82_495 137
328 3300050512 nmdc:mga0n895_4760_c1 nmdc:mga0n895_4760_c1_4697_5110 137
329 3300050513 nmdc:mga0rr50_1144188_c1 nmdc:mga0rr50_1144188_c1_213_626 137
330 3300050513 nmdc:mga0rr50_176156_c1 nmdc:mga0rr50_176156_c1_581_994 137
331 3300050514 nmdc:mga08x19_61269_c1 nmdc:mga08x19_61269_c1_1339_1752 137
332 3300050514 nmdc:mga08x19_61505_c1 nmdc:mga08x19_61505_c1_580_993 137
333 3300050514 nmdc:mga08x19_76535_c1 nmdc:mga08x19_76535_c1_1341_1754 137
334 3300050515 nmdc:mga0a205_338_c1 nmdc:mga0a205_338_c1_16132_16545 137
335 3300050515 nmdc:mga0a205_93096_c1 nmdc:mga0a205_93096_c1_466_879 137
336 3300054114 Ga0501084_0231583 Ga0501084_0231583_555_968 137
337 3300060353 Ga0501082_0269767 Ga0501082_0269767_483_896 137
338 3300061734 Ga0530510_0306663 Ga0530510_0306663_420_845 137
339 3300005468 Ga0070707_100553429 Ga0070707_1005534292 138
340 3300005985 Ga0081539_10026137 Ga0081539_100261374 138
341 3300006852 Ga0075433_10009551 Ga0075433_100095514 138
342 3300006871 Ga0075434_101161667 Ga0075434_1011616672 138
343 3300031548 Ga0307408_100963914 Ga0307408_1009639141 138
344 3300035115 Ga0373941_0488886 Ga0373941_0488886_73_504 138
345 3300039438 Ga0436360_0806681 Ga0436360_0806681_253_681 138
346 3300045051 Ga0451576_1989466 Ga0451576_1989466_146_562 138
347 3300046528 Ga0495642_0017690 Ga0495642_0017690_2116_2532 138
348 3300046539 Ga0495621_0245682 Ga0495621_0245682_78_494 138
349 3300046684 Ga0495669_0030786 Ga0495669_0030786_642_1058 138
350 3300050507 nmdc:mga05p37_1022055_c1 nmdc:mga05p37_1022055_c1_377_793 138
351 3300050512 nmdc:mga0n895_919178_c1 nmdc:mga0n895_919178_c1_334_750 138
352 3300050515 nmdc:mga0a205_73885_c1 nmdc:mga0a205_73885_c1_335_751 138
353 3300005295 Ga0065707_10871890 Ga0065707_108718902 139
354 3300005333 Ga0070677_10668409 Ga0070677_106684092 139
355 3300005467 Ga0070706_100866480 Ga0070706_1008664802 139
356 3300005536 Ga0070697_100009219 Ga0070697_1000092196 139
357 3300005544 Ga0070686_100027538 Ga0070686_1000275382 139
358 3300005618 Ga0068864_100182394 Ga0068864_1001823942 139
359 3300006852 Ga0075433_10135846 Ga0075433_101358462 139
360 3300006852 Ga0075433_10136212 Ga0075433_101362123 139
361 3300006871 Ga0075434_100003932 Ga0075434_10000393214 139
362 3300007076 Ga0075435_100002163 Ga0075435_1000021638 139
363 3300007076 Ga0075435_100278060 Ga0075435_1002780602 139
364 3300007265 Ga0099794_10053759 Ga0099794_100537593 139
365 3300009094 Ga0111539_10822571 Ga0111539_108225712 139
366 3300009147 Ga0114129_10139312 Ga0114129_101393123 139
367 3300009147 Ga0114129_10445126 Ga0114129_104451261 139
368 3300009147 Ga0114129_10712519 Ga0114129_107125192 139
369 3300009176 Ga0105242_10023767 Ga0105242_100237675 139
370 3300009553 Ga0105249_10072985 Ga0105249_100729854 139
371 3300014326 Ga0157380_10122260 Ga0157380_101222604 139
372 3300014326 Ga0157380_11359201 Ga0157380_113592012 139
373 3300025893 Ga0207682_10376114 Ga0207682_103761141 139
374 3300025905 Ga0207685_10179148 Ga0207685_101791482 139
375 3300025910 Ga0207684_11269323 Ga0207684_112693232 139
376 3300025917 Ga0207660_10301860 Ga0207660_103018602 139
377 3300025917 Ga0207660_10416133 Ga0207660_104161333 139
378 3300025922 Ga0207646_11154563 Ga0207646_111545632 139
379 3300025927 Ga0207687_10030053 Ga0207687_100300536 139
380 3300025934 Ga0207686_10039516 Ga0207686_100395162 139
381 3300025972 Ga0207668_10739325 Ga0207668_107393252 139
382 3300027364 Ga0209967_1018592 Ga0209967_10185921 139
383 3300027378 Ga0209981_1030945 Ga0209981_10309452 139
384 3300027526 Ga0209968_1015813 Ga0209968_10158132 139
385 3300027682 Ga0209971_1004410 Ga0209971_10044102 139
386 3300027717 Ga0209998_10018468 Ga0209998_100184683 139
387 3300027876 Ga0209974_10213778 Ga0209974_102137782 139
388 3300028380 Ga0268265_10678017 Ga0268265_106780172 139
389 3300035111 Ga0373923_0225383 Ga0373923_0225383_139_573 139
390 3300035117 Ga0373953_0163491 Ga0373953_0163491_255_677 139
391 3300035724 Ga0373933_0432101 Ga0373933_0432101_314_736 139
392 3300041404 Ga0439436_0082844 Ga0439436_0082844_368_802 139
393 3300041496 Ga0451839_0021116 Ga0451839_0021116_54_488 139
394 3300042001 Ga0439441_000588 Ga0439441_000588_198_632 139
395 3300042016 Ga0439463_049204 Ga0439463_049204_421_855 139
396 3300042436 Ga0439435_0071840 Ga0439435_0071840_381_815 139
397 3300042437 Ga0439444_0006533 Ga0439444_0006533_48_482 139
398 3300045051 Ga0451576_1080505 Ga0451576_1080505_390_809 139
399 3300046459 Ga0495629_0238240 Ga0495629_0238240_800_1234 139
400 3300046476 Ga0495662_0003940 Ga0495662_0003940_551_985 139
401 3300046516 Ga0495628_0101743 Ga0495628_0101743_1435_1869 139
402 3300046517 Ga0495630_0074262 Ga0495630_0074262_1426_1860 139
403 3300046533 Ga0495640_0059465 Ga0495640_0059465_1055_1489 139
404 3300046535 Ga0495586_0071777 Ga0495586_0071777_526_960 139
405 3300046538 Ga0495609_0235763 Ga0495609_0235763_276_698 139
406 3300046663 Ga0495635_0190780 Ga0495635_0190780_528_962 139
407 3300046678 Ga0495599_0005056 Ga0495599_0005056_5450_5884 139
408 3300046681 Ga0495647_0142442 Ga0495647_0142442_234_668 139
409 3300046690 Ga0495624_0130156 Ga0495624_0130156_508_942 139
410 3300046809 Ga0495600_0794810 Ga0495600_0794810_41_475 139
411 3300047315 Ga0495581_0070319 Ga0495581_0070319_1215_1649 139
412 3300047319 Ga0495674_0097528 Ga0495674_0097528_1990_2424 139
413 3300047319 Ga0495674_0315603 Ga0495674_0315603_554_988 139
414 3300047471 Ga0495684_0387195 Ga0495684_0387195_465_899 139
415 3300049568 Ga0501031_0263453 Ga0501031_0263453_646_1080 139
416 3300049569 Ga0501032_0174413 Ga0501032_0174413_632_1066 139
417 3300049570 Ga0501033_0240577 Ga0501033_0240577_593_1027 139
418 3300049573 Ga0501037_0238012 Ga0501037_0238012_436_870 139
419 3300049574 Ga0501038_0120570 Ga0501038_0120570_1315_1749 139
420 3300049575 Ga0501039_0082370 Ga0501039_0082370_661_1095 139
421 3300049576 Ga0501040_0016522 Ga0501040_0016522_2045_2479 139
422 3300049576 Ga0501040_0112677 Ga0501040_0112677_783_1217 139
423 3300049577 Ga0501041_0178726 Ga0501041_0178726_199_633 139
424 3300049577 Ga0501041_0205404 Ga0501041_0205404_179_613 139
425 3300049578 Ga0501042_0012747 Ga0501042_0012747_1721_2155 139
426 3300049582 Ga0501048_0058633 Ga0501048_0058633_979_1413 139
427 3300049582 Ga0501048_0626395 Ga0501048_0626395_179_613 139
428 3300049587 Ga0501071_0805723 Ga0501071_0805723_93_527 139
429 3300049588 Ga0501072_0015596 Ga0501072_0015596_4168_4602 139
430 3300049592 Ga0501076_0005337 Ga0501076_0005337_1029_1463 139
431 3300049743 Ga0501081_0029235 Ga0501081_0029235_1138_1572 139
432 3300049822 Ga0501035_0356857 Ga0501035_0356857_419_853 139
433 3300049823 Ga0501044_1369125 Ga0501044_1369125_75_509 139
434 3300049824 Ga0501045_0105501 Ga0501045_0105501_1017_1451 139
435 3300050508 nmdc:mga09592_216586_c1 nmdc:mga09592_216586_c1_179_613 139
436 3300050509 nmdc:mga0qj67_232850_c1 nmdc:mga0qj67_232850_c1_729_1163 139
437 3300050509 nmdc:mga0qj67_26974_c1 nmdc:mga0qj67_26974_c1_2202_2636 139
438 3300050510 nmdc:mga06r32_1088410_c1 nmdc:mga06r32_1088410_c1_10_444 139
439 3300050511 nmdc:mga08y16_172347_c1 nmdc:mga08y16_172347_c1_421_855 139
440 3300050511 nmdc:mga08y16_98775_c1 nmdc:mga08y16_98775_c1_1459_1893 139
441 3300050513 nmdc:mga0rr50_852_c1 nmdc:mga0rr50_852_c1_13061_13489 139
442 3300050513 nmdc:mga0rr50_912729_c1 nmdc:mga0rr50_912729_c1_65_499 139
443 3300050515 nmdc:mga0a205_103253_c1 nmdc:mga0a205_103253_c1_985_1413 139
444 3300050515 nmdc:mga0a205_902009_c1 nmdc:mga0a205_902009_c1_229_663 139
445 3300053077 Ga0495601_0182521 Ga0495601_0182521_289_723 139
446 3300054114 Ga0501084_0094251 Ga0501084_0094251_1864_2298 139
447 3300060353 Ga0501082_0182472 Ga0501082_0182472_547_981 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

71

140

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8q-assembly1.cif.gz_B-2 crystal structure of a protein with a cupin-like fold and unknown function (bxe_c0505) from burkholderia xenovorans lb400 at 1.55 a resolution 0.9206 23 126
2o8q-assembly1.cif.gz_A-2 crystal structure of a protein with a cupin-like fold and unknown function (bxe_c0505) from burkholderia xenovorans lb400 at 1.55 a resolution 0.8851 16 125
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8537 37 115
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.844 13 116
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.839 38 115
ID Description Score Start End Superfamily
2o8qB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9153 23 126 2.60.120.10
af_P09377_6_85_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8442 39 113 2.60.120.10
5cu1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8353 37 124 2.60.120.10
af_Q2G1P7_1_117_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8319 63 115 2.60.120.10
af_Q10LJ3_463_844_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8303 82 115 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A813A6V3-F1-model_v4 GuaA protein 0.9664 20 117 GO:0003921
GO:0005524
GO:0005829
GO:0006541
GO:0016747
AF-A0A6A7KNZ7-F1-model_v4 Cupin domain-containing protein 0.9498 50 124
AF-A0A6N6ZVS9-F1-model_v4 deleted 0.9415 15 125
AF-A0A161K856-F1-model_v4 Conserved domain protein 0.9408 23 128
AF-A0A2E8Y7V5-F1-model_v4 Cupin type-2 domain-containing protein 0.9382 50 125

Feature Viewer

pLDDT pTM Quality
84.69 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map