F445968

General Info

Members Datasets Scaffolds Average Seq Length
447 248 424 338

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10047847|Ga0207661_100478472
Length 363
Sequence MAGRFLHAPLDSISNGCSNNGMRWASQAVAVNGTPVEDGALPGLQRIGLVRSVRAPQFEGITFHEVLCKSALNKVPNAAALPFRYTVNGYRGCSHACRYCFARPTHEYLELDCGTDFDTQVVVKTNVVEVLRRELRRPSWQHETVALGTNTDPYQRAEGRYALMPGIIGALADSGTPLSILTKGTLLRRDLPLIAEAATRVPVSVAVSLAVGDPGLHRDVEPGTPTPQARLGLISAIRAAGLGCHVMVAPVLPHLTDSVEHLDGLLGQIAAAGAGSATVFGLHLRSSTRGWFMSWLARSHPELVGRYRELYRRGAYLPQGYRDMLRERAAPLIAKYRLAGDHRPFSQAVSATRTPEPVQQTLF

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
6 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
7 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
8 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
9 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
10 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
11 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
12 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
13 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
14 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
15 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
16 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
17 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
18 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
19 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
20 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
21 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
22 2922554459 Rhodococcus sp. 66b Isolate Unclassified
23 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
24 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
168 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.88
Nodule 0.22
Rhizoplane 10.51
Rhizosphere 62.64
Stem 0
Stem Tuber 0
Unclassified 10.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10000417 3300002244 Bacteria 6310
2 Ga0055540_1001298 3300003792 Bacteria 15107
3 Ga0055540_1001311 3300003792 Bacteria 15007
4 Ga0070676_10015819 3300005328 Bacteria 4162
5 Ga0070676_10064515 3300005328 Bacteria 2184
6 Ga0070690_100034551 3300005330 Bacteria 3168
7 Ga0068869_100007262 3300005334 Bacteria 7060
8 Ga0068869_100364012 3300005334 Bacteria 1181
9 Ga0070666_10102676 3300005335 Bacteria 1972
10 Ga0070680_100143132 3300005336 Bacteria 2005
11 Ga0068868_100001755 3300005338 Bacteria 14860
12 Ga0070660_100132445 3300005339 Bacteria 1996
13 Ga0070689_100001420 3300005340 Bacteria 15272
14 Ga0070687_100027081 3300005343 Bacteria 2765
15 Ga0070668_100009669 3300005347 Bacteria 7150
16 Ga0070669_100022458 3300005353 Bacteria 4511
17 Ga0070669_100040399 3300005353 Bacteria 3391
18 Ga0070669_100079473 3300005353 Bacteria 2439
19 Ga0070671_100055111 3300005355 Bacteria 3307
20 Ga0070674_100002757 3300005356 Bacteria 9712
21 Ga0070674_100023933 3300005356 Bacteria 3960
22 Ga0070673_100060034 3300005364 Bacteria 3012
23 Ga0070659_100174007 3300005366 Bacteria 1765
24 Ga0070667_100000034 3300005367 Bacteria 173652
25 Ga0070667_100016034 3300005367 Bacteria 6198
26 Ga0070667_100075034 3300005367 Bacteria 2886
27 Ga0070709_10032075 3300005434 Bacteria 3166
28 Ga0070709_10103550 3300005434 Bacteria 1901
29 Ga0070714_100108896 3300005435 Bacteria 2450
30 Ga0070710_10000924 3300005437 Bacteria 13997
31 Ga0070710_10206633 3300005437 Bacteria 1243
32 Ga0070701_10005230 3300005438 Bacteria 5338
33 Ga0070711_100004446 3300005439 Bacteria 8272
34 Ga0070711_100017812 3300005439 Bacteria 4526
35 Ga0070705_100221961 3300005440 Bacteria 1309
36 Ga0070700_100000987 3300005441 Bacteria 14034
37 Ga0070678_100000064 3300005456 Bacteria 39363
38 Ga0070662_100006244 3300005457 Bacteria 7675
39 Ga0068867_100004286 3300005459 Bacteria 10040
40 Ga0068853_100009293 3300005539 Bacteria 7929
41 Ga0068853_100170103 3300005539 Bacteria 1971
42 Ga0070672_100175439 3300005543 Bacteria 1784
43 Ga0070686_100032799 3300005544 Bacteria 3187
44 Ga0070693_100015848 3300005547 Bacteria 3889
45 Ga0070665_100082069 3300005548 Bacteria 3229
46 Ga0070665_100086934 3300005548 Bacteria 3132
47 Ga0070704_100003142 3300005549 Bacteria 9422
48 Ga0068855_100011379 3300005563 Bacteria 10744
49 Ga0068854_100037849 3300005578 Bacteria 3388
50 Ga0070702_100000251 3300005615 Bacteria 18300
51 Ga0070702_100212003 3300005615 Bacteria 1290
52 Ga0068852_100108321 3300005616 Bacteria 2521
53 Ga0068852_100446107 3300005616 Bacteria 1280
54 Ga0068859_100001203 3300005617 Bacteria 26401
55 Ga0068859_100072751 3300005617 Bacteria 3474
56 Ga0068866_10000114 3300005718 Bacteria 34929
57 Ga0068861_100001877 3300005719 Bacteria 13533
58 Ga0068870_10096385 3300005840 Bacteria 1663
59 Ga0068863_100000373 3300005841 Bacteria 45591
60 Ga0068860_100000011 3300005843 Bacteria 328172
61 Ga0068860_100000645 3300005843 Bacteria 40756
62 Ga0068860_100167896 3300005843 Bacteria 2119
63 Ga0068862_100000139 3300005844 Bacteria 82475
64 Ga0068862_100000957 3300005844 Bacteria 27784
65 Ga0081455_10023146 3300005937 Bacteria 5784
66 Ga0075365_10001297 3300006038 Bacteria 11144
67 Ga0075365_10224065 3300006038 Bacteria 1319
68 Ga0075368_10080855 3300006042 Bacteria 1322
69 Ga0075363_100000133 3300006048 Bacteria 18088
70 Ga0075363_100000343 3300006048 Bacteria 13935
71 Ga0075363_100000381 3300006048 Bacteria 13449
72 Ga0075363_100000859 3300006048 Bacteria 10624
73 Ga0075363_100015287 3300006048 Bacteria 3770
74 Ga0075363_100024227 3300006048 Bacteria 3083
75 Ga0075363_100079724 3300006048 Bacteria 1789
76 Ga0075363_100151284 3300006048 Bacteria 1310
77 Ga0075363_100200451 3300006048 Bacteria 1140
78 Ga0075364_10001419 3300006051 Bacteria 12991
79 Ga0075364_10002112 3300006051 Bacteria 11104
80 Ga0075364_10009267 3300006051 Bacteria 5901
81 Ga0075364_10017082 3300006051 Bacteria 4526
82 Ga0075364_10023368 3300006051 Bacteria 3914
83 Ga0075364_10144062 3300006051 Bacteria 1603
84 Ga0070715_10014295 3300006163 Bacteria 2937
85 Ga0070716_100162565 3300006173 Bacteria 1448
86 Ga0070712_100001978 3300006175 Bacteria 12561
87 Ga0070712_100007132 3300006175 Bacteria 6972
88 Ga0075362_10101689 3300006177 Bacteria 1345
89 Ga0075367_10002453 3300006178 Bacteria 8485
90 Ga0075367_10035012 3300006178 Bacteria 2904
91 Ga0075369_10001632 3300006186 Bacteria 7729
92 Ga0075369_10007703 3300006186 Bacteria 4115
93 Ga0075369_10036306 3300006186 Bacteria 2096
94 Ga0075369_10075836 3300006186 Bacteria 1485
95 Ga0075369_10122705 3300006186 Bacteria 1177
96 Ga0075370_10006133 3300006353 Bacteria 6029
97 Ga0075370_10011439 3300006353 Bacteria 4663
98 Ga0075370_10014994 3300006353 Bacteria 4142
99 Ga0075370_10021486 3300006353 Bacteria 3536
100 Ga0075370_10022042 3300006353 Bacteria 3493
101 Ga0075370_10149663 3300006353 Bacteria 1368
102 Ga0075428_100008623 3300006844 Bacteria 11312
103 Ga0075430_100032033 3300006846 Bacteria 4462
104 Ga0068865_100002572 3300006881 Bacteria 10770
105 Ga0097620_100001203 3300006931 Bacteria 26401
106 Ga0097620_100009322 3300006931 Bacteria 9908
107 Ga0097620_100072748 3300006931 Bacteria 3474
108 Ga0105240_10146711 3300009093 Bacteria 2815
109 Ga0105245_10000356 3300009098 Bacteria 42681
110 Ga0105247_10000067 3300009101 Bacteria 118585
111 Ga0105247_10000092 3300009101 Bacteria 97046
112 Ga0105247_10024173 3300009101 Bacteria 3660
113 Ga0114129_10006762 3300009147 Bacteria 16277
114 Ga0105243_10007691 3300009148 Bacteria 8282
115 Ga0105243_10033435 3300009148 Bacteria 3977
116 Ga0105241_10066989 3300009174 Bacteria 2778
117 Ga0105242_10000763 3300009176 Bacteria 25011
118 Ga0105242_10325357 3300009176 Bacteria 1411
119 Ga0105248_10000040 3300009177 Bacteria 172452
120 Ga0105248_10019986 3300009177 Bacteria 7415
121 Ga0105248_10131657 3300009177 Bacteria 2822
122 Ga0105248_10205145 3300009177 Bacteria 2221
123 Ga0105238_10100263 3300009551 Bacteria 2879
124 Ga0105249_10000001 3300009553 Bacteria 504948
125 Ga0105249_10000380 3300009553 Bacteria 44166
126 Ga0105239_10009826 3300010375 Bacteria 10751
127 Ga0105239_10043166 3300010375 Bacteria 4941
128 Ga0105239_10125771 3300010375 Bacteria 2849
129 Ga0105246_10380980 3300011119 Bacteria 1165
130 Ga0157374_10020992 3300013296 Bacteria 5803
131 Ga0157374_10114341 3300013296 Bacteria 2598
132 Ga0157378_10022776 3300013297 Bacteria 5513
133 Ga0163162_10166046 3300013306 Bacteria 2331
134 Ga0157372_10038514 3300013307 Bacteria 5276
135 Ga0157375_10001562 3300013308 Bacteria 19721
136 Ga0157380_10000210 3300014326 Bacteria 34429
137 Ga0157377_10105514 3300014745 Bacteria 1686
138 Ga0157379_10015215 3300014968 Bacteria 6747
139 Ga0157376_10028468 3300014969 Bacteria 4441
140 Ga0157376_10109142 3300014969 Bacteria 2432
141 Ga0163161_10017766 3300017792 Bacteria 4984
142 Ga0163161_10141233 3300017792 Bacteria 1824
143 Ga0213876_10001753 3300021384 Bacteria 13163
144 Ga0213876_10008976 3300021384 Bacteria 5388
145 Ga0213875_10010989 3300021388 Bacteria 4523
146 Ga0213875_10022746 3300021388 Bacteria 2998
147 Ga0209673_1017600 3300025273 Bacteria 2630
148 Ga0209051_1000546 3300025303 Bacteria 45996
149 Ga0209051_1001222 3300025303 Bacteria 23105
150 Ga0209051_1001430 3300025303 Bacteria 20445
151 Ga0209051_1018328 3300025303 Bacteria 3100
152 Ga0207692_10004073 3300025898 Bacteria 5762
153 Ga0207642_10123802 3300025899 Bacteria 1338
154 Ga0207710_10000094 3300025900 Bacteria 118590
155 Ga0207710_10025827 3300025900 Bacteria 2536
156 Ga0207710_10046040 3300025900 Bacteria 1947
157 Ga0207688_10003016 3300025901 Bacteria 9173
158 Ga0207699_10098166 3300025906 Bacteria 1852
159 Ga0207699_10225018 3300025906 Bacteria 1282
160 Ga0207645_10028983 3300025907 Bacteria 3569
161 Ga0207671_10066845 3300025914 Bacteria 2676
162 Ga0207693_10000389 3300025915 Bacteria 40306
163 Ga0207693_10009243 3300025915 Bacteria 8047
164 Ga0207663_10000758 3300025916 Bacteria 14428
165 Ga0207660_10177045 3300025917 Bacteria 1654
166 Ga0207657_10168394 3300025919 Bacteria 1776
167 Ga0207657_10230317 3300025919 Bacteria 1482
168 Ga0207681_10065581 3300025923 Bacteria 2511
169 Ga0207694_10092316 3300025924 Bacteria 2390
170 Ga0207687_10001073 3300025927 Bacteria 18532
171 Ga0207687_10012922 3300025927 Bacteria 5456
172 Ga0207644_10005506 3300025931 Bacteria 8246
173 Ga0207706_10004405 3300025933 Bacteria 13228
174 Ga0207706_10019090 3300025933 Bacteria 6167
175 Ga0207709_10038872 3300025935 Bacteria 2838
176 Ga0207709_10060487 3300025935 Bacteria 2362
177 Ga0207670_10088125 3300025936 Bacteria 2188
178 Ga0207669_10003561 3300025937 Bacteria 6747
179 Ga0207669_10028962 3300025937 Bacteria 3055
180 Ga0207704_10001031 3300025938 Bacteria 12369
181 Ga0207704_10169378 3300025938 Bacteria 1564
182 Ga0207665_10007564 3300025939 Bacteria 7177
183 Ga0207665_10138658 3300025939 Bacteria 1732
184 Ga0207691_10139216 3300025940 Bacteria 2139
185 Ga0207711_10000419 3300025941 Bacteria 44875
186 Ga0207711_10011119 3300025941 Bacteria 7481
187 Ga0207711_10101114 3300025941 Bacteria 2551
188 Ga0207689_10010895 3300025942 Bacteria 7819
189 Ga0207689_10066265 3300025942 Bacteria 2970
190 Ga0207661_10047847 3300025944 Bacteria 3397
191 Ga0207712_10000006 3300025961 Bacteria 573204
192 Ga0207712_10004935 3300025961 Bacteria 8432
193 Ga0207712_10167739 3300025961 Bacteria 1713
194 Ga0207668_10300456 3300025972 Bacteria 1324
195 Ga0207640_10036032 3300025981 Bacteria 3102
196 Ga0207658_10000382 3300025986 Bacteria 43284
197 Ga0207658_10170815 3300025986 Bacteria 1791
198 Ga0207677_10001803 3300026023 Bacteria 11314
199 Ga0207677_10160526 3300026023 Bacteria 1746
200 Ga0207703_10015179 3300026035 Bacteria 6010
201 Ga0207703_10106669 3300026035 Bacteria 2383
202 Ga0207639_10006949 3300026041 Bacteria 7711
203 Ga0207678_10004019 3300026067 Bacteria 13238
204 Ga0207678_10050262 3300026067 Bacteria 3602
205 Ga0207678_10165316 3300026067 Bacteria 1889
206 Ga0207708_10058806 3300026075 Bacteria 2933
207 Ga0207641_10000489 3300026088 Bacteria 44684
208 Ga0207641_10004598 3300026088 Bacteria 11920
209 Ga0207641_10079856 3300026088 Bacteria 2837
210 Ga0207641_10115490 3300026088 Bacteria 2387
211 Ga0207648_10000908 3300026089 Bacteria 33336
212 Ga0207648_10035849 3300026089 Bacteria 4371
213 Ga0207675_100000578 3300026118 Bacteria 35812
214 Ga0207675_100014173 3300026118 Bacteria 7434
215 Ga0207675_100061773 3300026118 Bacteria 3497
216 Ga0207683_10000404 3300026121 Bacteria 39718
217 Ga0207683_10064574 3300026121 Bacteria 3226
218 Ga0207698_10066555 3300026142 Bacteria 2837
219 Ga0268266_10009115 3300028379 Bacteria 8759
220 Ga0268266_10272552 3300028379 Bacteria 1571
221 Ga0268265_10000032 3300028380 Bacteria 225953
222 Ga0268265_10117928 3300028380 Bacteria 2181
223 Ga0268264_10000026 3300028381 Bacteria 459088
224 Ga0268264_10031262 3300028381 Bacteria 4365
225 Ga0268264_10142949 3300028381 Bacteria 2136
226 Ga0265327_10000064 3300031251 Bacteria 231983
227 Ga0307413_10092811 3300031824 Bacteria 1971
228 Ga0307410_10024072 3300031852 Bacteria 3798
229 Ga0307406_10218929 3300031901 Bacteria 1414
230 Ga0307407_10011827 3300031903 Bacteria 4173
231 Ga0307409_100013273 3300031995 Bacteria 5292
232 Ga0307416_100038301 3300032002 Bacteria 3698
233 Ga0373939_0067491 3300035114 Bacteria 1156
234 Ga0373931_0109507 3300035691 Bacteria 1565
235 Ga0436364_0150784 3300037853 Bacteria 7242
236 Ga0436364_0786185 3300037853 Bacteria 1153
237 Ga0436364_1174432 3300037853 Bacteria 5127
238 Ga0436364_1233325 3300037853 Bacteria 6500
239 Ga0436365_0492062 3300039437 Bacteria 2265
240 Ga0436365_0756863 3300039437 Bacteria 54771
241 Ga0436365_0881811 3300039437 Bacteria 25591
242 Ga0436365_1937054 3300039437 Bacteria 6078
243 Ga0439461_0001495 3300041410 Bacteria 3623
244 Ga0439461_0023904 3300041410 Bacteria 1232
245 Ga0439466_0002568 3300041411 Bacteria 7112
246 Ga0439465_0001153 3300041413 Bacteria 8481
247 Ga0439465_0027010 3300041413 Bacteria 1816
248 Ga0439465_0035401 3300041413 Bacteria 1600
249 Ga0451789_0954465 3300041443 Bacteria 2050
250 Ga0439431_0002420 3300041997 Bacteria 4130
251 Ga0439445_0021358 3300042004 Bacteria 1626
252 Ga0439434_0057641 3300042435 Bacteria 1211
253 Ga0466969_0031085 3300044656 Bacteria 2719
254 Ga0466972_0006612 3300044658 Bacteria 5822
255 Ga0466972_0006793 3300044658 Bacteria 5743
256 Ga0466972_0029419 3300044658 Bacteria 2704
257 Ga0466972_0118422 3300044658 Bacteria 1249
258 Ga0466965_0021914 3300044683 Bacteria 3078
259 Ga0466966_0014804 3300044684 Bacteria 5161
260 Ga0466966_0015589 3300044684 Bacteria 5023
261 Ga0466966_0015953 3300044684 Bacteria 4965
262 Ga0466961_0006706 3300044693 Bacteria 7327
263 Ga0466961_0127801 3300044693 Bacteria 1594
264 Ga0466963_0085132 3300044694 Bacteria 2146
265 Ga0466971_0015142 3300044719 Bacteria 3393
266 Ga0466968_0002885 3300044735 Bacteria 6355
267 Ga0466968_0133159 3300044735 Bacteria 1132
268 Ga0466957_0038314 3300044842 Bacteria 2888
269 Ga0466957_0038554 3300044842 Bacteria 2879
270 Ga0466957_0166774 3300044842 Bacteria 1433
271 Ga0466960_0000264 3300044901 Bacteria 18082
272 Ga0466960_0008431 3300044901 Bacteria 4221
273 Ga0466959_0016651 3300045049 Bacteria 5375
274 Ga0466959_0023485 3300045049 Bacteria 4562
275 Ga0466959_0064842 3300045049 Bacteria 2651
276 Ga0466958_0003800 3300045836 Bacteria 7884
277 Ga0466958_0029574 3300045836 Bacteria 3251
278 Ga0466958_0041416 3300045836 Bacteria 2770
279 Ga0466967_0015095 3300045976 Bacteria 6044
280 Ga0466967_0028407 3300045976 Bacteria 4669
281 Ga0466967_0032031 3300045976 Bacteria 4435
282 Ga0466967_0063312 3300045976 Bacteria 3286
283 Ga0466967_0252599 3300045976 Bacteria 1685
284 Ga0495629_0030907 3300046459 Bacteria 3794
285 Ga0495638_0043547 3300046460 Bacteria 2831
286 Ga0495662_0029285 3300046476 Bacteria 2659
287 Ga0495606_0020689 3300046507 Bacteria 4842
288 Ga0495668_0001451 3300046616 Bacteria 22869
289 Ga0495668_0037345 3300046616 Bacteria 2717
290 Ga0495611_0120324 3300046648 Bacteria 1224
291 Ga0495658_0023379 3300046683 Bacteria 3280
292 Ga0495674_0008083 3300047319 Bacteria 10039
293 Ga0495672_0001705 3300047320 Bacteria 21272
294 Ga0495672_0086198 3300047320 Bacteria 1738
295 Ga0495673_0002871 3300047469 Bacteria 11726
296 Ga0495686_0010064 3300047472 Bacteria 6755
297 Ga0495593_0025925 3300047673 Bacteria 3242
298 Ga0496100_0001738 3300048903 Bacteria 10863
299 Ga0496100_0002233 3300048903 Bacteria 9784
300 Ga0496100_0010478 3300048903 Bacteria 5249
301 Ga0496100_0064448 3300048903 Bacteria 2425
302 Ga0496100_0165720 3300048903 Bacteria 1587
303 Ga0496101_0000011 3300048904 Bacteria 272153
304 Ga0496101_0001997 3300048904 Bacteria 12375
305 Ga0496101_0003412 3300048904 Bacteria 9912
306 Ga0496101_0004803 3300048904 Bacteria 8576
307 Ga0496101_0017234 3300048904 Bacteria 4896
308 Ga0496101_0074006 3300048904 Bacteria 2504
309 Ga0496102_0000012 3300048905 Bacteria 315470
310 Ga0496102_0000427 3300048905 Bacteria 48669
311 Ga0496102_0044621 3300048905 Bacteria 4024
312 Ga0496102_0065383 3300048905 Bacteria 3333
313 Ga0496103_0000005 3300048906 Bacteria 505416
314 Ga0496103_0002441 3300048906 Bacteria 11693
315 Ga0496103_0007221 3300048906 Bacteria 6626
316 Ga0496103_0021148 3300048906 Bacteria 3915
317 Ga0496103_0267779 3300048906 Bacteria 1099
318 Ga0496104_0033795 3300048907 Bacteria 4766
319 Ga0496104_0081448 3300048907 Bacteria 3087
320 Ga0496104_0087886 3300048907 Bacteria 2969
321 Ga0496104_0191080 3300048907 Bacteria 1959
322 Ga0496105_0004147 3300048908 Bacteria 10872
323 Ga0496106_0001641 3300048909 Bacteria 16786
324 Ga0496106_0009129 3300048909 Bacteria 7327
325 Ga0496106_0009492 3300048909 Bacteria 7192
326 Ga0496107_0003756 3300048910 Bacteria 10198
327 Ga0496107_0133885 3300048910 Bacteria 1831
328 Ga0496107_0200153 3300048910 Bacteria 1485
329 Ga0496108_0014196 3300048911 Bacteria 6499
330 Ga0496108_0088903 3300048911 Bacteria 2625
331 Ga0496108_0103298 3300048911 Bacteria 2432
332 Ga0496109_0001495 3300048912 Bacteria 19414
333 Ga0496109_0004181 3300048912 Bacteria 12045
334 Ga0496110_0032585 3300048913 Bacteria 4502
335 Ga0496112_0001012 3300048915 Bacteria 20626
336 Ga0496112_0024751 3300048915 Bacteria 5756
337 Ga0496112_0102771 3300048915 Bacteria 2828
338 Ga0496113_0021291 3300048916 Bacteria 4572
339 Ga0496114_0001706 3300048917 Bacteria 16675
340 Ga0496114_0003655 3300048917 Bacteria 11833
341 Ga0496114_0239925 3300048917 Bacteria 1594
342 Ga0496115_0005559 3300048918 Bacteria 9172
343 Ga0496115_0007011 3300048918 Bacteria 8279
344 Ga0496116_0000050 3300048919 Bacteria 311670
345 Ga0496116_0003227 3300048919 Bacteria 16257
346 Ga0496117_0000042 3300048920 Bacteria 315470
347 Ga0496117_0004452 3300048920 Bacteria 15450
348 Ga0496117_0075195 3300048920 Bacteria 2245
349 Ga0496118_0000037 3300048921 Bacteria 315470
350 Ga0496118_0000857 3300048921 Bacteria 48262
351 Ga0496119_0000486 3300048922 Bacteria 54401
352 Ga0496119_0001747 3300048922 Bacteria 25331
353 Ga0496120_0000121 3300048923 Bacteria 131612
354 Ga0496120_0003739 3300048923 Bacteria 13479
355 Ga0496121_0000250 3300048924 Bacteria 114145
356 Ga0496121_0001945 3300048924 Bacteria 32921
357 Ga0496123_0009037 3300048926 Bacteria 9035
358 Ga0496124_0073110 3300048927 Bacteria 2837
359 Ga0496125_0032137 3300048928 Bacteria 4665
360 Ga0496126_0000317 3300048929 Bacteria 102866
361 Ga0496126_0008566 3300048929 Bacteria 11019
362 Ga0496126_0009578 3300048929 Bacteria 10276
363 Ga0496126_0030125 3300048929 Bacteria 5146
364 Ga0496126_0057475 3300048929 Bacteria 3512
365 Ga0501032_0000590 3300049569 Bacteria 29286
366 Ga0501032_0098900 3300049569 Bacteria 1933
367 Ga0501033_0045688 3300049570 Bacteria 3258
368 Ga0501033_0071525 3300049570 Bacteria 2548
369 Ga0501034_0000604 3300049571 Bacteria 56560
370 Ga0501034_0038877 3300049571 Bacteria 4819
371 Ga0501034_0443691 3300049571 Bacteria 1216
372 Ga0501037_0000588 3300049573 Bacteria 28582
373 Ga0501037_0012551 3300049573 Bacteria 6242
374 Ga0501038_0067568 3300049574 Bacteria 3040
375 Ga0501043_0001623 3300049579 Bacteria 19576
376 Ga0501043_0177905 3300049579 Bacteria 1658
377 Ga0501046_0000704 3300049580 Bacteria 32300
378 Ga0501047_0001307 3300049581 Bacteria 24572
379 Ga0501047_0014602 3300049581 Bacteria 7472
380 Ga0501048_0004662 3300049582 Bacteria 10434
381 Ga0501070_0003326 3300049586 Bacteria 13964
382 Ga0501080_0007722 3300049742 Bacteria 9724
383 Ga0501035_0000864 3300049822 Bacteria 32359
384 Ga0501035_0066628 3300049822 Bacteria 3195
385 Ga0501044_0000804 3300049823 Bacteria 37831
386 Ga0501044_0000966 3300049823 Bacteria 34622
387 Ga0501044_0047036 3300049823 Bacteria 4464
388 Ga0501044_0473085 3300049823 Bacteria 1157
389 nmdc:mga03683_33282_c2 3300050489 Bacteria 1729
390 nmdc:mga03n38_1482_c1 3300050490 Bacteria 6764
391 nmdc:mga03n38_3253_c2 3300050490 Bacteria 3816
392 nmdc:mga03n38_877_c1 3300050490 Bacteria 8088
393 nmdc:mga00v17_10454_c1 3300050491 Bacteria 5069
394 nmdc:mga00v17_1092_c1 3300050491 Bacteria 14276
395 nmdc:mga00v17_116680_c1 3300050491 Bacteria 1697
396 nmdc:mga00v17_16642_c1 3300050491 Bacteria 4147
397 nmdc:mga00v17_2790_c1 3300050491 Bacteria 8970
398 nmdc:mga00v17_6746_c1 3300050491 Bacteria 6099
399 nmdc:mga00v17_77450_c1 3300050491 Bacteria 2070
400 nmdc:mga0yw44_27912_c1 3300050492 Bacteria 3240
401 nmdc:mga0yw44_31360_c1 3300050492 Bacteria 3090
402 nmdc:mga0yw44_8747_c1 3300050492 Bacteria 5065
403 nmdc:mga06z11_3706_c1 3300050494 Bacteria 5935
404 nmdc:mga07m45_156913_c1 3300050496 Bacteria 1320
405 nmdc:mga07m45_30049_c1 3300050496 Bacteria 3008
406 nmdc:mga07m45_3710_c1 3300050496 Bacteria 7388
407 nmdc:mga07m45_4329_c1 3300050496 Bacteria 6945
408 nmdc:mga07m45_68331_c1 3300050496 Bacteria 2020
409 nmdc:mga0qj67_10576_c1 3300050509 Bacteria 6893
410 nmdc:mga0sz30_14770_c1 3300050516 Bacteria 2178
411 nmdc:mga0sz30_18651_c1 3300050516 Bacteria 2779
412 nmdc:mga0sz30_28974_c1 3300050516 Bacteria 2280
413 nmdc:mga0sz30_35896_c1 3300050516 Bacteria 2071
414 Ga0500643_004566 3300053087 Bacteria 6202
415 Ga0500643_015532 3300053087 Bacteria 2607
416 Ga0500608_044981 3300053122 Bacteria 2121
417 Ga0500642_0023733 3300053130 Bacteria 2467
418 Ga0500652_005812 3300053131 Bacteria 3922
419 Ga0500652_025822 3300053131 Bacteria 2255
420 Ga0500616_0012015 3300053153 Bacteria 5085
421 Ga0500645_000107 3300053730 Bacteria 66965
422 Ga0466962_0027266 3300061719 Bacteria 2742
423 Ga0466962_0038579 3300061719 Bacteria 2288
424 Ga0466962_0114510 3300061719 Bacteria 1299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0267779 Ga0496103_0267779_68_925 285
2 3300006353 Ga0075370_10021486 Ga0075370_100214863 304
3 3300021384 Ga0213876_10001753 Ga0213876_100017539 304
4 3300021388 Ga0213875_10010989 Ga0213875_100109894 304
5 3300037853 Ga0436364_0150784 Ga0436364_0150784_1750_2775 304
6 3300039437 Ga0436365_0756863 Ga0436365_0756863_21009_22034 304
7 3300021388 Ga0213875_10022746 Ga0213875_100227465 310
8 3300037853 Ga0436364_1233325 Ga0436364_1233325_3881_4894 310
9 3300053130 Ga0500642_0023733 Ga0500642_0023733_211_1179 313
10 3300006051 Ga0075364_10017082 Ga0075364_100170823 315
11 3300041410 Ga0439461_0001495 Ga0439461_0001495_1771_2787 316
12 3300041411 Ga0439466_0002568 Ga0439466_0002568_176_1192 316
13 3300041997 Ga0439431_0002420 Ga0439431_0002420_2199_3215 316
14 3300042004 Ga0439445_0021358 Ga0439445_0021358_486_1502 316
15 3300042435 Ga0439434_0057641 Ga0439434_0057641_24_1040 316
16 3300009101 Ga0105247_10000067 Ga0105247_1000006723 318
17 3300009177 Ga0105248_10000040 Ga0105248_10000040149 318
18 3300009553 Ga0105249_10000001 Ga0105249_10000001143 318
19 3300048904 Ga0496101_0001997 Ga0496101_0001997_134_1090 318
20 3300048905 Ga0496102_0000427 Ga0496102_0000427_29945_30901 318
21 3300048906 Ga0496103_0002441 Ga0496103_0002441_5430_6386 318
22 3300048910 Ga0496107_0133885 Ga0496107_0133885_357_1313 318
23 3300048919 Ga0496116_0003227 Ga0496116_0003227_1537_2493 318
24 3300048920 Ga0496117_0004452 Ga0496117_0004452_8601_9557 318
25 3300048921 Ga0496118_0000857 Ga0496118_0000857_25120_26076 318
26 3300048922 Ga0496119_0001747 Ga0496119_0001747_7120_8076 318
27 3300048923 Ga0496120_0003739 Ga0496120_0003739_522_1478 318
28 3300048924 Ga0496121_0001945 Ga0496121_0001945_27086_28042 318
29 3300048927 Ga0496124_0073110 Ga0496124_0073110_281_1237 318
30 3300048928 Ga0496125_0032137 Ga0496125_0032137_1385_2341 318
31 3300048929 Ga0496126_0008566 Ga0496126_0008566_3111_4067 318
32 3300049570 Ga0501033_0045688 Ga0501033_0045688_184_1155 319
33 3300005843 Ga0068860_100167896 Ga0068860_1001678962 320
34 3300028381 Ga0268264_10142949 Ga0268264_101429492 320
35 3300044658 Ga0466972_0006612 Ga0466972_0006612_3798_4826 320
36 3300044683 Ga0466965_0021914 Ga0466965_0021914_1939_2967 320
37 3300044901 Ga0466960_0000264 Ga0466960_0000264_2609_3637 320
38 3300048917 Ga0496114_0239925 Ga0496114_0239925_255_1283 320
39 3300009148 Ga0105243_10033435 Ga0105243_100334352 322
40 3300025935 Ga0207709_10038872 Ga0207709_100388723 322
41 3300048929 Ga0496126_0030125 Ga0496126_0030125_1630_2655 322
42 3300061719 Ga0466962_0038579 Ga0466962_0038579_581_1618 322
43 iso_pu_bacteria 2842888712 2842891259 322
44 3300003792 Ga0055540_1001298 Ga0055540_100129816 326
45 3300025303 Ga0209051_1000546 Ga0209051_100054628 326
46 3300048905 Ga0496102_0000012 Ga0496102_0000012_205639_206652 326
47 3300048906 Ga0496103_0000005 Ga0496103_0000005_108811_109824 326
48 3300048919 Ga0496116_0000050 Ga0496116_0000050_201860_202873 326
49 3300048920 Ga0496117_0000042 Ga0496117_0000042_108819_109832 326
50 3300048921 Ga0496118_0000037 Ga0496118_0000037_108819_109832 326
51 3300050496 nmdc:mga07m45_156913_c1 nmdc:mga07m45_156913_c1_19_1011 326
52 iso_pu_bacteria 2643221715 2644633536 326
53 iso_pu_bacteria 2738543034 2739361915 326
54 iso_pu_bacteria 2744054611 2744954869 326
55 iso_pu_bacteria 2902810491 2902815160 326
56 3300039437 Ga0436365_1937054 Ga0436365_1937054_3026_4054 327
57 3300044658 Ga0466972_0029419 Ga0466972_0029419_540_1553 327
58 3300044684 Ga0466966_0014804 Ga0466966_0014804_4097_5110 328
59 3300044693 Ga0466961_0006706 Ga0466961_0006706_6128_7141 328
60 3300044842 Ga0466957_0038314 Ga0466957_0038314_620_1633 328
61 3300045836 Ga0466958_0003800 Ga0466958_0003800_82_1095 328
62 iso_pu_bacteria 2547132424 2548696819 328
63 iso_pu_bacteria 2738541274 2738705150 328
64 iso_pu_bacteria 2738543028 2739332847 328
65 iso_pu_bacteria 2902799365 2902801248 328
66 3300048903 Ga0496100_0001738 Ga0496100_0001738_2889_3962 329
67 3300048904 Ga0496101_0000011 Ga0496101_0000011_100924_101997 329
68 3300048922 Ga0496119_0000486 Ga0496119_0000486_39880_40953 329
69 3300048923 Ga0496120_0000121 Ga0496120_0000121_90660_91733 329
70 3300048924 Ga0496121_0000250 Ga0496121_0000250_4340_5413 329
71 3300048929 Ga0496126_0000317 Ga0496126_0000317_101293_102366 329
72 3300053087 Ga0500643_004566 Ga0500643_004566_2255_3268 329
73 iso_pu_bacteria 2929212328 2929215298 329
74 3300049571 Ga0501034_0038877 Ga0501034_0038877_1178_2206 330
75 3300049573 Ga0501037_0000588 Ga0501037_0000588_21267_22295 330
76 3300049574 Ga0501038_0067568 Ga0501038_0067568_835_1863 330
77 3300049579 Ga0501043_0001623 Ga0501043_0001623_17505_18533 330
78 3300049823 Ga0501044_0047036 Ga0501044_0047036_3223_4251 330
79 3300005353 Ga0070669_100040399 Ga0070669_1000403994 331
80 3300005353 Ga0070669_100079473 Ga0070669_1000794733 331
81 3300005364 Ga0070673_100060034 Ga0070673_1000600343 331
82 3300005367 Ga0070667_100000034 Ga0070667_10000003449 331
83 3300005434 Ga0070709_10032075 Ga0070709_100320754 331
84 3300005437 Ga0070710_10206633 Ga0070710_102066331 331
85 3300005439 Ga0070711_100017812 Ga0070711_1000178123 331
86 3300005616 Ga0068852_100108321 Ga0068852_1001083212 331
87 3300009101 Ga0105247_10024173 Ga0105247_100241734 331
88 3300009177 Ga0105248_10205145 Ga0105248_102051452 331
89 3300011119 Ga0105246_10380980 Ga0105246_103809801 331
90 3300013296 Ga0157374_10020992 Ga0157374_100209922 331
91 3300014968 Ga0157379_10015215 Ga0157379_100152156 331
92 3300014969 Ga0157376_10028468 Ga0157376_100284681 331
93 3300017792 Ga0163161_10141233 Ga0163161_101412331 331
94 3300025900 Ga0207710_10025827 Ga0207710_100258273 331
95 3300025942 Ga0207689_10066265 Ga0207689_100662651 331
96 3300026088 Ga0207641_10115490 Ga0207641_101154903 331
97 3300026118 Ga0207675_100014173 Ga0207675_1000141735 331
98 3300044658 Ga0466972_0118422 Ga0466972_0118422_172_1167 331
99 3300048903 Ga0496100_0064448 Ga0496100_0064448_935_1957 331
100 3300048904 Ga0496101_0017234 Ga0496101_0017234_2006_3028 331
101 3300048905 Ga0496102_0044621 Ga0496102_0044621_1097_2122 331
102 3300048907 Ga0496104_0087886 Ga0496104_0087886_86_1111 331
103 3300048909 Ga0496106_0009492 Ga0496106_0009492_3151_4176 331
104 3300048911 Ga0496108_0014196 Ga0496108_0014196_985_2010 331
105 3300048912 Ga0496109_0004181 Ga0496109_0004181_3138_4163 331
106 3300048915 Ga0496112_0024751 Ga0496112_0024751_1262_2287 331
107 3300048915 Ga0496112_0102771 Ga0496112_0102771_1763_2785 331
108 3300048926 Ga0496123_0009037 Ga0496123_0009037_6005_7027 331
109 3300048929 Ga0496126_0009578 Ga0496126_0009578_1798_2820 331
110 iso_pu_bacteria 2842134933 2842138120 331
111 iso_pu_bacteria 2904765812 2904769820 331
112 iso_pu_bacteria 2904770941 2904771321 331
113 iso_pu_bacteria 2908811453 2908816132 331
114 iso_pu_bacteria 2919420072 2919423183 331
115 iso_pu_bacteria 2919432681 2919435791 331
116 3300025303 Ga0209051_1018328 Ga0209051_10183282 332
117 3300046460 Ga0495638_0043547 Ga0495638_0043547_86_1099 332
118 3300046507 Ga0495606_0020689 Ga0495606_0020689_3140_4153 332
119 3300048929 Ga0496126_0057475 Ga0496126_0057475_15_1034 332
120 3300053087 Ga0500643_015532 Ga0500643_015532_308_1321 332
121 3300053122 Ga0500608_044981 Ga0500608_044981_298_1317 332
122 3300053131 Ga0500652_005812 Ga0500652_005812_753_1766 332
123 3300053730 Ga0500645_000107 Ga0500645_000107_63510_64529 332
124 iso_pu_bacteria 2565956761 2566992412 332
125 iso_pu_bacteria 2904535858 2904539336 332
126 iso_pu_bacteria 2922554459 2922555584 332
127 3300005435 Ga0070714_100108896 Ga0070714_1001088961 333
128 3300006048 Ga0075363_100079724 Ga0075363_1000797242 333
129 3300006051 Ga0075364_10009267 Ga0075364_100092676 333
130 3300006051 Ga0075364_10144062 Ga0075364_101440622 333
131 3300006186 Ga0075369_10001632 Ga0075369_100016324 333
132 3300006186 Ga0075369_10122705 Ga0075369_101227052 333
133 3300021384 Ga0213876_10008976 Ga0213876_100089763 333
134 3300031251 Ga0265327_10000064 Ga0265327_1000006484 333
135 3300037853 Ga0436364_0786185 Ga0436364_0786185_42_1070 333
136 3300039437 Ga0436365_0881811 Ga0436365_0881811_17562_18572 333
137 3300044693 Ga0466961_0127801 Ga0466961_0127801_138_1160 333
138 3300044694 Ga0466963_0085132 Ga0466963_0085132_979_2007 333
139 3300044719 Ga0466971_0015142 Ga0466971_0015142_1600_2628 333
140 3300044735 Ga0466968_0002885 Ga0466968_0002885_1912_2982 333
141 3300044842 Ga0466957_0166774 Ga0466957_0166774_245_1273 333
142 3300044901 Ga0466960_0008431 Ga0466960_0008431_502_1572 333
143 3300045049 Ga0466959_0023485 Ga0466959_0023485_2741_3784 333
144 3300045836 Ga0466958_0041416 Ga0466958_0041416_554_1582 333
145 3300045976 Ga0466967_0015095 Ga0466967_0015095_1251_2279 333
146 3300045976 Ga0466967_0032031 Ga0466967_0032031_3019_4089 333
147 3300048905 Ga0496102_0065383 Ga0496102_0065383_841_1845 333
148 3300048920 Ga0496117_0075195 Ga0496117_0075195_16_1020 333
149 3300049569 Ga0501032_0000590 Ga0501032_0000590_16486_17514 333
150 3300049571 Ga0501034_0000604 Ga0501034_0000604_54529_55557 333
151 3300049573 Ga0501037_0012551 Ga0501037_0012551_2895_3923 333
152 3300049579 Ga0501043_0177905 Ga0501043_0177905_618_1646 333
153 3300049580 Ga0501046_0000704 Ga0501046_0000704_5534_6562 333
154 3300049581 Ga0501047_0001307 Ga0501047_0001307_17722_18750 333
155 3300049582 Ga0501048_0004662 Ga0501048_0004662_1528_2556 333
156 3300049586 Ga0501070_0003326 Ga0501070_0003326_12442_13470 333
157 3300049742 Ga0501080_0007722 Ga0501080_0007722_39_1052 333
158 3300049822 Ga0501035_0000864 Ga0501035_0000864_28810_29838 333
159 3300049823 Ga0501044_0000804 Ga0501044_0000804_12026_13054 333
160 3300050491 nmdc:mga00v17_16642_c1 nmdc:mga00v17_16642_c1_2831_3844 333
161 3300050491 nmdc:mga00v17_77450_c1 nmdc:mga00v17_77450_c1_304_1323 333
162 3300050516 nmdc:mga0sz30_18651_c1 nmdc:mga0sz30_18651_c1_311_1354 333
163 3300061719 Ga0466962_0027266 Ga0466962_0027266_605_1633 333
164 iso_pu_bacteria 2902792274 2902796122 333
165 3300025944 Ga0207661_10047847 Ga0207661_100478472 334
166 3300044656 Ga0466969_0031085 Ga0466969_0031085_1020_2027 334
167 3300044842 Ga0466957_0038554 Ga0466957_0038554_950_1957 334
168 3300045049 Ga0466959_0016651 Ga0466959_0016651_1853_2860 334
169 iso_pu_bacteria 2902837492 2902840511 334
170 iso_pu_bacteria 2919713450 2919717568 334
171 3300037853 Ga0436364_1174432 Ga0436364_1174432_3265_4275 335
172 3300044684 Ga0466966_0015589 Ga0466966_0015589_2778_3794 335
173 3300044684 Ga0466966_0015953 Ga0466966_0015953_1171_2187 335
174 3300044735 Ga0466968_0133159 Ga0466968_0133159_49_1065 335
175 3300045049 Ga0466959_0064842 Ga0466959_0064842_768_1784 335
176 3300045836 Ga0466958_0029574 Ga0466958_0029574_1845_2861 335
177 3300045976 Ga0466967_0063312 Ga0466967_0063312_1456_2484 335
178 3300049569 Ga0501032_0098900 Ga0501032_0098900_71_1081 335
179 3300049570 Ga0501033_0071525 Ga0501033_0071525_1424_2434 335
180 3300049571 Ga0501034_0443691 Ga0501034_0443691_49_1059 335
181 3300049581 Ga0501047_0014602 Ga0501047_0014602_1475_2485 335
182 3300049822 Ga0501035_0066628 Ga0501035_0066628_119_1129 335
183 3300049823 Ga0501044_0000966 Ga0501044_0000966_31980_32990 335
184 3300061719 Ga0466962_0114510 Ga0466962_0114510_246_1262 335
185 3300046616 Ga0495668_0001451 Ga0495668_0001451_3564_4601 336
186 3300048911 Ga0496108_0103298 Ga0496108_0103298_743_1780 336
187 3300053153 Ga0500616_0012015 Ga0500616_0012015_3206_4216 336
188 3300005539 Ga0068853_100170103 Ga0068853_1001701033 337
189 3300006186 Ga0075369_10075836 Ga0075369_100758362 337
190 3300006353 Ga0075370_10022042 Ga0075370_100220422 337
191 3300039437 Ga0436365_0492062 Ga0436365_0492062_196_1212 337
192 3300045976 Ga0466967_0028407 Ga0466967_0028407_1573_2586 337
193 3300046616 Ga0495668_0037345 Ga0495668_0037345_1676_2689 337
194 3300047320 Ga0495672_0086198 Ga0495672_0086198_533_1546 337
195 3300047472 Ga0495686_0010064 Ga0495686_0010064_411_1424 337
196 3300050496 nmdc:mga07m45_68331_c1 nmdc:mga07m45_68331_c1_437_1450 337
197 3300050516 nmdc:mga0sz30_28974_c1 nmdc:mga0sz30_28974_c1_477_1490 337
198 iso_pu_bacteria 2643221687 2644486145 337
199 3300003792 Ga0055540_1001311 Ga0055540_10013119 338
200 3300005328 Ga0070676_10064515 Ga0070676_100645152 338
201 3300005355 Ga0070671_100055111 Ga0070671_1000551112 338
202 3300005356 Ga0070674_100023933 Ga0070674_1000239333 338
203 3300005367 Ga0070667_100075034 Ga0070667_1000750343 338
204 3300005544 Ga0070686_100032799 Ga0070686_1000327993 338
205 3300005548 Ga0070665_100082069 Ga0070665_1000820691 338
206 3300005617 Ga0068859_100072751 Ga0068859_1000727512 338
207 3300005840 Ga0068870_10096385 Ga0068870_100963852 338
208 3300005937 Ga0081455_10023146 Ga0081455_100231463 338
209 3300006038 Ga0075365_10001297 Ga0075365_100012975 338
210 3300006038 Ga0075365_10224065 Ga0075365_102240651 338
211 3300006042 Ga0075368_10080855 Ga0075368_100808552 338
212 3300006048 Ga0075363_100000343 Ga0075363_1000003435 338
213 3300006048 Ga0075363_100000381 Ga0075363_1000003814 338
214 3300006048 Ga0075363_100000859 Ga0075363_1000008598 338
215 3300006048 Ga0075363_100015287 Ga0075363_1000152873 338
216 3300006048 Ga0075363_100024227 Ga0075363_1000242273 338
217 3300006048 Ga0075363_100151284 Ga0075363_1001512842 338
218 3300006048 Ga0075363_100200451 Ga0075363_1002004511 338
219 3300006051 Ga0075364_10001419 Ga0075364_100014192 338
220 3300006051 Ga0075364_10002112 Ga0075364_100021122 338
221 3300006051 Ga0075364_10023368 Ga0075364_100233681 338
222 3300006163 Ga0070715_10014295 Ga0070715_100142952 338
223 3300006175 Ga0070712_100007132 Ga0070712_1000071322 338
224 3300006177 Ga0075362_10101689 Ga0075362_101016892 338
225 3300006178 Ga0075367_10002453 Ga0075367_100024532 338
226 3300006178 Ga0075367_10035012 Ga0075367_100350122 338
227 3300006186 Ga0075369_10007703 Ga0075369_100077033 338
228 3300006186 Ga0075369_10036306 Ga0075369_100363063 338
229 3300006353 Ga0075370_10006133 Ga0075370_100061333 338
230 3300006353 Ga0075370_10011439 Ga0075370_100114394 338
231 3300006353 Ga0075370_10014994 Ga0075370_100149944 338
232 3300006353 Ga0075370_10149663 Ga0075370_101496631 338
233 3300006931 Ga0097620_100072748 Ga0097620_1000727482 338
234 3300009176 Ga0105242_10325357 Ga0105242_103253572 338
235 3300009177 Ga0105248_10131657 Ga0105248_101316572 338
236 3300009551 Ga0105238_10100263 Ga0105238_101002633 338
237 3300010375 Ga0105239_10043166 Ga0105239_100431662 338
238 3300013306 Ga0163162_10166046 Ga0163162_101660463 338
239 3300025273 Ga0209673_1017600 Ga0209673_10176004 338
240 3300025303 Ga0209051_1001222 Ga0209051_10012224 338
241 3300025303 Ga0209051_1001430 Ga0209051_10014305 338
242 3300025906 Ga0207699_10225018 Ga0207699_102250181 338
243 3300025915 Ga0207693_10009243 Ga0207693_100092436 338
244 3300025919 Ga0207657_10230317 Ga0207657_102303172 338
245 3300025924 Ga0207694_10092316 Ga0207694_100923163 338
246 3300025927 Ga0207687_10012922 Ga0207687_100129225 338
247 3300025931 Ga0207644_10005506 Ga0207644_100055065 338
248 3300025937 Ga0207669_10028962 Ga0207669_100289622 338
249 3300025938 Ga0207704_10169378 Ga0207704_101693782 338
250 3300025941 Ga0207711_10101114 Ga0207711_101011142 338
251 3300025961 Ga0207712_10167739 Ga0207712_101677392 338
252 3300026035 Ga0207703_10015179 Ga0207703_100151795 338
253 3300026067 Ga0207678_10004019 Ga0207678_1000401910 338
254 3300026067 Ga0207678_10165316 Ga0207678_101653162 338
255 3300026088 Ga0207641_10004598 Ga0207641_1000459814 338
256 3300026121 Ga0207683_10064574 Ga0207683_100645743 338
257 3300028379 Ga0268266_10009115 Ga0268266_100091153 338
258 3300028380 Ga0268265_10117928 Ga0268265_101179281 338
259 3300031824 Ga0307413_10092811 Ga0307413_100928112 338
260 3300031852 Ga0307410_10024072 Ga0307410_100240722 338
261 3300031901 Ga0307406_10218929 Ga0307406_102189291 338
262 3300031903 Ga0307407_10011827 Ga0307407_100118272 338
263 3300031995 Ga0307409_100013273 Ga0307409_1000132736 338
264 3300032002 Ga0307416_100038301 Ga0307416_1000383012 338
265 3300035114 Ga0373939_0067491 Ga0373939_0067491_90_1136 338
266 3300041410 Ga0439461_0023904 Ga0439461_0023904_15_1031 338
267 3300041413 Ga0439465_0001153 Ga0439465_0001153_7227_8243 338
268 3300041413 Ga0439465_0027010 Ga0439465_0027010_264_1280 338
269 3300041413 Ga0439465_0035401 Ga0439465_0035401_223_1239 338
270 3300041443 Ga0451789_0954465 Ga0451789_0954465_59_1099 338
271 3300044658 Ga0466972_0006793 Ga0466972_0006793_1686_2702 338
272 3300046459 Ga0495629_0030907 Ga0495629_0030907_1625_2641 338
273 3300046476 Ga0495662_0029285 Ga0495662_0029285_611_1627 338
274 3300046683 Ga0495658_0023379 Ga0495658_0023379_2193_3209 338
275 3300047319 Ga0495674_0008083 Ga0495674_0008083_6910_7926 338
276 3300047673 Ga0495593_0025925 Ga0495593_0025925_807_1823 338
277 3300048903 Ga0496100_0002233 Ga0496100_0002233_2459_3478 338
278 3300048903 Ga0496100_0165720 Ga0496100_0165720_363_1394 338
279 3300048904 Ga0496101_0003412 Ga0496101_0003412_4803_5822 338
280 3300048904 Ga0496101_0074006 Ga0496101_0074006_624_1640 338
281 3300048906 Ga0496103_0021148 Ga0496103_0021148_1360_2376 338
282 3300048907 Ga0496104_0033795 Ga0496104_0033795_2344_3363 338
283 3300048907 Ga0496104_0081448 Ga0496104_0081448_918_1934 338
284 3300048907 Ga0496104_0191080 Ga0496104_0191080_132_1163 338
285 3300048908 Ga0496105_0004147 Ga0496105_0004147_2615_3634 338
286 3300048909 Ga0496106_0009129 Ga0496106_0009129_3326_4345 338
287 3300048910 Ga0496107_0003756 Ga0496107_0003756_2431_3450 338
288 3300048910 Ga0496107_0200153 Ga0496107_0200153_347_1378 338
289 3300048911 Ga0496108_0088903 Ga0496108_0088903_1186_2202 338
290 3300048912 Ga0496109_0001495 Ga0496109_0001495_651_1667 338
291 3300048913 Ga0496110_0032585 Ga0496110_0032585_1080_2096 338
292 3300048915 Ga0496112_0001012 Ga0496112_0001012_12221_13237 338
293 3300048916 Ga0496113_0021291 Ga0496113_0021291_1497_2513 338
294 3300048917 Ga0496114_0003655 Ga0496114_0003655_4137_5156 338
295 3300048918 Ga0496115_0005559 Ga0496115_0005559_2527_3546 338
296 3300049823 Ga0501044_0473085 Ga0501044_0473085_87_1130 338
297 3300050489 nmdc:mga03683_33282_c2 nmdc:mga03683_33282_c2_586_1602 338
298 3300050490 nmdc:mga03n38_1482_c1 nmdc:mga03n38_1482_c1_1313_2329 338
299 3300050490 nmdc:mga03n38_3253_c2 nmdc:mga03n38_3253_c2_595_1611 338
300 3300050490 nmdc:mga03n38_877_c1 nmdc:mga03n38_877_c1_4336_5352 338
301 3300050491 nmdc:mga00v17_10454_c1 nmdc:mga00v17_10454_c1_1063_2079 338
302 3300050491 nmdc:mga00v17_1092_c1 nmdc:mga00v17_1092_c1_11006_12022 338
303 3300050491 nmdc:mga00v17_116680_c1 nmdc:mga00v17_116680_c1_451_1467 338
304 3300050491 nmdc:mga00v17_2790_c1 nmdc:mga00v17_2790_c1_5921_6937 338
305 3300050491 nmdc:mga00v17_6746_c1 nmdc:mga00v17_6746_c1_761_1777 338
306 3300050492 nmdc:mga0yw44_27912_c1 nmdc:mga0yw44_27912_c1_717_1733 338
307 3300050492 nmdc:mga0yw44_31360_c1 nmdc:mga0yw44_31360_c1_387_1403 338
308 3300050492 nmdc:mga0yw44_8747_c1 nmdc:mga0yw44_8747_c1_3419_4435 338
309 3300050494 nmdc:mga06z11_3706_c1 nmdc:mga06z11_3706_c1_4018_5034 338
310 3300050496 nmdc:mga07m45_30049_c1 nmdc:mga07m45_30049_c1_616_1632 338
311 3300050496 nmdc:mga07m45_3710_c1 nmdc:mga07m45_3710_c1_1005_2021 338
312 3300050496 nmdc:mga07m45_4329_c1 nmdc:mga07m45_4329_c1_3556_4572 338
313 3300050516 nmdc:mga0sz30_14770_c1 nmdc:mga0sz30_14770_c1_413_1429 338
314 3300050516 nmdc:mga0sz30_35896_c1 nmdc:mga0sz30_35896_c1_806_1825 338
315 3300053131 Ga0500652_025822 Ga0500652_025822_867_1895 338
316 3300005841 Ga0068863_100000373 Ga0068863_10000037317 339
317 3300005843 Ga0068860_100000011 Ga0068860_10000001194 339
318 3300005844 Ga0068862_100000139 Ga0068862_10000013917 339
319 3300006844 Ga0075428_100008623 Ga0075428_1000086236 339
320 3300006846 Ga0075430_100032033 Ga0075430_1000320336 339
321 3300006931 Ga0097620_100009322 Ga0097620_10000932210 339
322 3300009147 Ga0114129_10006762 Ga0114129_100067626 339
323 3300010375 Ga0105239_10125771 Ga0105239_101257713 339
324 3300025900 Ga0207710_10000094 Ga0207710_1000009424 339
325 3300025941 Ga0207711_10000419 Ga0207711_100004195 339
326 3300025961 Ga0207712_10000006 Ga0207712_10000006350 339
327 3300025986 Ga0207658_10000382 Ga0207658_1000038212 339
328 3300025986 Ga0207658_10170815 Ga0207658_101708152 339
329 3300026035 Ga0207703_10106669 Ga0207703_101066693 339
330 3300026088 Ga0207641_10000489 Ga0207641_1000048942 339
331 3300026088 Ga0207641_10079856 Ga0207641_100798562 339
332 3300026118 Ga0207675_100061773 Ga0207675_1000617732 339
333 3300028380 Ga0268265_10000032 Ga0268265_10000032169 339
334 3300028381 Ga0268264_10000026 Ga0268264_10000026346 339
335 3300045976 Ga0466967_0252599 Ga0466967_0252599_290_1309 339
336 3300050509 nmdc:mga0qj67_10576_c1 nmdc:mga0qj67_10576_c1_5591_6610 339
337 3300046648 Ga0495611_0120324 Ga0495611_0120324_45_1112 340
338 3300047320 Ga0495672_0001705 Ga0495672_0001705_10979_12046 340
339 3300047469 Ga0495673_0002871 Ga0495673_0002871_7450_8517 340
340 3300005334 Ga0068869_100364012 Ga0068869_1003640121 341
341 3300005615 Ga0070702_100212003 Ga0070702_1002120031 341
342 3300006048 Ga0075363_100000133 Ga0075363_10000013317 341
343 3300006173 Ga0070716_100162565 Ga0070716_1001625651 341
344 3300014745 Ga0157377_10105514 Ga0157377_101055142 341
345 3300025933 Ga0207706_10019090 Ga0207706_100190906 341
346 3300025939 Ga0207665_10138658 Ga0207665_101386581 341
347 3300025981 Ga0207640_10036032 Ga0207640_100360321 341
348 3300026023 Ga0207677_10160526 Ga0207677_101605262 341
349 3300026089 Ga0207648_10035849 Ga0207648_100358493 341
350 3300002244 JGI24742J22300_10000417 JGI24742J22300_100004172 342
351 3300005328 Ga0070676_10015819 Ga0070676_100158194 342
352 3300005330 Ga0070690_100034551 Ga0070690_1000345513 342
353 3300005334 Ga0068869_100007262 Ga0068869_1000072624 342
354 3300005335 Ga0070666_10102676 Ga0070666_101026762 342
355 3300005336 Ga0070680_100143132 Ga0070680_1001431322 342
356 3300005338 Ga0068868_100001755 Ga0068868_10000175510 342
357 3300005339 Ga0070660_100132445 Ga0070660_1001324452 342
358 3300005340 Ga0070689_100001420 Ga0070689_10000142014 342
359 3300005343 Ga0070687_100027081 Ga0070687_1000270813 342
360 3300005347 Ga0070668_100009669 Ga0070668_1000096692 342
361 3300005353 Ga0070669_100022458 Ga0070669_1000224584 342
362 3300005356 Ga0070674_100002757 Ga0070674_1000027578 342
363 3300005366 Ga0070659_100174007 Ga0070659_1001740072 342
364 3300005367 Ga0070667_100016034 Ga0070667_1000160344 342
365 3300005434 Ga0070709_10103550 Ga0070709_101035501 342
366 3300005437 Ga0070710_10000924 Ga0070710_1000092413 342
367 3300005438 Ga0070701_10005230 Ga0070701_100052301 342
368 3300005439 Ga0070711_100004446 Ga0070711_1000044467 342
369 3300005440 Ga0070705_100221961 Ga0070705_1002219612 342
370 3300005441 Ga0070700_100000987 Ga0070700_10000098716 342
371 3300005456 Ga0070678_100000064 Ga0070678_10000006432 342
372 3300005457 Ga0070662_100006244 Ga0070662_1000062444 342
373 3300005459 Ga0068867_100004286 Ga0068867_1000042868 342
374 3300005539 Ga0068853_100009293 Ga0068853_1000092935 342
375 3300005543 Ga0070672_100175439 Ga0070672_1001754392 342
376 3300005547 Ga0070693_100015848 Ga0070693_1000158483 342
377 3300005548 Ga0070665_100086934 Ga0070665_1000869343 342
378 3300005549 Ga0070704_100003142 Ga0070704_1000031426 342
379 3300005563 Ga0068855_100011379 Ga0068855_1000113794 342
380 3300005578 Ga0068854_100037849 Ga0068854_1000378493 342
381 3300005615 Ga0070702_100000251 Ga0070702_10000025118 342
382 3300005616 Ga0068852_100446107 Ga0068852_1004461072 342
383 3300005617 Ga0068859_100001203 Ga0068859_10000120317 342
384 3300005718 Ga0068866_10000114 Ga0068866_1000011428 342
385 3300005719 Ga0068861_100001877 Ga0068861_10000187710 342
386 3300005843 Ga0068860_100000645 Ga0068860_10000064529 342
387 3300005844 Ga0068862_100000957 Ga0068862_10000095712 342
388 3300006175 Ga0070712_100001978 Ga0070712_10000197817 342
389 3300006881 Ga0068865_100002572 Ga0068865_1000025728 342
390 3300006931 Ga0097620_100001203 Ga0097620_10000120317 342
391 3300009093 Ga0105240_10146711 Ga0105240_101467113 342
392 3300009098 Ga0105245_10000356 Ga0105245_1000035623 342
393 3300009101 Ga0105247_10000092 Ga0105247_1000009276 342
394 3300009148 Ga0105243_10007691 Ga0105243_100076912 342
395 3300009174 Ga0105241_10066989 Ga0105241_100669892 342
396 3300009176 Ga0105242_10000763 Ga0105242_1000076313 342
397 3300009177 Ga0105248_10019986 Ga0105248_100199867 342
398 3300009553 Ga0105249_10000380 Ga0105249_1000038021 342
399 3300010375 Ga0105239_10009826 Ga0105239_1000982614 342
400 3300013296 Ga0157374_10114341 Ga0157374_101143412 342
401 3300013297 Ga0157378_10022776 Ga0157378_100227764 342
402 3300013307 Ga0157372_10038514 Ga0157372_100385146 342
403 3300013308 Ga0157375_10001562 Ga0157375_1000156218 342
404 3300014326 Ga0157380_10000210 Ga0157380_1000021032 342
405 3300014969 Ga0157376_10109142 Ga0157376_101091422 342
406 3300017792 Ga0163161_10017766 Ga0163161_100177667 342
407 3300025898 Ga0207692_10004073 Ga0207692_100040731 342
408 3300025899 Ga0207642_10123802 Ga0207642_101238021 342
409 3300025900 Ga0207710_10046040 Ga0207710_100460402 342
410 3300025901 Ga0207688_10003016 Ga0207688_100030162 342
411 3300025906 Ga0207699_10098166 Ga0207699_100981661 342
412 3300025907 Ga0207645_10028983 Ga0207645_100289832 342
413 3300025914 Ga0207671_10066845 Ga0207671_100668453 342
414 3300025915 Ga0207693_10000389 Ga0207693_100003893 342
415 3300025916 Ga0207663_10000758 Ga0207663_1000075810 342
416 3300025917 Ga0207660_10177045 Ga0207660_101770452 342
417 3300025919 Ga0207657_10168394 Ga0207657_101683942 342
418 3300025923 Ga0207681_10065581 Ga0207681_100655812 342
419 3300025927 Ga0207687_10001073 Ga0207687_100010732 342
420 3300025933 Ga0207706_10004405 Ga0207706_1000440510 342
421 3300025935 Ga0207709_10060487 Ga0207709_100604871 342
422 3300025936 Ga0207670_10088125 Ga0207670_100881252 342
423 3300025937 Ga0207669_10003561 Ga0207669_100035615 342
424 3300025938 Ga0207704_10001031 Ga0207704_100010311 342
425 3300025939 Ga0207665_10007564 Ga0207665_100075642 342
426 3300025940 Ga0207691_10139216 Ga0207691_101392162 342
427 3300025941 Ga0207711_10011119 Ga0207711_100111197 342
428 3300025942 Ga0207689_10010895 Ga0207689_100108956 342
429 3300025961 Ga0207712_10004935 Ga0207712_100049355 342
430 3300025972 Ga0207668_10300456 Ga0207668_103004561 342
431 3300026023 Ga0207677_10001803 Ga0207677_100018033 342
432 3300026041 Ga0207639_10006949 Ga0207639_100069495 342
433 3300026067 Ga0207678_10050262 Ga0207678_100502623 342
434 3300026075 Ga0207708_10058806 Ga0207708_100588062 342
435 3300026089 Ga0207648_10000908 Ga0207648_1000090814 342
436 3300026118 Ga0207675_100000578 Ga0207675_10000057823 342
437 3300026121 Ga0207683_10000404 Ga0207683_1000040420 342
438 3300026142 Ga0207698_10066555 Ga0207698_100665553 342
439 3300028379 Ga0268266_10272552 Ga0268266_102725522 342
440 3300028381 Ga0268264_10031262 Ga0268264_100312623 342
441 3300035691 Ga0373931_0109507 Ga0373931_0109507_515_1543 342
442 3300048903 Ga0496100_0010478 Ga0496100_0010478_4020_5048 342
443 3300048904 Ga0496101_0004803 Ga0496101_0004803_4603_5631 342
444 3300048906 Ga0496103_0007221 Ga0496103_0007221_94_1122 342
445 3300048909 Ga0496106_0001641 Ga0496106_0001641_11147_12175 342
446 3300048917 Ga0496114_0001706 Ga0496114_0001706_15135_16163 342
447 3300048918 Ga0496115_0007011 Ga0496115_0007011_1762_2790 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

87

266

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v1q-assembly1.cif.gz_A crystal structure of streptococcus suis suib 0.7169 120 311
7bi7-assembly2.cif.gz_B an unexpected p-cluster like intermediate en route to the nitrogenase femo-co 0.7064 120 266
7qbu-assembly2.cif.gz_B b12-dependent radical sam methyltransferase, mmp10 with [4fe-4s] cluster, cobalamin, and s-methyl-5'-thioadenosine bound. 0.7057 120 255
5v1t-assembly1.cif.gz_A crystal structure of streptococcus suis suib bound to precursor peptide suia 0.701 120 311
6efn-assembly1.cif.gz_A-2 structure of a ripp maturase, skfb 0.6688 67 313
ID Description Score Start End Superfamily
af_P9WL79_106_315_3.80.30.30 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; 0.9457 104 312 3.80.30.30
af_P9WL79_106_315_3.80.30.30 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; 0.937 104 312 3.80.30.30
af_P0ADW6_41_234_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8069 137 271 3.80.30.20
af_Q4DSS9_285_412_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7993 204 255 3.40.50.2020
af_Q58096_62_257_3.80.30.30 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; 0.7635 107 315 3.80.30.30
ID Description Score Start End GO Terms
AF-U3P943-F1-model_v4 Radical SAM core domain-containing protein 0.983 140 320 GO:0003824
GO:0046872
GO:0051536
AF-A0A662G755-F1-model_v4 Radical SAM protein 0.9687 185 315 GO:0046872
GO:0051536
AF-A0A1V6N4L9-F1-model_v4 Uncharacterized protein 0.9507 182 314 GO:0046872
GO:0051536
AF-X0XJT8-F1-model_v4 Radical SAM core domain-containing protein 0.9489 185 318 GO:0046872
GO:0051536
AF-A0A235BZQ2-F1-model_v4 Radical SAM protein 0.9488 159 314 GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
72.86 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map