F445969

General Info

Members Datasets Scaffolds Average Seq Length
447 198 894 231

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10352269|Ga0207658_103522692
Length 276
Sequence LIFPRRVRPEKTFHKLLVTGRDKSGNVGGMWLIPPYFLYIRCTEIKTMKIIIVTGASGNLGQAVVKKFLSEGCYVIGTTVPNDPVTISIQDKNFETVTVDLMNEDSASQFITKVIDKHGRVDTAVLTVGGFAMGKIADTKTADMVKQYKLNFETAYNTARPVFNQMIKQKGGQIFMIGSRPGSDMHNSKGMAAYGLAKSLIFRLAELMNDEAKGTNVITSVIVPSTIDTPQNRQSMPDADFNKWVKPEEIAGVIYFYCSENASIIREPVIKVYNNA

Samples

Sample ID Description Type Environment
1 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
137 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
138 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
142 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
147 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
194 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
195 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
196 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
197 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
198 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.22
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0.67
Rhizoplane 0.22
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 15.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207658_10352269 3300025986 Bacteria 1282
2 JGI24751J29686_10000395 3300002459 Bacteria 14494
3 JGI25151J46595_10004301 3300003187 Bacteria 7565
4 rootL2_10132266 3300003322 Bacteria 1743
5 rootH1_10136629 3300003323 Bacteria 1508
6 Ga0065714_10217056 3300005288 Bacteria 851
7 Ga0065712_10068275 3300005290 Bacteria 12255
8 Ga0065715_10001943 3300005293 Bacteria 6820
9 Ga0065707_10009422 3300005295 Bacteria 3810
10 Ga0070676_10016927 3300005328 Unclassified 4030
11 Ga0070683_100478243 3300005329 Bacteria 1189
12 Ga0070670_100036219 3300005331 Bacteria 4247
13 Ga0070670_100172703 3300005331 Bacteria 1875
14 Ga0070677_10126587 3300005333 Unclassified 1161
15 Ga0068869_100019620 3300005334 Bacteria 4624
16 Ga0068869_100020396 3300005334 Unclassified 4544
17 Ga0068869_100034225 3300005334 Unclassified 3593
18 Ga0068869_100184128 3300005334 Unclassified 1639
19 Ga0068869_100262164 3300005334 Bacteria 1384
20 Ga0070666_10009776 3300005335 Bacteria 5995
21 Ga0070666_10011395 3300005335 Bacteria 5578
22 Ga0070666_10032865 3300005335 Bacteria 3429
23 Ga0070666_10075093 3300005335 Bacteria 2305
24 Ga0068868_100022685 3300005338 Bacteria 4741
25 Ga0068868_100052383 3300005338 Bacteria 3213
26 Ga0068868_100052411 3300005338 Bacteria 3212
27 Ga0068868_100339962 3300005338 Unclassified 1283
28 Ga0068868_100422591 3300005338 Bacteria 1154
29 Ga0070689_100069034 3300005340 Bacteria 2757
30 Ga0070689_100070416 3300005340 Bacteria 2731
31 Ga0070668_100006547 3300005347 Bacteria 8631
32 Ga0070668_100199723 3300005347 Unclassified 1641
33 Ga0070668_100245814 3300005347 Bacteria 1484
34 Ga0070669_100015287 3300005353 Bacteria 5468
35 Ga0070669_100072655 3300005353 Bacteria 2547
36 Ga0070669_100267049 3300005353 Bacteria 1367
37 Ga0070669_100356529 3300005353 Bacteria 1188
38 Ga0070669_100749063 3300005353 Bacteria 828
39 Ga0070675_100052423 3300005354 Bacteria 3354
40 Ga0070675_100852576 3300005354 Bacteria 834
41 Ga0070671_100810948 3300005355 Bacteria 815
42 Ga0070673_100037193 3300005364 Unclassified 3707
43 Ga0070688_100015313 3300005365 Bacteria 4360
44 Ga0070688_100036653 3300005365 Bacteria 2984
45 Ga0070688_100136273 3300005365 Bacteria 1662
46 Ga0070688_100353274 3300005365 Bacteria 1077
47 Ga0070667_100203888 3300005367 Bacteria 1755
48 Ga0070667_100241407 3300005367 Bacteria 1613
49 Ga0070667_100292552 3300005367 Bacteria 1465
50 Ga0070667_100346580 3300005367 Bacteria 1344
51 Ga0070667_100502632 3300005367 Bacteria 1111
52 Ga0070700_100089664 3300005441 Bacteria 2004
53 Ga0070678_100018273 3300005456 Bacteria 4543
54 Ga0070678_101030543 3300005456 Bacteria 757
55 Ga0070662_100018171 3300005457 Bacteria 4752
56 Ga0070681_10356211 3300005458 Bacteria 1374
57 Ga0068867_100073155 3300005459 Bacteria 2567
58 Ga0068867_100199696 3300005459 Bacteria 1600
59 Ga0068867_100454157 3300005459 Bacteria 1092
60 Ga0068867_100609583 3300005459 Bacteria 953
61 Ga0070685_10001257 3300005466 Bacteria 13442
62 Ga0070685_10041606 3300005466 Bacteria 2619
63 Ga0070685_10344202 3300005466 Bacteria 1017
64 Ga0070698_100003404 3300005471 Bacteria 17491
65 Ga0070698_100006049 3300005471 Bacteria 13180
66 Ga0070698_100011917 3300005471 Bacteria 9224
67 Ga0070698_100048072 3300005471 Bacteria 4359
68 Ga0070679_100057562 3300005530 Bacteria 3874
69 Ga0070679_100068478 3300005530 Bacteria 3540
70 Ga0070679_100416972 3300005530 Bacteria 1288
71 Ga0070684_100025039 3300005535 Bacteria 5011
72 Ga0070684_100479542 3300005535 Bacteria 1151
73 Ga0068853_100012917 3300005539 Bacteria 6806
74 Ga0068853_100040380 3300005539 Bacteria 3981
75 Ga0068853_100059910 3300005539 Bacteria 3289
76 Ga0068853_100105185 3300005539 Bacteria 2500
77 Ga0068853_100187538 3300005539 Bacteria 1878
78 Ga0068853_100742322 3300005539 Bacteria 938
79 Ga0070672_100034079 3300005543 Unclassified 3861
80 Ga0070672_100166419 3300005543 Unclassified 1832
81 Ga0070672_100354439 3300005543 Bacteria 1251
82 Ga0070665_100089679 3300005548 Bacteria 3080
83 Ga0068855_100190389 3300005563 Bacteria 2314
84 Ga0070664_100025250 3300005564 Bacteria 4923
85 Ga0068854_100482633 3300005578 Unclassified 1041
86 Ga0068856_100105390 3300005614 Bacteria 2813
87 Ga0070702_100066522 3300005615 Bacteria 2114
88 Ga0068852_100494588 3300005616 Unclassified 1217
89 Ga0068859_100000249 3300005617 Bacteria 53191
90 Ga0068859_100025855 3300005617 Bacteria 5889
91 Ga0068859_100028827 3300005617 Bacteria 5567
92 Ga0068859_100047014 3300005617 Bacteria 4334
93 Ga0068859_100049901 3300005617 Bacteria 4204
94 Ga0068859_100062381 3300005617 Bacteria 3757
95 Ga0068859_100140052 3300005617 Unclassified 2493
96 Ga0068859_100237956 3300005617 Bacteria 1909
97 Ga0068859_100315972 3300005617 Bacteria 1656
98 Ga0068859_100445608 3300005617 Bacteria 1391
99 Ga0068859_100451717 3300005617 Bacteria 1381
100 Ga0068864_100012814 3300005618 Bacteria 6933
101 Ga0068864_100016084 3300005618 Bacteria 6226
102 Ga0068864_100031116 3300005618 Bacteria 4526
103 Ga0068864_100033442 3300005618 Bacteria 4371
104 Ga0068864_100048223 3300005618 Unclassified 3661
105 Ga0068864_100111549 3300005618 Bacteria 2437
106 Ga0068864_100275287 3300005618 Bacteria 1569
107 Ga0068864_100576539 3300005618 Bacteria 1090
108 Ga0068866_10017275 3300005718 Bacteria 3242
109 Ga0068866_10049038 3300005718 Unclassified 2137
110 Ga0068866_10088072 3300005718 Unclassified 1684
111 Ga0068861_100040345 3300005719 Bacteria 3491
112 Ga0068861_100227709 3300005719 Bacteria 1579
113 Ga0068861_100373963 3300005719 Bacteria 1257
114 Ga0068861_100953008 3300005719 Bacteria 816
115 Ga0068870_10118578 3300005840 Unclassified 1521
116 Ga0068870_10401754 3300005840 Bacteria 892
117 Ga0068863_100004176 3300005841 Bacteria 14261
118 Ga0068863_100021592 3300005841 Bacteria 6140
119 Ga0068863_100296679 3300005841 Bacteria 1567
120 Ga0068863_100387958 3300005841 Bacteria 1364
121 Ga0068863_100451826 3300005841 Bacteria 1261
122 Ga0068858_100099349 3300005842 Bacteria 2713
123 Ga0068860_100011603 3300005843 Bacteria 8690
124 Ga0068860_100030646 3300005843 Bacteria 5173
125 Ga0068860_100198425 3300005843 Unclassified 1944
126 Ga0068860_100270287 3300005843 Unclassified 1659
127 Ga0068862_100035394 3300005844 Bacteria 4229
128 Ga0068862_100037468 3300005844 Bacteria 4110
129 Ga0068862_100207974 3300005844 Bacteria 1767
130 Ga0068862_100224854 3300005844 Unclassified 1700
131 Ga0068862_100249572 3300005844 Bacteria 1617
132 Ga0081539_10072474 3300005985 Bacteria 1841
133 Ga0075366_10171798 3300006195 Bacteria 1315
134 Ga0097621_100004616 3300006237 Bacteria 9616
135 Ga0068871_100004783 3300006358 Bacteria 9463
136 Ga0068871_100017438 3300006358 Bacteria 5434
137 Ga0068871_100219465 3300006358 Bacteria 1647
138 Ga0075428_100047754 3300006844 Bacteria 4700
139 Ga0075428_100049951 3300006844 Bacteria 4588
140 Ga0075428_100174369 3300006844 Bacteria 2329
141 Ga0075430_100003156 3300006846 Bacteria 13793
142 Ga0075430_100015529 3300006846 Bacteria 6484
143 Ga0075431_100172909 3300006847 Bacteria 2219
144 Ga0075429_100016415 3300006880 Bacteria 6419
145 Ga0075429_100088508 3300006880 Bacteria 2699
146 Ga0068865_100036127 3300006881 Bacteria 3328
147 Ga0068865_100155780 3300006881 Unclassified 1737
148 Ga0068865_100294071 3300006881 Unclassified 1297
149 Ga0068865_100908503 3300006881 Unclassified 766
150 Ga0097620_100000249 3300006931 Bacteria 53191
151 Ga0097620_100005855 3300006931 Bacteria 12473
152 Ga0097620_100025858 3300006931 Bacteria 5889
153 Ga0097620_100028827 3300006931 Bacteria 5567
154 Ga0097620_100047014 3300006931 Bacteria 4334
155 Ga0097620_100049902 3300006931 Bacteria 4204
156 Ga0097620_100062380 3300006931 Bacteria 3757
157 Ga0097620_100140058 3300006931 Unclassified 2493
158 Ga0097620_100237955 3300006931 Bacteria 1909
159 Ga0097620_100315964 3300006931 Bacteria 1656
160 Ga0097620_100408048 3300006931 Bacteria 1455
161 Ga0097620_100445582 3300006931 Bacteria 1391
162 Ga0097620_100451709 3300006931 Bacteria 1381
163 Ga0105240_10853444 3300009093 Bacteria 983
164 Ga0105240_10897028 3300009093 Unclassified 954
165 Ga0111539_10146579 3300009094 Bacteria 2764
166 Ga0111539_10249746 3300009094 Bacteria 2066
167 Ga0111539_10467124 3300009094 Bacteria 1469
168 Ga0105247_10001996 3300009101 Bacteria 14144
169 Ga0105247_10004320 3300009101 Bacteria 9081
170 Ga0105247_10066491 3300009101 Bacteria 2245
171 Ga0114129_10298910 3300009147 Bacteria 2146
172 Ga0105243_10423918 3300009148 Bacteria 1242
173 Ga0105241_10082410 3300009174 Bacteria 2521
174 Ga0105242_10002846 3300009176 Bacteria 13551
175 Ga0105242_10024583 3300009176 Bacteria 4759
176 Ga0105242_10039168 3300009176 Bacteria 3814
177 Ga0105242_10256635 3300009176 Unclassified 1577
178 Ga0105248_10063815 3300009177 Bacteria 4134
179 Ga0105248_10181464 3300009177 Bacteria 2372
180 Ga0105249_10001026 3300009553 Bacteria 24688
181 Ga0105249_10002633 3300009553 Bacteria 15534
182 Ga0105249_10003465 3300009553 Bacteria 13663
183 Ga0105249_10062547 3300009553 Unclassified 3418
184 Ga0105249_10070196 3300009553 Bacteria 3234
185 Ga0105249_10097369 3300009553 Bacteria 2761
186 Ga0105249_10195003 3300009553 Bacteria 1979
187 Ga0105249_10257739 3300009553 Bacteria 1732
188 Ga0105249_10512232 3300009553 Bacteria 1246
189 Ga0105239_10074819 3300010375 Bacteria 3724
190 Ga0105239_10211616 3300010375 Bacteria 2173
191 Ga0105246_10008701 3300011119 Bacteria 6245
192 Ga0105246_10806377 3300011119 Bacteria 833
193 Ga0157370_10201068 3300013104 Bacteria 1848
194 Ga0157369_10072402 3300013105 Bacteria 3699
195 Ga0157369_10302725 3300013105 Unclassified 1663
196 Ga0157374_10001322 3300013296 Bacteria 21102
197 Ga0157374_10011705 3300013296 Bacteria 7610
198 Ga0157374_10053592 3300013296 Bacteria 3760
199 Ga0157374_10061967 3300013296 Bacteria 3504
200 Ga0157374_10347378 3300013296 Unclassified 1474
201 Ga0157374_10573487 3300013296 Unclassified 1137
202 Ga0157374_10637137 3300013296 Bacteria 1077
203 Ga0157378_10118865 3300013297 Unclassified 2433
204 Ga0157378_10227946 3300013297 Bacteria 1774
205 Ga0157378_10249319 3300013297 Bacteria 1699
206 Ga0157378_10849782 3300013297 Bacteria 941
207 Ga0163162_10002150 3300013306 Bacteria 18485
208 Ga0163162_10061508 3300013306 Bacteria 3792
209 Ga0163162_10069010 3300013306 Bacteria 3587
210 Ga0163162_10264451 3300013306 Bacteria 1852
211 Ga0163162_10296421 3300013306 Bacteria 1749
212 Ga0163162_10352676 3300013306 Bacteria 1604
213 Ga0163162_10803733 3300013306 Bacteria 1058
214 Ga0163162_10900158 3300013306 Bacteria 998
215 Ga0163162_11177646 3300013306 Bacteria 869
216 Ga0157372_10003383 3300013307 Bacteria 17209
217 Ga0157372_10012933 3300013307 Bacteria 8897
218 Ga0157372_10172721 3300013307 Bacteria 2501
219 Ga0157372_10313055 3300013307 Bacteria 1827
220 Ga0157372_10651622 3300013307 Bacteria 1226
221 Ga0157372_10714803 3300013307 Bacteria 1165
222 Ga0157375_10002186 3300013308 Bacteria 16910
223 Ga0157375_10040260 3300013308 Bacteria 4504
224 Ga0157375_10063027 3300013308 Bacteria 3687
225 Ga0157375_10284424 3300013308 Bacteria 1817
226 Ga0157375_11266576 3300013308 Unclassified 866
227 Ga0157375_11412087 3300013308 Bacteria 820
228 Ga0163163_10000697 3300014325 Bacteria 28555
229 Ga0163163_10237992 3300014325 Bacteria 1870
230 Ga0163163_10390510 3300014325 Bacteria 1450
231 Ga0163163_10538078 3300014325 Unclassified 1230
232 Ga0157380_10074326 3300014326 Bacteria 2759
233 Ga0157380_10405552 3300014326 Bacteria 1295
234 Ga0157379_10362784 3300014968 Bacteria 1328
235 Ga0157376_10034708 3300014969 Bacteria 4075
236 Ga0163161_10022242 3300017792 Bacteria 4463
237 Ga0163161_10134173 3300017792 Bacteria 1870
238 Ga0163161_10137966 3300017792 Bacteria 1845
239 Ga0163161_10175647 3300017792 Bacteria 1640
240 Ga0213876_10055869 3300021384 Bacteria 2084
241 Ga0209025_1000123 3300025294 Bacteria 204125
242 Ga0209051_1017525 3300025303 Bacteria 3197
243 Ga0207697_10146526 3300025315 Unclassified 1026
244 Ga0207682_10133220 3300025893 Bacteria 1110
245 Ga0207682_10134109 3300025893 Bacteria 1107
246 Ga0207642_10038586 3300025899 Unclassified 2068
247 Ga0207710_10001954 3300025900 Bacteria 9853
248 Ga0207710_10003258 3300025900 Bacteria 7256
249 Ga0207688_10003878 3300025901 Bacteria 8154
250 Ga0207688_10016817 3300025901 Bacteria 3971
251 Ga0207688_10341971 3300025901 Unclassified 921
252 Ga0207680_10023789 3300025903 Bacteria 3351
253 Ga0207680_10132436 3300025903 Bacteria 1644
254 Ga0207647_10139228 3300025904 Unclassified 1423
255 Ga0207685_10008324 3300025905 Bacteria 2948
256 Ga0207645_10000958 3300025907 Bacteria 23890
257 Ga0207645_10002136 3300025907 Bacteria 15798
258 Ga0207645_10374154 3300025907 Bacteria 955
259 Ga0207643_10003410 3300025908 Bacteria 8566
260 Ga0207643_10020355 3300025908 Unclassified 3641
261 Ga0207705_10079644 3300025909 Bacteria 2386
262 Ga0207695_10012638 3300025913 Bacteria 10115
263 Ga0207695_10117732 3300025913 Bacteria 2628
264 Ga0207662_10562043 3300025918 Bacteria 791
265 Ga0207681_10124760 3300025923 Bacteria 1894
266 Ga0207681_10172402 3300025923 Unclassified 1641
267 Ga0207681_10315822 3300025923 Bacteria 1241
268 Ga0207681_10471429 3300025923 Unclassified 1024
269 Ga0207650_10037606 3300025925 Bacteria 3528
270 Ga0207650_10084993 3300025925 Bacteria 2406
271 Ga0207650_10133301 3300025925 Bacteria 1946
272 Ga0207650_10230082 3300025925 Unclassified 1495
273 Ga0207650_10843867 3300025925 Unclassified 777
274 Ga0207659_10018007 3300025926 Bacteria 4623
275 Ga0207659_10182428 3300025926 Bacteria 1664
276 Ga0207706_10040383 3300025933 Bacteria 4135
277 Ga0207706_10044939 3300025933 Bacteria 3913
278 Ga0207706_10207118 3300025933 Unclassified 1720
279 Ga0207686_10004705 3300025934 Bacteria 7318
280 Ga0207686_10048892 3300025934 Bacteria 2622
281 Ga0207670_10053078 3300025936 Bacteria 2729
282 Ga0207669_10024377 3300025937 Unclassified 3251
283 Ga0207669_10079377 3300025937 Unclassified 2095
284 Ga0207669_10164755 3300025937 Unclassified 1570
285 Ga0207704_10063495 3300025938 Unclassified 2302
286 Ga0207704_10847091 3300025938 Unclassified 766
287 Ga0207691_10030320 3300025940 Bacteria 5055
288 Ga0207691_10165644 3300025940 Unclassified 1937
289 Ga0207691_10199824 3300025940 Unclassified 1740
290 Ga0207691_10353167 3300025940 Bacteria 1258
291 Ga0207711_10417253 3300025941 Bacteria 1248
292 Ga0207689_10004687 3300025942 Bacteria 12337
293 Ga0207689_10012871 3300025942 Bacteria 7146
294 Ga0207689_10027029 3300025942 Bacteria 4803
295 Ga0207689_10031168 3300025942 Bacteria 4441
296 Ga0207689_10050019 3300025942 Bacteria 3447
297 Ga0207689_10136188 3300025942 Bacteria 2022
298 Ga0207689_10148771 3300025942 Bacteria 1930
299 Ga0207689_10357032 3300025942 Bacteria 1215
300 Ga0207661_10458843 3300025944 Bacteria 1161
301 Ga0207679_10003197 3300025945 Bacteria 10103
302 Ga0207667_10027241 3300025949 Bacteria 6226
303 Ga0207651_10084457 3300025960 Bacteria 2300
304 Ga0207651_10126805 3300025960 Unclassified 1946
305 Ga0207651_10518526 3300025960 Bacteria 1032
306 Ga0207712_10002991 3300025961 Bacteria 10799
307 Ga0207712_10005446 3300025961 Bacteria 8035
308 Ga0207712_10022679 3300025961 Bacteria 4137
309 Ga0207712_10072427 3300025961 Bacteria 2481
310 Ga0207712_10121150 3300025961 Bacteria 1979
311 Ga0207712_10218245 3300025961 Unclassified 1523
312 Ga0207712_10323984 3300025961 Bacteria 1272
313 Ga0207668_10071525 3300025972 Unclassified 2478
314 Ga0207640_10230128 3300025981 Unclassified 1425
315 Ga0207658_10343487 3300025986 Unclassified 1298
316 Ga0207658_10549489 3300025986 Bacteria 1033
317 Ga0207677_10407400 3300026023 Bacteria 1155
318 Ga0207639_10030076 3300026041 Bacteria 3981
319 Ga0207639_10031612 3300026041 Bacteria 3891
320 Ga0207639_10080305 3300026041 Bacteria 2579
321 Ga0207639_10090699 3300026041 Unclassified 2445
322 Ga0207639_10315260 3300026041 Bacteria 1387
323 Ga0207639_10332514 3300026041 Unclassified 1352
324 Ga0207708_10076205 3300026075 Bacteria 2572
325 Ga0207708_10196044 3300026075 Bacteria 1609
326 Ga0207702_10026966 3300026078 Bacteria 4770
327 Ga0207641_10000380 3300026088 Bacteria 52801
328 Ga0207641_10015756 3300026088 Bacteria 6193
329 Ga0207641_10027933 3300026088 Bacteria 4660
330 Ga0207648_10008276 3300026089 Bacteria 10099
331 Ga0207648_10029474 3300026089 Bacteria 4866
332 Ga0207648_10033503 3300026089 Bacteria 4531
333 Ga0207676_10024446 3300026095 Bacteria 4469
334 Ga0207676_10024760 3300026095 Bacteria 4445
335 Ga0207676_10042231 3300026095 Bacteria 3506
336 Ga0207676_10088070 3300026095 Bacteria 2541
337 Ga0207676_10093562 3300026095 Bacteria 2475
338 Ga0207676_10120611 3300026095 Bacteria 2211
339 Ga0207676_10135109 3300026095 Bacteria 2103
340 Ga0207676_10135403 3300026095 Unclassified 2101
341 Ga0207674_10031075 3300026116 Bacteria 5611
342 Ga0207675_100017193 3300026118 Bacteria 6754
343 Ga0207675_100173484 3300026118 Unclassified 2062
344 Ga0207675_100246528 3300026118 Bacteria 1728
345 Ga0207675_100256492 3300026118 Bacteria 1694
346 Ga0207675_100358006 3300026118 Bacteria 1431
347 Ga0207675_100467017 3300026118 Bacteria 1252
348 Ga0207683_10002824 3300026121 Bacteria 15171
349 Ga0207683_10048399 3300026121 Bacteria 3723
350 Ga0207698_10118482 3300026142 Bacteria 2236
351 Ga0207698_10240481 3300026142 Bacteria 1650
352 Ga0207428_10246911 3300027907 Bacteria 1332
353 Ga0207428_10263781 3300027907 Bacteria 1282
354 Ga0268266_10597148 3300028379 Unclassified 1060
355 Ga0268265_10041445 3300028380 Bacteria 3408
356 Ga0268265_10072064 3300028380 Bacteria 2694
357 Ga0268265_10080011 3300028380 Bacteria 2576
358 Ga0268265_10097845 3300028380 Bacteria 2362
359 Ga0268265_10105152 3300028380 Unclassified 2290
360 Ga0268265_10365355 3300028380 Bacteria 1323
361 Ga0268264_10058346 3300028381 Bacteria 3232
362 Ga0268264_10076115 3300028381 Unclassified 2855
363 Ga0268264_10096890 3300028381 Bacteria 2556
364 Ga0268264_10098510 3300028381 Bacteria 2535
365 Ga0268264_10124406 3300028381 Bacteria 2277
366 Ga0307515_10000001 3300028794 Bacteria 4259510
367 Ga0265327_10000219 3300031251 Bacteria 116606
368 Ga0316579_10104346 3300031691 Bacteria 1359
369 Ga0316578_10027326 3300031728 Bacteria 3224
370 Ga0316577_10000530 3300031733 Bacteria 15344
371 Ga0307416_100209745 3300032002 Archaea 1857
372 Ga0307414_10208384 3300032004 Bacteria 1596
373 Ga0307414_10308415 3300032004 Bacteria 1342
374 Ga0316585_10048147 3300032137 Unclassified 1366
375 Ga0316593_10021280 3300032168 Bacteria 2027
376 Ga0316582_0035057 3300036647 Bacteria 3095
377 Ga0316584_0043112 3300036712 Unclassified 3364
378 Ga0436365_1426137 3300039437 Bacteria 9898
379 Ga0436365_1824164 3300039437 Bacteria 746
380 Ga0451804_0484573 3300041463 Bacteria 1955
381 Ga0439442_007016 3300042002 Bacteria 2262
382 Ga0439445_0032761 3300042004 Unclassified 1356
383 Ga0439457_027478 3300042014 Bacteria 1260
384 Ga0439446_0042182 3300042156 Bacteria 1346
385 Ga0439434_0039395 3300042435 Bacteria 1450
386 Ga0453684_0142096 3300044712 Bacteria 2865
387 Ga0495638_0158474 3300046460 Bacteria 1308
388 Ga0495636_0000702 3300047318 Bacteria 12217
389 Ga0495672_0027367 3300047320 Unclassified 3624
390 Ga0495685_018381 3300047447 Bacteria 2399
391 Ga0495686_0227609 3300047472 Bacteria 1057
392 Ga0501031_0012253 3300049568 Archaea 5588
393 Ga0501031_0016660 3300049568 Bacteria 4773
394 Ga0501033_0240281 3300049570 Archaea 1285
395 Ga0501034_0000022 3300049571 Bacteria 264441
396 Ga0501034_0000277 3300049571 Bacteria 92445
397 Ga0501036_0007654 3300049572 Bacteria 8817
398 Ga0501036_0014621 3300049572 Archaea 6538
399 Ga0501037_0007544 3300049573 Bacteria 7966
400 Ga0501037_0043805 3300049573 Archaea 3289
401 Ga0501038_0184579 3300049574 Archaea 1681
402 Ga0501039_0273577 3300049575 Archaea 1327
403 Ga0501040_0171637 3300049576 Archaea 1535
404 Ga0501041_0013323 3300049577 Archaea 4872
405 Ga0501042_0118876 3300049578 Archaea 1902
406 Ga0501043_0005718 3300049579 Bacteria 10017
407 Ga0501043_0057656 3300049579 Bacteria 3049
408 Ga0501046_0007172 3300049580 Bacteria 9808
409 Ga0501046_0151510 3300049580 Archaea 1749
410 Ga0501046_0186164 3300049580 Bacteria 1550
411 Ga0501047_0227457 3300049581 Bacteria 1720
412 Ga0501047_0283337 3300049581 Unclassified 1501
413 Ga0501048_0059349 3300049582 Archaea 2711
414 Ga0501048_0133110 3300049582 Unclassified 1757
415 Ga0501070_0467490 3300049586 Bacteria 1016
416 Ga0501072_0022245 3300049588 Archaea 4918
417 Ga0501073_0028428 3300049589 Bacteria 3995
418 Ga0501074_0000591 3300049590 Bacteria 22526
419 Ga0501075_0019313 3300049591 Archaea 4941
420 Ga0501076_0025379 3300049592 Archaea 4585
421 Ga0501079_0366624 3300049741 Unclassified 1129
422 Ga0501080_0125228 3300049742 Archaea 2380
423 Ga0501081_0201195 3300049743 Archaea 1444
424 Ga0501035_0003701 3300049822 Bacteria 14580
425 Ga0501035_0110003 3300049822 Unclassified 2415
426 Ga0501035_0243100 3300049822 Archaea 1530
427 Ga0501044_0018327 3300049823 Bacteria 7503
428 Ga0501044_0035998 3300049823 Bacteria 5180
429 Ga0501044_0258599 3300049823 Archaea 1680
430 nmdc:mga05p37_494134_c1 3300050507 Bacteria 1406
431 nmdc:mga09592_86782_c1 3300050508 Unclassified 2671
432 nmdc:mga0qj67_26743_c1 3300050509 Bacteria 4468
433 nmdc:mga0qj67_295398_c1 3300050509 Bacteria 1313
434 nmdc:mga06r32_116279_c1 3300050510 Bacteria 2635
435 nmdc:mga06r32_275999_c1 3300050510 Bacteria 1668
436 nmdc:mga08y16_521372_c1 3300050511 Bacteria 1205
437 Ga0500641_0064589 3300053096 Bacteria 1529
438 Ga0500568_0001298 3300053139 Bacteria 16407
439 Ga0500611_000011 3300053727 Bacteria 141259
440 Ga0501084_0157611 3300054114 Bacteria 1915
441 Ga0501082_0113261 3300060353 Bacteria 2349
442 Ga0530510_0014082 3300061734 Archaea 5638
443 2513954683 2513237150 Bacteria 6553639
444 2514043568 2513237165 Bacteria 6771773
445 2834644543 2834641062 Bacteria 5559922
446 644752219 644736347 Bacteria 6476522
447 8003404074 8003400568 Bacteria 5535898
448 Ga0207658_10352269
449 JGI24751J29686_10000395
450 JGI25151J46595_10004301
451 rootL2_10132266
452 rootH1_10136629
453 Ga0065714_10217056
454 Ga0065712_10068275
455 Ga0065715_10001943
456 Ga0065707_10009422
457 Ga0070676_10016927
458 Ga0070683_100478243
459 Ga0070670_100036219
460 Ga0070670_100172703
461 Ga0070677_10126587
462 Ga0068869_100019620
463 Ga0068869_100020396
464 Ga0068869_100034225
465 Ga0068869_100184128
466 Ga0068869_100262164
467 Ga0070666_10009776
468 Ga0070666_10011395
469 Ga0070666_10032865
470 Ga0070666_10075093
471 Ga0068868_100022685
472 Ga0068868_100052383
473 Ga0068868_100052411
474 Ga0068868_100339962
475 Ga0068868_100422591
476 Ga0070689_100069034
477 Ga0070689_100070416
478 Ga0070668_100006547
479 Ga0070668_100199723
480 Ga0070668_100245814
481 Ga0070669_100015287
482 Ga0070669_100072655
483 Ga0070669_100267049
484 Ga0070669_100356529
485 Ga0070669_100749063
486 Ga0070675_100052423
487 Ga0070675_100852576
488 Ga0070671_100810948
489 Ga0070673_100037193
490 Ga0070688_100015313
491 Ga0070688_100036653
492 Ga0070688_100136273
493 Ga0070688_100353274
494 Ga0070667_100203888
495 Ga0070667_100241407
496 Ga0070667_100292552
497 Ga0070667_100346580
498 Ga0070667_100502632
499 Ga0070700_100089664
500 Ga0070678_100018273
501 Ga0070678_101030543
502 Ga0070662_100018171
503 Ga0070681_10356211
504 Ga0068867_100073155
505 Ga0068867_100199696
506 Ga0068867_100454157
507 Ga0068867_100609583
508 Ga0070685_10001257
509 Ga0070685_10041606
510 Ga0070685_10344202
511 Ga0070698_100003404
512 Ga0070698_100006049
513 Ga0070698_100011917
514 Ga0070698_100048072
515 Ga0070679_100057562
516 Ga0070679_100068478
517 Ga0070679_100416972
518 Ga0070684_100025039
519 Ga0070684_100479542
520 Ga0068853_100012917
521 Ga0068853_100040380
522 Ga0068853_100059910
523 Ga0068853_100105185
524 Ga0068853_100187538
525 Ga0068853_100742322
526 Ga0070672_100034079
527 Ga0070672_100166419
528 Ga0070672_100354439
529 Ga0070665_100089679
530 Ga0068855_100190389
531 Ga0070664_100025250
532 Ga0068854_100482633
533 Ga0068856_100105390
534 Ga0070702_100066522
535 Ga0068852_100494588
536 Ga0068859_100000249
537 Ga0068859_100025855
538 Ga0068859_100028827
539 Ga0068859_100047014
540 Ga0068859_100049901
541 Ga0068859_100062381
542 Ga0068859_100140052
543 Ga0068859_100237956
544 Ga0068859_100315972
545 Ga0068859_100445608
546 Ga0068859_100451717
547 Ga0068864_100012814
548 Ga0068864_100016084
549 Ga0068864_100031116
550 Ga0068864_100033442
551 Ga0068864_100048223
552 Ga0068864_100111549
553 Ga0068864_100275287
554 Ga0068864_100576539
555 Ga0068866_10017275
556 Ga0068866_10049038
557 Ga0068866_10088072
558 Ga0068861_100040345
559 Ga0068861_100227709
560 Ga0068861_100373963
561 Ga0068861_100953008
562 Ga0068870_10118578
563 Ga0068870_10401754
564 Ga0068863_100004176
565 Ga0068863_100021592
566 Ga0068863_100296679
567 Ga0068863_100387958
568 Ga0068863_100451826
569 Ga0068858_100099349
570 Ga0068860_100011603
571 Ga0068860_100030646
572 Ga0068860_100198425
573 Ga0068860_100270287
574 Ga0068862_100035394
575 Ga0068862_100037468
576 Ga0068862_100207974
577 Ga0068862_100224854
578 Ga0068862_100249572
579 Ga0081539_10072474
580 Ga0075366_10171798
581 Ga0097621_100004616
582 Ga0068871_100004783
583 Ga0068871_100017438
584 Ga0068871_100219465
585 Ga0075428_100047754
586 Ga0075428_100049951
587 Ga0075428_100174369
588 Ga0075430_100003156
589 Ga0075430_100015529
590 Ga0075431_100172909
591 Ga0075429_100016415
592 Ga0075429_100088508
593 Ga0068865_100036127
594 Ga0068865_100155780
595 Ga0068865_100294071
596 Ga0068865_100908503
597 Ga0097620_100000249
598 Ga0097620_100005855
599 Ga0097620_100025858
600 Ga0097620_100028827
601 Ga0097620_100047014
602 Ga0097620_100049902
603 Ga0097620_100062380
604 Ga0097620_100140058
605 Ga0097620_100237955
606 Ga0097620_100315964
607 Ga0097620_100408048
608 Ga0097620_100445582
609 Ga0097620_100451709
610 Ga0105240_10853444
611 Ga0105240_10897028
612 Ga0111539_10146579
613 Ga0111539_10249746
614 Ga0111539_10467124
615 Ga0105247_10001996
616 Ga0105247_10004320
617 Ga0105247_10066491
618 Ga0114129_10298910
619 Ga0105243_10423918
620 Ga0105241_10082410
621 Ga0105242_10002846
622 Ga0105242_10024583
623 Ga0105242_10039168
624 Ga0105242_10256635
625 Ga0105248_10063815
626 Ga0105248_10181464
627 Ga0105249_10001026
628 Ga0105249_10002633
629 Ga0105249_10003465
630 Ga0105249_10062547
631 Ga0105249_10070196
632 Ga0105249_10097369
633 Ga0105249_10195003
634 Ga0105249_10257739
635 Ga0105249_10512232
636 Ga0105239_10074819
637 Ga0105239_10211616
638 Ga0105246_10008701
639 Ga0105246_10806377
640 Ga0157370_10201068
641 Ga0157369_10072402
642 Ga0157369_10302725
643 Ga0157374_10001322
644 Ga0157374_10011705
645 Ga0157374_10053592
646 Ga0157374_10061967
647 Ga0157374_10347378
648 Ga0157374_10573487
649 Ga0157374_10637137
650 Ga0157378_10118865
651 Ga0157378_10227946
652 Ga0157378_10249319
653 Ga0157378_10849782
654 Ga0163162_10002150
655 Ga0163162_10061508
656 Ga0163162_10069010
657 Ga0163162_10264451
658 Ga0163162_10296421
659 Ga0163162_10352676
660 Ga0163162_10803733
661 Ga0163162_10900158
662 Ga0163162_11177646
663 Ga0157372_10003383
664 Ga0157372_10012933
665 Ga0157372_10172721
666 Ga0157372_10313055
667 Ga0157372_10651622
668 Ga0157372_10714803
669 Ga0157375_10002186
670 Ga0157375_10040260
671 Ga0157375_10063027
672 Ga0157375_10284424
673 Ga0157375_11266576
674 Ga0157375_11412087
675 Ga0163163_10000697
676 Ga0163163_10237992
677 Ga0163163_10390510
678 Ga0163163_10538078
679 Ga0157380_10074326
680 Ga0157380_10405552
681 Ga0157379_10362784
682 Ga0157376_10034708
683 Ga0163161_10022242
684 Ga0163161_10134173
685 Ga0163161_10137966
686 Ga0163161_10175647
687 Ga0213876_10055869
688 Ga0209025_1000123
689 Ga0209051_1017525
690 Ga0207697_10146526
691 Ga0207682_10133220
692 Ga0207682_10134109
693 Ga0207642_10038586
694 Ga0207710_10001954
695 Ga0207710_10003258
696 Ga0207688_10003878
697 Ga0207688_10016817
698 Ga0207688_10341971
699 Ga0207680_10023789
700 Ga0207680_10132436
701 Ga0207647_10139228
702 Ga0207685_10008324
703 Ga0207645_10000958
704 Ga0207645_10002136
705 Ga0207645_10374154
706 Ga0207643_10003410
707 Ga0207643_10020355
708 Ga0207705_10079644
709 Ga0207695_10012638
710 Ga0207695_10117732
711 Ga0207662_10562043
712 Ga0207681_10124760
713 Ga0207681_10172402
714 Ga0207681_10315822
715 Ga0207681_10471429
716 Ga0207650_10037606
717 Ga0207650_10084993
718 Ga0207650_10133301
719 Ga0207650_10230082
720 Ga0207650_10843867
721 Ga0207659_10018007
722 Ga0207659_10182428
723 Ga0207706_10040383
724 Ga0207706_10044939
725 Ga0207706_10207118
726 Ga0207686_10004705
727 Ga0207686_10048892
728 Ga0207670_10053078
729 Ga0207669_10024377
730 Ga0207669_10079377
731 Ga0207669_10164755
732 Ga0207704_10063495
733 Ga0207704_10847091
734 Ga0207691_10030320
735 Ga0207691_10165644
736 Ga0207691_10199824
737 Ga0207691_10353167
738 Ga0207711_10417253
739 Ga0207689_10004687
740 Ga0207689_10012871
741 Ga0207689_10027029
742 Ga0207689_10031168
743 Ga0207689_10050019
744 Ga0207689_10136188
745 Ga0207689_10148771
746 Ga0207689_10357032
747 Ga0207661_10458843
748 Ga0207679_10003197
749 Ga0207667_10027241
750 Ga0207651_10084457
751 Ga0207651_10126805
752 Ga0207651_10518526
753 Ga0207712_10002991
754 Ga0207712_10005446
755 Ga0207712_10022679
756 Ga0207712_10072427
757 Ga0207712_10121150
758 Ga0207712_10218245
759 Ga0207712_10323984
760 Ga0207668_10071525
761 Ga0207640_10230128
762 Ga0207658_10343487
763 Ga0207658_10549489
764 Ga0207677_10407400
765 Ga0207639_10030076
766 Ga0207639_10031612
767 Ga0207639_10080305
768 Ga0207639_10090699
769 Ga0207639_10315260
770 Ga0207639_10332514
771 Ga0207708_10076205
772 Ga0207708_10196044
773 Ga0207702_10026966
774 Ga0207641_10000380
775 Ga0207641_10015756
776 Ga0207641_10027933
777 Ga0207648_10008276
778 Ga0207648_10029474
779 Ga0207648_10033503
780 Ga0207676_10024446
781 Ga0207676_10024760
782 Ga0207676_10042231
783 Ga0207676_10088070
784 Ga0207676_10093562
785 Ga0207676_10120611
786 Ga0207676_10135109
787 Ga0207676_10135403
788 Ga0207674_10031075
789 Ga0207675_100017193
790 Ga0207675_100173484
791 Ga0207675_100246528
792 Ga0207675_100256492
793 Ga0207675_100358006
794 Ga0207675_100467017
795 Ga0207683_10002824
796 Ga0207683_10048399
797 Ga0207698_10118482
798 Ga0207698_10240481
799 Ga0207428_10246911
800 Ga0207428_10263781
801 Ga0268266_10597148
802 Ga0268265_10041445
803 Ga0268265_10072064
804 Ga0268265_10080011
805 Ga0268265_10097845
806 Ga0268265_10105152
807 Ga0268265_10365355
808 Ga0268264_10058346
809 Ga0268264_10076115
810 Ga0268264_10096890
811 Ga0268264_10098510
812 Ga0268264_10124406
813 Ga0307515_10000001
814 Ga0265327_10000219
815 Ga0316579_10104346
816 Ga0316578_10027326
817 Ga0316577_10000530
818 Ga0307416_100209745
819 Ga0307414_10208384
820 Ga0307414_10308415
821 Ga0316585_10048147
822 Ga0316593_10021280
823 Ga0316582_0035057
824 Ga0316584_0043112
825 Ga0436365_1426137
826 Ga0436365_1824164
827 Ga0451804_0484573
828 Ga0439442_007016
829 Ga0439445_0032761
830 Ga0439457_027478
831 Ga0439446_0042182
832 Ga0439434_0039395
833 Ga0453684_0142096
834 Ga0495638_0158474
835 Ga0495636_0000702
836 Ga0495672_0027367
837 Ga0495685_018381
838 Ga0495686_0227609
839 Ga0501031_0012253
840 Ga0501031_0016660
841 Ga0501033_0240281
842 Ga0501034_0000022
843 Ga0501034_0000277
844 Ga0501036_0007654
845 Ga0501036_0014621
846 Ga0501037_0007544
847 Ga0501037_0043805
848 Ga0501038_0184579
849 Ga0501039_0273577
850 Ga0501040_0171637
851 Ga0501041_0013323
852 Ga0501042_0118876
853 Ga0501043_0005718
854 Ga0501043_0057656
855 Ga0501046_0007172
856 Ga0501046_0151510
857 Ga0501046_0186164
858 Ga0501047_0227457
859 Ga0501047_0283337
860 Ga0501048_0059349
861 Ga0501048_0133110
862 Ga0501070_0467490
863 Ga0501072_0022245
864 Ga0501073_0028428
865 Ga0501074_0000591
866 Ga0501075_0019313
867 Ga0501076_0025379
868 Ga0501079_0366624
869 Ga0501080_0125228
870 Ga0501081_0201195
871 Ga0501035_0003701
872 Ga0501035_0110003
873 Ga0501035_0243100
874 Ga0501044_0018327
875 Ga0501044_0035998
876 Ga0501044_0258599
877 nmdc:mga05p37_494134_c1
878 nmdc:mga09592_86782_c1
879 nmdc:mga0qj67_26743_c1
880 nmdc:mga0qj67_295398_c1
881 nmdc:mga06r32_116279_c1
882 nmdc:mga06r32_275999_c1
883 nmdc:mga08y16_521372_c1
884 Ga0500641_0064589
885 Ga0500568_0001298
886 Ga0500611_000011
887 Ga0501084_0157611
888 Ga0501082_0113261
889 Ga0530510_0014082
890 2513954683
891 2514043568
892 2834644543
893 644752219
894 8003404074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

49

240

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

55

272

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

51

234

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sbv-assembly2.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (adp bound) 0.9154 2 226
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.911 2 225
4qec-assembly1.cif.gz_A elxo with nadp bound 0.9107 2 225
5ovl-assembly1.cif.gz_D crystal structure of maba bound to nadp+ from m. smegmatis 0.906 4 225
8sbw-assembly1.cif.gz_A crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (apo, orthorhombic form) 0.9037 2 229
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9296 2 35 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9193 2 174 3.40.50.720
2fwmX00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9037 2 225 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9035 3 178 3.40.50.720
af_A0A1D6GEP1_1_92_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9015 2 38 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A832BKX5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9956 2 229 GO:0016491
AF-A0A832BKX5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9869 2 229 GO:0016491
AF-A0A1V9G635-F1-model_v4 Short-chain dehydrogenase 0.9788 2 229 GO:0050664
AF-A0A1V9FJJ9-F1-model_v4 Short-chain dehydrogenase 0.9767 2 229 GO:0016491
AF-A0A395LZS9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9759 2 229 GO:0016491

Map