F445972

General Info

Members Datasets Scaffolds Average Seq Length
447 323 894 174

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10000008|Ga0265324_1000000820
Length 184
Sequence LNLRWQVMAIRAVLRMGDVHLLQQAEELRVFDTPELHALLADMRDTMHALDGVGLAAPQIGVGLRVVIFEVSSNPRYPDAETVPQTVLINPVLTPLSDTMEEGWEGCLSVPGMRGLVPRYTHLRYQGRDEYGALIDRSVSGFHARVVQHECDHLDGILYPMRIRDMRNFGFNEAMFPGEEVQDE

Samples

Sample ID Description Type Environment
1 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
110 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
115 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
116 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
117 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
121 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
185 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
204 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
241 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
242 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
246 2511231004 Pseudomonas sp. GM102 Isolate Nodule
247 2511231007 Pseudomonas sp. GM18 Isolate Nodule
248 2511231008 Pseudomonas sp. GM21 Isolate Nodule
249 2511231010 Pseudomonas sp. GM25 Isolate Nodule
250 2511231011 Pseudomonas sp. GM30 Isolate Nodule
251 2511231012 Pseudomonas sp. GM33 Isolate Nodule
252 2511231014 Pseudomonas sp. GM48 Isolate Nodule
253 2511231015 Pseudomonas sp. GM49 Isolate Nodule
254 2511231016 Pseudomonas sp. GM50 Isolate Nodule
255 2511231017 Pseudomonas sp. GM55 Isolate Nodule
256 2511231022 Pseudomonas sp. GM79 Isolate Nodule
257 2511231023 Pseudomonas sp. GM80 Isolate Nodule
258 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
259 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
260 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
261 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
262 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
263 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
264 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
265 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
266 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
267 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
268 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
269 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
270 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
271 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
272 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
273 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
274 2773857670 Pseudomonas sp. 478 Isolate Unclassified
275 2773857673 Pseudomonas sp. 443 Isolate Unclassified
276 2784132063 Pseudomonas sp. 424 Isolate Unclassified
277 2784132072 Pseudomonas sp. 460 Isolate Unclassified
278 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
279 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
280 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
281 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
282 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
283 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
284 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
285 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
286 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
287 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
288 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
289 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
290 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
291 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
292 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
293 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
294 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
295 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
296 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
297 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
298 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
299 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
300 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
301 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
302 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
303 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
304 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
305 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
306 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
307 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
308 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
309 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
310 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
311 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
312 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
313 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
314 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
315 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
316 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
317 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
318 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
319 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
320 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
321 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
322 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
323 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.55
Metatranscriptomes 0
Isolates 17.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 2.68
Rhizoplane 2.46
Rhizosphere 82.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265324_10000008 3300029957 Bacteria 259947
2 SwRhRL2b_contig_3166003 2162886007 Bacteria 3735
3 Ga0055538_1000002 3300003751 Bacteria 999437
4 Ga0055539_1000002 3300003752 Bacteria 999437
5 Ga0055533_1000004 3300003756 Bacteria 999437
6 Ga0055525_1000002 3300003759 Bacteria 999437
7 Ga0055541_1000002 3300003841 Bacteria 896405
8 Ga0070690_100059431 3300005330 Bacteria 2457
9 Ga0070659_100018995 3300005366 Bacteria 5197
10 Ga0070700_100027129 3300005441 Bacteria 3393
11 Ga0070700_100607382 3300005441 Bacteria 858
12 Ga0070663_100898381 3300005455 Bacteria 765
13 Ga0070662_100554229 3300005457 Bacteria 963
14 Ga0070679_100610147 3300005530 Bacteria 1034
15 Ga0070684_100042163 3300005535 Bacteria 3939
16 Ga0070697_100001705 3300005536 Bacteria 16785
17 Ga0068855_100001741 3300005563 Bacteria 27181
18 Ga0068855_100515589 3300005563 Bacteria 1298
19 Ga0068855_101078592 3300005563 Bacteria 840
20 Ga0070664_100138253 3300005564 Bacteria 2143
21 Ga0068854_100051852 3300005578 Bacteria 2941
22 Ga0070702_100065669 3300005615 Bacteria 2126
23 Ga0070702_100188408 3300005615 Bacteria 1355
24 Ga0068859_100366057 3300005617 Bacteria 1537
25 Ga0068859_100669876 3300005617 Bacteria 1129
26 Ga0068864_100280225 3300005618 Bacteria 1556
27 Ga0068851_10312235 3300005834 Bacteria 906
28 Ga0068863_100484407 3300005841 Bacteria 1217
29 Ga0068858_100044568 3300005842 Bacteria 4111
30 Ga0068858_100262868 3300005842 Bacteria 1641
31 Ga0075366_10002796 3300006195 Bacteria 9022
32 Ga0097621_100021280 3300006237 Bacteria 5013
33 Ga0068871_100002565 3300006358 Bacteria 12407
34 Ga0075430_100250838 3300006846 Bacteria 1466
35 Ga0075433_11029066 3300006852 Bacteria 717
36 Ga0068865_100873176 3300006881 Bacteria 780
37 Ga0097620_100366031 3300006931 Bacteria 1537
38 Ga0097620_100669893 3300006931 Bacteria 1129
39 Ga0105251_10000268 3300009011 Bacteria 52036
40 Ga0105250_10123424 3300009092 Bacteria 1066
41 Ga0105240_10097593 3300009093 Bacteria 3580
42 Ga0105240_10442186 3300009093 Bacteria 1457
43 Ga0111539_10007340 3300009094 Bacteria 14116
44 Ga0111539_10157499 3300009094 Bacteria 2657
45 Ga0111539_10959333 3300009094 Bacteria 994
46 Ga0105245_10130564 3300009098 Bacteria 2356
47 Ga0114129_10064085 3300009147 Bacteria 5129
48 Ga0105243_10017031 3300009148 Bacteria 5495
49 Ga0105243_10113095 3300009148 Bacteria 2276
50 Ga0105241_10170626 3300009174 Bacteria 1797
51 Ga0105242_10049101 3300009176 Bacteria 3433
52 Ga0105248_10194423 3300009177 Bacteria 2286
53 Ga0105237_10014721 3300009545 Bacteria 8167
54 Ga0105238_10000977 3300009551 Bacteria 29236
55 Ga0105238_10265924 3300009551 Bacteria 1695
56 Ga0105246_10566989 3300011119 Bacteria 976
57 Ga0157370_10047742 3300013104 Bacteria 4103
58 Ga0157370_10095123 3300013104 Bacteria 2795
59 Ga0163162_11092377 3300013306 Bacteria 904
60 Ga0157372_10037230 3300013307 Bacteria 5365
61 Ga0163163_10175587 3300014325 Bacteria 2189
62 Ga0182008_10000515 3300014497 Bacteria 29030
63 Ga0182008_10113232 3300014497 Bacteria 1345
64 Ga0157379_11131953 3300014968 Bacteria 751
65 Ga0157376_10011821 3300014969 Bacteria 6454
66 Ga0157376_10375426 3300014969 Bacteria 1368
67 Ga0182006_1000112 3300015261 Bacteria 87378
68 Ga0182006_1011405 3300015261 Bacteria 3912
69 Ga0182006_1032526 3300015261 Bacteria 2096
70 Ga0182007_10000020 3300015262 Bacteria 194053
71 Ga0182005_1000001 3300015265 Bacteria 1014869
72 Ga0182005_1016912 3300015265 Bacteria 2021
73 Ga0209784_100002 3300025224 Bacteria 1753105
74 Ga0209566_100003 3300025225 Bacteria 1753105
75 Ga0209674_100004 3300025226 Bacteria 1753105
76 Ga0209672_103329 3300025228 Bacteria 3371
77 Ga0209563_100006 3300025230 Bacteria 1753105
78 Ga0209437_100053 3300025233 Bacteria 375580
79 Ga0209677_100003 3300025253 Bacteria 1753105
80 Ga0207656_10163713 3300025321 Bacteria 1060
81 Ga0207696_1000044 3300025711 Bacteria 300953
82 Ga0207713_1000013 3300025735 Bacteria 475751
83 Ga0207695_10013645 3300025913 Bacteria 9675
84 Ga0207671_10018653 3300025914 Bacteria 5316
85 Ga0207649_10004863 3300025920 Bacteria 7267
86 Ga0207694_10039691 3300025924 Bacteria 3623
87 Ga0207690_10021194 3300025932 Bacteria 4027
88 Ga0207686_10056326 3300025934 Bacteria 2471
89 Ga0207711_10222160 3300025941 Bacteria 1728
90 Ga0207679_10013087 3300025945 Bacteria 5432
91 Ga0207667_10000036 3300025949 Bacteria 297966
92 Ga0207667_10081172 3300025949 Bacteria 3359
93 Ga0207667_11193722 3300025949 Bacteria 741
94 Ga0207640_10023722 3300025981 Bacteria 3691
95 Ga0207640_10339567 3300025981 Bacteria 1202
96 Ga0207658_10681503 3300025986 Bacteria 928
97 Ga0207703_10006062 3300026035 Bacteria 9668
98 Ga0207703_10112325 3300026035 Bacteria 2327
99 Ga0207641_10408044 3300026088 Bacteria 1306
100 Ga0207676_10175192 3300026095 Bacteria 1873
101 Ga0209981_1005799 3300027378 Bacteria 1647
102 Ga0209968_1013816 3300027526 Bacteria 1269
103 Ga0207428_10009441 3300027907 Bacteria 8740
104 Ga0207428_10017731 3300027907 Bacteria 6107
105 Ga0265318_10019700 3300028577 Bacteria 2733
106 Ga0265336_10000931 3300028666 Bacteria 14816
107 Ga0265338_10098868 3300028800 Bacteria 2386
108 Ga0265324_10000813 3300029957 Bacteria 20352
109 Ga0316182_1089273 3300030745 Bacteria 741
110 Ga0265330_10029320 3300031235 Bacteria 2475
111 Ga0265332_10023432 3300031238 Bacteria 2722
112 Ga0265320_10016343 3300031240 Bacteria 4161
113 Ga0265325_10000154 3300031241 Bacteria 48571
114 Ga0265325_10074594 3300031241 Bacteria 1696
115 Ga0265329_10018599 3300031242 Bacteria 2373
116 Ga0265331_10009344 3300031250 Bacteria 5508
117 Ga0265331_10034042 3300031250 Bacteria 2516
118 Ga0307408_100847225 3300031548 Bacteria 833
119 Ga0265314_10000136 3300031711 Bacteria 109906
120 Ga0265314_10008502 3300031711 Bacteria 8776
121 Ga0265314_10019805 3300031711 Bacteria 5203
122 Ga0265342_10062451 3300031712 Bacteria 2192
123 Ga0307410_10092515 3300031852 Bacteria 2150
124 Ga0307407_10625710 3300031903 Bacteria 804
125 Ga0307409_101191950 3300031995 Bacteria 785
126 Ga0307411_10130526 3300032005 Bacteria 1836
127 Ga0307411_10202140 3300032005 Bacteria 1527
128 Ga0373960_0004285 3300035121 Bacteria 3259
129 Ga0373960_0014564 3300035121 Bacteria 1995
130 Ga0373942_0040261 3300035207 Bacteria 1274
131 Ga0373961_0005880 3300035241 Bacteria 2948
132 Ga0373961_0010109 3300035241 Bacteria 2321
133 Ga0373931_0009704 3300035691 Bacteria 4609
134 Ga0395899_0002047 3300037312 Bacteria 16612
135 Ga0395899_0009612 3300037312 Bacteria 7421
136 Ga0395900_0002186 3300037418 Bacteria 21856
137 Ga0395900_0164245 3300037418 Bacteria 2263
138 Ga0395900_0217505 3300037418 Bacteria 1927
139 Ga0395898_0071146 3300037466 Bacteria 3362
140 Ga0395898_0174523 3300037466 Bacteria 2054
141 Ga0395898_0251006 3300037466 Bacteria 1687
142 Ga0395905_0200968 3300037471 Bacteria 1868
143 Ga0395901_0009268 3300038443 Bacteria 9982
144 Ga0395901_0176429 3300038443 Bacteria 2241
145 Ga0395901_0885606 3300038443 Bacteria 875
146 Ga0436361_0560696 3300039447 Bacteria 5389
147 Ga0439438_170635 3300041405 Bacteria 517
148 Ga0439447_123262 3300041407 Bacteria 594
149 Ga0451807_1641279 3300041486 Bacteria 1162
150 Ga0439448_0238874 3300042005 Bacteria 640
151 Ga0439449_0019421 3300042007 Bacteria 2547
152 Ga0439455_0010147 3300042012 Bacteria 2063
153 Ga0439463_016900 3300042016 Bacteria 1805
154 Ga0450911_048007 3300042115 Bacteria 554
155 Ga0450923_067874 3300042125 Bacteria 787
156 Ga0439446_0005376 3300042156 Bacteria 3290
157 Ga0451577_0000002 3300042876 Bacteria 1731375
158 Ga0451577_0137759 3300042876 Bacteria 2192
159 Ga0451577_0847036 3300042876 Bacteria 825
160 Ga0451577_1210132 3300042876 Bacteria 674
161 Ga0439440_0044109 3300042993 Bacteria 1096
162 Ga0466982_0056404 3300044672 Bacteria 2413
163 Ga0453683_0000003 3300044673 Bacteria 942572
164 Ga0466965_0039961 3300044683 Bacteria 2307
165 Ga0466966_0038405 3300044684 Bacteria 3085
166 Ga0466961_0402081 3300044693 Bacteria 831
167 Ga0466963_0009383 3300044694 Bacteria 5894
168 Ga0466964_0001256 3300044706 Bacteria 8623
169 Ga0466964_0081713 3300044706 Bacteria 1388
170 Ga0453684_0000002 3300044712 Bacteria 1731375
171 Ga0453684_0000029 3300044712 Bacteria 757969
172 Ga0453684_0219390 3300044712 Bacteria 2204
173 Ga0453684_0430014 3300044712 Bacteria 1473
174 Ga0466957_0005465 3300044842 Bacteria 7131
175 Ga0466957_0019951 3300044842 Bacteria 3945
176 Ga0451576_0000004 3300045051 Bacteria 1312238
177 Ga0451576_0000057 3300045051 Bacteria 300798
178 Ga0451576_0001043 3300045051 Bacteria 51028
179 Ga0451576_0089229 3300045051 Bacteria 3206
180 Ga0451576_0225540 3300045051 Bacteria 1956
181 Ga0466958_0283602 3300045836 Bacteria 1062
182 Ga0466967_0001817 3300045976 Bacteria 12817
183 Ga0466967_0237218 3300045976 Bacteria 1738
184 Ga0495590_0000002 3300046457 Bacteria 485720
185 Ga0495590_0001727 3300046457 Bacteria 9288
186 Ga0495629_0990920 3300046459 Bacteria 547
187 Ga0495638_0006961 3300046460 Bacteria 8164
188 Ga0495651_0099989 3300046462 Bacteria 2161
189 Ga0495653_0077617 3300046463 Bacteria 2465
190 Ga0495650_0009555 3300046471 Bacteria 5506
191 Ga0495650_0037977 3300046471 Bacteria 2090
192 Ga0495582_0079824 3300046473 Bacteria 1816
193 Ga0495605_0010710 3300046474 Bacteria 5124
194 Ga0495605_0111151 3300046474 Bacteria 1250
195 Ga0495605_0138725 3300046474 Bacteria 1092
196 Ga0495605_0191671 3300046474 Bacteria 894
197 Ga0495584_0019749 3300046491 Bacteria 3423
198 Ga0495584_0037279 3300046491 Bacteria 2456
199 Ga0495585_0019406 3300046492 Bacteria 3919
200 Ga0495594_0132236 3300046499 Bacteria 1413
201 Ga0495607_0001356 3300046501 Bacteria 21830
202 Ga0495607_0061954 3300046501 Bacteria 2123
203 Ga0495583_0000741 3300046506 Bacteria 41476
204 Ga0495583_0003758 3300046506 Bacteria 11291
205 Ga0495606_0046684 3300046507 Bacteria 2861
206 Ga0495606_0121875 3300046507 Bacteria 1560
207 Ga0495606_0297211 3300046507 Bacteria 876
208 Ga0495608_0054992 3300046511 Bacteria 2630
209 Ga0495610_0002587 3300046512 Bacteria 15005
210 Ga0495610_0023783 3300046512 Bacteria 3322
211 Ga0495610_0051705 3300046512 Bacteria 1998
212 Ga0495610_0150526 3300046512 Bacteria 993
213 Ga0495616_0010712 3300046513 Bacteria 5292
214 Ga0495616_0130604 3300046513 Bacteria 1151
215 Ga0495616_0206705 3300046513 Bacteria 860
216 Ga0495620_0109596 3300046515 Bacteria 1095
217 Ga0495628_0000929 3300046516 Bacteria 26874
218 Ga0495630_0069090 3300046517 Bacteria 2657
219 Ga0495630_0298801 3300046517 Bacteria 1230
220 Ga0495631_0009695 3300046518 Bacteria 4800
221 Ga0495632_0021509 3300046519 Bacteria 3475
222 Ga0495637_0011956 3300046520 Bacteria 4160
223 Ga0495637_0014428 3300046520 Bacteria 3728
224 Ga0495637_0031134 3300046520 Bacteria 2361
225 Ga0495637_0031328 3300046520 Bacteria 2353
226 Ga0495643_0000643 3300046522 Bacteria 41372
227 Ga0495643_0020951 3300046522 Bacteria 3760
228 Ga0495643_0329049 3300046522 Bacteria 689
229 Ga0495644_0011213 3300046523 Bacteria 3454
230 Ga0495644_0197682 3300046523 Bacteria 775
231 Ga0495648_0002410 3300046524 Bacteria 17336
232 Ga0495648_0045016 3300046524 Bacteria 2749
233 Ga0495666_0036015 3300046526 Bacteria 2410
234 Ga0495642_0004947 3300046528 Bacteria 5138
235 Ga0495642_0050938 3300046528 Bacteria 1703
236 Ga0495642_0383139 3300046528 Bacteria 619
237 Ga0495652_0002952 3300046529 Bacteria 17113
238 Ga0495652_0009247 3300046529 Bacteria 8959
239 Ga0495652_0010677 3300046529 Bacteria 8319
240 Ga0495654_0153228 3300046530 Bacteria 1017
241 Ga0495654_0263226 3300046530 Bacteria 714
242 Ga0495665_0033730 3300046531 Bacteria 2737
243 Ga0495587_0321883 3300046536 Bacteria 863
244 Ga0495609_0280427 3300046538 Bacteria 681
245 Ga0495609_0381628 3300046538 Bacteria 565
246 Ga0495597_0000874 3300046542 Bacteria 23420
247 Ga0495597_0061505 3300046542 Bacteria 1635
248 Ga0495597_0249096 3300046542 Bacteria 698
249 Ga0495645_0008074 3300046543 Bacteria 7334
250 Ga0495645_0261783 3300046543 Bacteria 1145
251 Ga0495633_0376169 3300046558 Bacteria 643
252 Ga0495634_0022173 3300046642 Bacteria 4476
253 Ga0495611_0113926 3300046648 Bacteria 1259
254 Ga0495625_0595339 3300046660 Bacteria 664
255 Ga0495661_0020196 3300046665 Bacteria 4353
256 Ga0495623_0006164 3300046679 Bacteria 7796
257 Ga0495623_0008650 3300046679 Bacteria 6610
258 Ga0495646_0012297 3300046680 Bacteria 5443
259 Ga0495646_0103756 3300046680 Bacteria 1627
260 Ga0495669_0159024 3300046684 Bacteria 1072
261 Ga0495671_0038443 3300046692 Bacteria 2419
262 Ga0495589_0006804 3300046794 Bacteria 6019
263 Ga0495600_0124297 3300046809 Bacteria 1678
264 Ga0495660_0035872 3300046810 Bacteria 2768
265 Ga0495660_0064123 3300046810 Bacteria 1964
266 Ga0495660_0068743 3300046810 Bacteria 1884
267 Ga0495581_0089081 3300047315 Bacteria 1789
268 Ga0495581_0255855 3300047315 Bacteria 1024
269 Ga0495604_0045818 3300047317 Bacteria 3411
270 Ga0495672_0000021 3300047320 Bacteria 422795
271 Ga0495672_0045238 3300047320 Bacteria 2635
272 Ga0495675_0041172 3300047444 Bacteria 2944
273 Ga0495675_0063595 3300047444 Bacteria 2334
274 Ga0495685_015504 3300047447 Bacteria 2599
275 Ga0495681_0009303 3300047470 Bacteria 6068
276 Ga0495686_0003022 3300047472 Bacteria 14935
277 Ga0495602_0008077 3300048088 Bacteria 10998
278 Ga0495602_0193909 3300048088 Bacteria 1555
279 Ga0495614_0166595 3300048089 Bacteria 987
280 Ga0495626_0030461 3300048091 Bacteria 2602
281 Ga0496100_0259860 3300048903 Bacteria 1287
282 Ga0496104_0476810 3300048907 Bacteria 1159
283 Ga0496110_1031042 3300048913 Bacteria 730
284 Ga0496111_0012430 3300048914 Bacteria 5764
285 Ga0496114_0194807 3300048917 Bacteria 1774
286 Ga0496116_0026598 3300048919 Bacteria 4227
287 Ga0496116_0104553 3300048919 Bacteria 1682
288 Ga0496117_0000094 3300048920 Bacteria 201853
289 Ga0496118_0000071 3300048921 Bacteria 201853
290 Ga0496121_0089329 3300048924 Bacteria 2413
291 Ga0496122_0009932 3300048925 Bacteria 9915
292 Ga0496123_0002403 3300048926 Bacteria 23383
293 Ga0496124_0111979 3300048927 Bacteria 2195
294 Ga0496124_0246949 3300048927 Bacteria 1323
295 Ga0496125_0038118 3300048928 Bacteria 4166
296 Ga0495678_008263 3300049459 Bacteria 5274
297 Ga0495678_119330 3300049459 Bacteria 888
298 Ga0495682_0075523 3300049460 Bacteria 1212
299 Ga0501033_0001193 3300049570 Bacteria 23470
300 Ga0501036_0000543 3300049572 Bacteria 27032
301 Ga0501037_0037385 3300049573 Bacteria 3579
302 Ga0501037_0175925 3300049573 Bacteria 1520
303 Ga0501038_0000909 3300049574 Bacteria 26221
304 Ga0501038_0215763 3300049574 Bacteria 1533
305 Ga0501039_0000990 3300049575 Bacteria 20671
306 Ga0501039_0089002 3300049575 Bacteria 2405
307 Ga0501039_0555830 3300049575 Bacteria 900
308 Ga0501040_0001274 3300049576 Bacteria 16022
309 Ga0501041_0000405 3300049577 Bacteria 21753
310 Ga0501041_0103851 3300049577 Bacteria 1760
311 Ga0501042_0002353 3300049578 Bacteria 11598
312 Ga0501043_0008861 3300049579 Bacteria 7917
313 Ga0501046_0053624 3300049580 Bacteria 3175
314 Ga0501047_0152621 3300049581 Bacteria 2185
315 Ga0501047_0493765 3300049581 Bacteria 1051
316 Ga0501047_0972274 3300049581 Bacteria 662
317 Ga0501048_0000804 3300049582 Bacteria 23031
318 Ga0501068_0002016 3300049584 Bacteria 10806
319 Ga0501068_0398122 3300049584 Bacteria 888
320 Ga0501070_0058246 3300049586 Bacteria 3202
321 Ga0501070_0813577 3300049586 Bacteria 733
322 Ga0501071_0028877 3300049587 Bacteria 3910
323 Ga0501071_0353424 3300049587 Bacteria 1119
324 Ga0501072_0000322 3300049588 Bacteria 34133
325 Ga0501073_0166663 3300049589 Bacteria 1525
326 Ga0501074_0008612 3300049590 Bacteria 7387
327 Ga0501075_0003775 3300049591 Bacteria 10180
328 Ga0501075_0141108 3300049591 Bacteria 1836
329 Ga0501076_0000092 3300049592 Bacteria 47957
330 Ga0501076_0199368 3300049592 Bacteria 1634
331 Ga0501076_0263795 3300049592 Bacteria 1410
332 Ga0501077_0000070 3300049593 Bacteria 51447
333 Ga0501247_038810 3300049677 Bacteria 675
334 Ga0501079_0000005 3300049741 Bacteria 85998
335 Ga0501079_0154167 3300049741 Bacteria 1791
336 Ga0501079_1087409 3300049741 Bacteria 630
337 Ga0501080_0163493 3300049742 Bacteria 2055
338 Ga0501080_1048826 3300049742 Bacteria 705
339 Ga0501081_0001888 3300049743 Bacteria 13011
340 Ga0501035_0001495 3300049822 Bacteria 23928
341 Ga0501045_0000596 3300049824 Bacteria 22747
342 Ga0501045_0156042 3300049824 Bacteria 1698
343 nmdc:mga0k408_2939_c1 3300050493 Bacteria 9034
344 nmdc:mga05p37_60826_c1 3300050507 Bacteria 4650
345 nmdc:mga05p37_610618_c1 3300050507 Bacteria 1229
346 nmdc:mga05p37_636338_c1 3300050507 Bacteria 1197
347 nmdc:mga09592_1131067_c1 3300050508 Bacteria 650
348 nmdc:mga09592_371_c1 3300050508 Bacteria 32873
349 nmdc:mga0qj67_121011_c1 3300050509 Bacteria 2117
350 nmdc:mga0qj67_71446_c2 3300050509 Bacteria 1217
351 nmdc:mga06r32_116217_c1 3300050510 Bacteria 2636
352 nmdc:mga06r32_66_c1 3300050510 Bacteria 67675
353 nmdc:mga08y16_124413_c1 3300050511 Bacteria 2683
354 nmdc:mga08y16_1425993_c1 3300050511 Bacteria 655
355 nmdc:mga08y16_2926_c1 3300050511 Bacteria 17573
356 nmdc:mga08y16_3200_c1 3300050511 Bacteria 16945
357 nmdc:mga08y16_613066_c1 3300050511 Bacteria 1096
358 nmdc:mga0n895_461513_c1 3300050512 Bacteria 1282
359 nmdc:mga0a205_1356108_c1 3300050515 Bacteria 559
360 nmdc:mga0a205_746245_c1 3300050515 Bacteria 827
361 Ga0500617_065453 3300053124 Bacteria 1602
362 Ga0500573_0059208 3300053140 Bacteria 2195
363 Ga0500588_0021082 3300053146 Bacteria 1755
364 Ga0501084_0001577 3300054114 Bacteria 18055
365 Ga0501084_0194337 3300054114 Bacteria 1712
366 Ga0501082_0000755 3300060353 Bacteria 28412
367 Ga0501082_0294979 3300060353 Bacteria 1412
368 Ga0501082_0518031 3300060353 Bacteria 1042
369 Ga0530510_0000240 3300061734 Bacteria 34436
370 2511256055 2511231004 Bacteria 6669789
371 2511270049 2511231007 Bacteria 6306603
372 2511280986 2511231008 Bacteria 6624100
373 2511287913 2511231010 Bacteria 6373152
374 2511298558 2511231011 Bacteria 6149768
375 2511301622 2511231012 Bacteria 6738011
376 2511315775 2511231014 Bacteria 6462302
377 2511319124 2511231015 Bacteria 6598026
378 2511326225 2511231016 Bacteria 6704427
379 2511333001 2511231017 Bacteria 6503007
380 2511361615 2511231022 Bacteria 6719296
381 2511369502 2511231023 Bacteria 6808468
382 2521558127 2521172590 Bacteria 5047645
383 2599501424 2599185188 Bacteria 6164180
384 2599931724 2599185300 Bacteria 6062622
385 2601796619 2600255318 Bacteria 6383414
386 2606073769 2603880185 Bacteria 6379190
387 2606126586 2603880199 Bacteria 6377649
388 2624482320 2623620443 Bacteria 6427864
389 2624490636 2623620446 Bacteria 6500345
390 2643841331 2643221565 Bacteria 6216018
391 2644186454 2643221633 Bacteria 6733554
392 2715750320 2713897148 Bacteria 5883533
393 2715755291 2713897149 Bacteria 6506249
394 2718635500 2718217725 Bacteria 5758958
395 2738689272 2738541271 Bacteria 5657310
396 2739264660 2738543016 Bacteria 5657564
397 2739313377 2738543025 Bacteria 6600348
398 2774122329 2773857670 Bacteria 6407454
399 2774133203 2773857673 Bacteria 6513460
400 2784262936 2784132063 Bacteria 6262788
401 2784316167 2784132072 Bacteria 6596533
402 2794594658 2791355520 Bacteria 5948615
403 2808958742 2808606382 Bacteria 6841132
404 2809146794 2808606418 Bacteria 6724496
405 2809219462 2808606445 Bacteria 6057339
406 2819614729 2818991449 Bacteria 5518009
407 2819655996 2818991456 Bacteria 6123676
408 2842837176 2842832357 Bacteria 5959113
409 2842844973 2842843487 Bacteria 6004777
410 2842856988 2842854478 Bacteria 6143501
411 2852660938 2852657418 Bacteria 6472974
412 2860341174 2860339153 Bacteria 6846989
413 2878034245 2878029506 Bacteria 6418441
414 2880234873 2880230671 Bacteria 6140320
415 2885084075 2885080285 Bacteria 6355622
416 2904441098 2904439833 Bacteria 5931679
417 2904522275 2904518522 Bacteria 6068986
418 2904531959 2904530477 Bacteria 5876334
419 2904587815 2904584206 Bacteria 6028872
420 2904590025 2904589729 Bacteria 6113573
421 2904602587 2904601388 Bacteria 5884906
422 2913038189 2913036834 Bacteria 6704877
423 2919046591 2919046199 Bacteria 5567169
424 2919066693 2919063839 Bacteria 6302690
425 2919079907 2919079590 Bacteria 5946433
426 2919388322 2919385768 Bacteria 5897293
427 2919459271 2919456309 Bacteria 6586567
428 2919489471 2919487758 Bacteria 5929766
429 2919701832 2919697872 Bacteria 6553725
430 2923590684 2923586266 Bacteria 6565975
431 2928131307 2928130867 Bacteria 5467269
432 2974289604 2974289157 Bacteria 6080362
433 2998144311 2998139840 Bacteria 6073514
434 3007516087 3007511990 Bacteria 6481491
435 3007617746 3007614139 Bacteria 6053559
436 3007721041 3007718800 Bacteria 5971527
437 3007858706 3007855910 Bacteria 5637581
438 3007865766 3007861166 Bacteria 6045338
439 3007871683 3007866637 Bacteria 5899198
440 8019780644 8019775933 Bacteria 6858656
441 8029996570 8029995093 Bacteria 5990776
442 8056130601 8056125926 Bacteria 6228218
443 8056147640 8056143049 Bacteria 6307666
444 8056155292 8056155041 Bacteria 6486948
445 8056166951 8056166840 Bacteria 5820959
446 8056172937 8056172158 Bacteria 6133900
447 8056183212 8056177738 Bacteria 6748268
448 Ga0265324_10000008
449 SwRhRL2b_contig_3166003
450 Ga0055538_1000002
451 Ga0055539_1000002
452 Ga0055533_1000004
453 Ga0055525_1000002
454 Ga0055541_1000002
455 Ga0070690_100059431
456 Ga0070659_100018995
457 Ga0070700_100027129
458 Ga0070700_100607382
459 Ga0070663_100898381
460 Ga0070662_100554229
461 Ga0070679_100610147
462 Ga0070684_100042163
463 Ga0070697_100001705
464 Ga0068855_100001741
465 Ga0068855_100515589
466 Ga0068855_101078592
467 Ga0070664_100138253
468 Ga0068854_100051852
469 Ga0070702_100065669
470 Ga0070702_100188408
471 Ga0068859_100366057
472 Ga0068859_100669876
473 Ga0068864_100280225
474 Ga0068851_10312235
475 Ga0068863_100484407
476 Ga0068858_100044568
477 Ga0068858_100262868
478 Ga0075366_10002796
479 Ga0097621_100021280
480 Ga0068871_100002565
481 Ga0075430_100250838
482 Ga0075433_11029066
483 Ga0068865_100873176
484 Ga0097620_100366031
485 Ga0097620_100669893
486 Ga0105251_10000268
487 Ga0105250_10123424
488 Ga0105240_10097593
489 Ga0105240_10442186
490 Ga0111539_10007340
491 Ga0111539_10157499
492 Ga0111539_10959333
493 Ga0105245_10130564
494 Ga0114129_10064085
495 Ga0105243_10017031
496 Ga0105243_10113095
497 Ga0105241_10170626
498 Ga0105242_10049101
499 Ga0105248_10194423
500 Ga0105237_10014721
501 Ga0105238_10000977
502 Ga0105238_10265924
503 Ga0105246_10566989
504 Ga0157370_10047742
505 Ga0157370_10095123
506 Ga0163162_11092377
507 Ga0157372_10037230
508 Ga0163163_10175587
509 Ga0182008_10000515
510 Ga0182008_10113232
511 Ga0157379_11131953
512 Ga0157376_10011821
513 Ga0157376_10375426
514 Ga0182006_1000112
515 Ga0182006_1011405
516 Ga0182006_1032526
517 Ga0182007_10000020
518 Ga0182005_1000001
519 Ga0182005_1016912
520 Ga0209784_100002
521 Ga0209566_100003
522 Ga0209674_100004
523 Ga0209672_103329
524 Ga0209563_100006
525 Ga0209437_100053
526 Ga0209677_100003
527 Ga0207656_10163713
528 Ga0207696_1000044
529 Ga0207713_1000013
530 Ga0207695_10013645
531 Ga0207671_10018653
532 Ga0207649_10004863
533 Ga0207694_10039691
534 Ga0207690_10021194
535 Ga0207686_10056326
536 Ga0207711_10222160
537 Ga0207679_10013087
538 Ga0207667_10000036
539 Ga0207667_10081172
540 Ga0207667_11193722
541 Ga0207640_10023722
542 Ga0207640_10339567
543 Ga0207658_10681503
544 Ga0207703_10006062
545 Ga0207703_10112325
546 Ga0207641_10408044
547 Ga0207676_10175192
548 Ga0209981_1005799
549 Ga0209968_1013816
550 Ga0207428_10009441
551 Ga0207428_10017731
552 Ga0265318_10019700
553 Ga0265336_10000931
554 Ga0265338_10098868
555 Ga0265324_10000813
556 Ga0316182_1089273
557 Ga0265330_10029320
558 Ga0265332_10023432
559 Ga0265320_10016343
560 Ga0265325_10000154
561 Ga0265325_10074594
562 Ga0265329_10018599
563 Ga0265331_10009344
564 Ga0265331_10034042
565 Ga0307408_100847225
566 Ga0265314_10000136
567 Ga0265314_10008502
568 Ga0265314_10019805
569 Ga0265342_10062451
570 Ga0307410_10092515
571 Ga0307407_10625710
572 Ga0307409_101191950
573 Ga0307411_10130526
574 Ga0307411_10202140
575 Ga0373960_0004285
576 Ga0373960_0014564
577 Ga0373942_0040261
578 Ga0373961_0005880
579 Ga0373961_0010109
580 Ga0373931_0009704
581 Ga0395899_0002047
582 Ga0395899_0009612
583 Ga0395900_0002186
584 Ga0395900_0164245
585 Ga0395900_0217505
586 Ga0395898_0071146
587 Ga0395898_0174523
588 Ga0395898_0251006
589 Ga0395905_0200968
590 Ga0395901_0009268
591 Ga0395901_0176429
592 Ga0395901_0885606
593 Ga0436361_0560696
594 Ga0439438_170635
595 Ga0439447_123262
596 Ga0451807_1641279
597 Ga0439448_0238874
598 Ga0439449_0019421
599 Ga0439455_0010147
600 Ga0439463_016900
601 Ga0450911_048007
602 Ga0450923_067874
603 Ga0439446_0005376
604 Ga0451577_0000002
605 Ga0451577_0137759
606 Ga0451577_0847036
607 Ga0451577_1210132
608 Ga0439440_0044109
609 Ga0466982_0056404
610 Ga0453683_0000003
611 Ga0466965_0039961
612 Ga0466966_0038405
613 Ga0466961_0402081
614 Ga0466963_0009383
615 Ga0466964_0001256
616 Ga0466964_0081713
617 Ga0453684_0000002
618 Ga0453684_0000029
619 Ga0453684_0219390
620 Ga0453684_0430014
621 Ga0466957_0005465
622 Ga0466957_0019951
623 Ga0451576_0000004
624 Ga0451576_0000057
625 Ga0451576_0001043
626 Ga0451576_0089229
627 Ga0451576_0225540
628 Ga0466958_0283602
629 Ga0466967_0001817
630 Ga0466967_0237218
631 Ga0495590_0000002
632 Ga0495590_0001727
633 Ga0495629_0990920
634 Ga0495638_0006961
635 Ga0495651_0099989
636 Ga0495653_0077617
637 Ga0495650_0009555
638 Ga0495650_0037977
639 Ga0495582_0079824
640 Ga0495605_0010710
641 Ga0495605_0111151
642 Ga0495605_0138725
643 Ga0495605_0191671
644 Ga0495584_0019749
645 Ga0495584_0037279
646 Ga0495585_0019406
647 Ga0495594_0132236
648 Ga0495607_0001356
649 Ga0495607_0061954
650 Ga0495583_0000741
651 Ga0495583_0003758
652 Ga0495606_0046684
653 Ga0495606_0121875
654 Ga0495606_0297211
655 Ga0495608_0054992
656 Ga0495610_0002587
657 Ga0495610_0023783
658 Ga0495610_0051705
659 Ga0495610_0150526
660 Ga0495616_0010712
661 Ga0495616_0130604
662 Ga0495616_0206705
663 Ga0495620_0109596
664 Ga0495628_0000929
665 Ga0495630_0069090
666 Ga0495630_0298801
667 Ga0495631_0009695
668 Ga0495632_0021509
669 Ga0495637_0011956
670 Ga0495637_0014428
671 Ga0495637_0031134
672 Ga0495637_0031328
673 Ga0495643_0000643
674 Ga0495643_0020951
675 Ga0495643_0329049
676 Ga0495644_0011213
677 Ga0495644_0197682
678 Ga0495648_0002410
679 Ga0495648_0045016
680 Ga0495666_0036015
681 Ga0495642_0004947
682 Ga0495642_0050938
683 Ga0495642_0383139
684 Ga0495652_0002952
685 Ga0495652_0009247
686 Ga0495652_0010677
687 Ga0495654_0153228
688 Ga0495654_0263226
689 Ga0495665_0033730
690 Ga0495587_0321883
691 Ga0495609_0280427
692 Ga0495609_0381628
693 Ga0495597_0000874
694 Ga0495597_0061505
695 Ga0495597_0249096
696 Ga0495645_0008074
697 Ga0495645_0261783
698 Ga0495633_0376169
699 Ga0495634_0022173
700 Ga0495611_0113926
701 Ga0495625_0595339
702 Ga0495661_0020196
703 Ga0495623_0006164
704 Ga0495623_0008650
705 Ga0495646_0012297
706 Ga0495646_0103756
707 Ga0495669_0159024
708 Ga0495671_0038443
709 Ga0495589_0006804
710 Ga0495600_0124297
711 Ga0495660_0035872
712 Ga0495660_0064123
713 Ga0495660_0068743
714 Ga0495581_0089081
715 Ga0495581_0255855
716 Ga0495604_0045818
717 Ga0495672_0000021
718 Ga0495672_0045238
719 Ga0495675_0041172
720 Ga0495675_0063595
721 Ga0495685_015504
722 Ga0495681_0009303
723 Ga0495686_0003022
724 Ga0495602_0008077
725 Ga0495602_0193909
726 Ga0495614_0166595
727 Ga0495626_0030461
728 Ga0496100_0259860
729 Ga0496104_0476810
730 Ga0496110_1031042
731 Ga0496111_0012430
732 Ga0496114_0194807
733 Ga0496116_0026598
734 Ga0496116_0104553
735 Ga0496117_0000094
736 Ga0496118_0000071
737 Ga0496121_0089329
738 Ga0496122_0009932
739 Ga0496123_0002403
740 Ga0496124_0111979
741 Ga0496124_0246949
742 Ga0496125_0038118
743 Ga0495678_008263
744 Ga0495678_119330
745 Ga0495682_0075523
746 Ga0501033_0001193
747 Ga0501036_0000543
748 Ga0501037_0037385
749 Ga0501037_0175925
750 Ga0501038_0000909
751 Ga0501038_0215763
752 Ga0501039_0000990
753 Ga0501039_0089002
754 Ga0501039_0555830
755 Ga0501040_0001274
756 Ga0501041_0000405
757 Ga0501041_0103851
758 Ga0501042_0002353
759 Ga0501043_0008861
760 Ga0501046_0053624
761 Ga0501047_0152621
762 Ga0501047_0493765
763 Ga0501047_0972274
764 Ga0501048_0000804
765 Ga0501068_0002016
766 Ga0501068_0398122
767 Ga0501070_0058246
768 Ga0501070_0813577
769 Ga0501071_0028877
770 Ga0501071_0353424
771 Ga0501072_0000322
772 Ga0501073_0166663
773 Ga0501074_0008612
774 Ga0501075_0003775
775 Ga0501075_0141108
776 Ga0501076_0000092
777 Ga0501076_0199368
778 Ga0501076_0263795
779 Ga0501077_0000070
780 Ga0501247_038810
781 Ga0501079_0000005
782 Ga0501079_0154167
783 Ga0501079_1087409
784 Ga0501080_0163493
785 Ga0501080_1048826
786 Ga0501081_0001888
787 Ga0501035_0001495
788 Ga0501045_0000596
789 Ga0501045_0156042
790 nmdc:mga0k408_2939_c1
791 nmdc:mga05p37_60826_c1
792 nmdc:mga05p37_610618_c1
793 nmdc:mga05p37_636338_c1
794 nmdc:mga09592_1131067_c1
795 nmdc:mga09592_371_c1
796 nmdc:mga0qj67_121011_c1
797 nmdc:mga0qj67_71446_c2
798 nmdc:mga06r32_116217_c1
799 nmdc:mga06r32_66_c1
800 nmdc:mga08y16_124413_c1
801 nmdc:mga08y16_1425993_c1
802 nmdc:mga08y16_2926_c1
803 nmdc:mga08y16_3200_c1
804 nmdc:mga08y16_613066_c1
805 nmdc:mga0n895_461513_c1
806 nmdc:mga0a205_1356108_c1
807 nmdc:mga0a205_746245_c1
808 Ga0500617_065453
809 Ga0500573_0059208
810 Ga0500588_0021082
811 Ga0501084_0001577
812 Ga0501084_0194337
813 Ga0501082_0000755
814 Ga0501082_0294979
815 Ga0501082_0518031
816 Ga0530510_0000240
817 2511256055
818 2511270049
819 2511280986
820 2511287913
821 2511298558
822 2511301622
823 2511315775
824 2511319124
825 2511326225
826 2511333001
827 2511361615
828 2511369502
829 2521558127
830 2599501424
831 2599931724
832 2601796619
833 2606073769
834 2606126586
835 2624482320
836 2624490636
837 2643841331
838 2644186454
839 2715750320
840 2715755291
841 2718635500
842 2738689272
843 2739264660
844 2739313377
845 2774122329
846 2774133203
847 2784262936
848 2784316167
849 2794594658
850 2808958742
851 2809146794
852 2809219462
853 2819614729
854 2819655996
855 2842837176
856 2842844973
857 2842856988
858 2852660938
859 2860341174
860 2878034245
861 2880234873
862 2885084075
863 2904441098
864 2904522275
865 2904531959
866 2904587815
867 2904590025
868 2904602587
869 2913038189
870 2919046591
871 2919066693
872 2919079907
873 2919388322
874 2919459271
875 2919489471
876 2919701832
877 2923590684
878 2928131307
879 2974289604
880 2998144311
881 3007516087
882 3007617746
883 3007721041
884 3007858706
885 3007865766
886 3007871683
887 8019780644
888 8029996570
889 8056130601
890 8056147640
891 8056155292
892 8056166951
893 8056172937
894 8056183212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

10

169

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vcp-assembly2.cif.gz_B crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9835 2 158
5vcp-assembly1.cif.gz_C crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.9813 2 159
5vcp-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin 0.978 2 158
5cy7-assembly1.cif.gz_A structure of xoo1075, a peptide deformylase from xanthomonas oryze pv oryze, in complex with fragment 275 0.978 2 156
5cx0-assembly1.cif.gz_A-2 structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv. oryzae, in complex with fragment 322 0.9759 2 156
ID Description Score Start End Superfamily
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.978 2 158 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9436 2 139 3.90.45.10
1rn5A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.94 2 156 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9356 2 145 3.90.45.10
af_Q9VGY2_49_232_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9354 2 155 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A0S7YYF1-F1-model_v4 Peptide deformylase (Polypeptide deformylase) 0.9966 2 126 GO:0042586
GO:0043686
AF-A0A524K758-F1-model_v4 Peptide deformylase (Polypeptide deformylase) 0.9949 2 147 GO:0042586
GO:0043686
AF-A0A6A5LES4-F1-model_v4 deleted 0.9943 2 140
AF-A0A1G0GP29-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9931 2 157 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A356HEX9-F1-model_v4 deleted 0.991 4 114

Map