F445975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 447 | 226 | 447 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300031238|Ga0265332_10049037|Ga0265332_100490372 |
| Length | 290 |
| Sequence | MFYTGNDTALGIRTSAVNSSVAAPLLQSAQPMMVPFVKATACGNDFLIIDVVHAPADIHSFARRICDRHNGVGADGVEWVVPAKDADLGVRLLNADGSEAEISGNGTRCVAAWYCAEHQRDSVVIRTGAGLKTCDLTSRNGSTFEFRSSMGVPEVGDEFPVKLTCGEMCGVPVSMGNPHYVVFVSEFELGWQAVAEQISKHHDFKEGMNVEFVRMMNESEIEVRFCERGVGETMSSGTGSCAAAVASIHSGKVKSPVRVRAPGGTQTVEWSGEVFLYGPASLLCRGEFFV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 181 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 182 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 183 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 186 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 187 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.83 |
| Rhizosphere | 91.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10016281 | 3300001991 | Bacteria | 1386 |
| 2 | JGI24748J21848_1009392 | 3300002074 | Unclassified | 1152 |
| 3 | JGI24034J26672_10004198 | 3300002239 | Unclassified | 2032 |
| 4 | rootH1_10391135 | 3300003323 | Unclassified | 1211 |
| 5 | Ga0058863_10581641 | 3300004799 | Unclassified | 1863 |
| 6 | Ga0058862_12178919 | 3300004803 | Unclassified | 1730 |
| 7 | Ga0065712_10159410 | 3300005290 | Unclassified | 1312 |
| 8 | Ga0070683_100009652 | 3300005329 | Bacteria | 8260 |
| 9 | Ga0070683_100056172 | 3300005329 | Bacteria | 3655 |
| 10 | Ga0070683_100111052 | 3300005329 | Unclassified | 2586 |
| 11 | Ga0070690_100192881 | 3300005330 | Unclassified | 1413 |
| 12 | Ga0070670_100042120 | 3300005331 | Unclassified | 3924 |
| 13 | Ga0068869_100010850 | 3300005334 | Bacteria | 5958 |
| 14 | Ga0068869_100268765 | 3300005334 | Unclassified | 1367 |
| 15 | Ga0070680_100001944 | 3300005336 | Bacteria | 15199 |
| 16 | Ga0070680_100201210 | 3300005336 | Bacteria | 1680 |
| 17 | Ga0070682_100015853 | 3300005337 | Unclassified | 4374 |
| 18 | Ga0068868_100067431 | 3300005338 | Unclassified | 2848 |
| 19 | Ga0070660_100010642 | 3300005339 | Bacteria | 6504 |
| 20 | Ga0070687_100003095 | 3300005343 | Bacteria | 6397 |
| 21 | Ga0070692_10156071 | 3300005345 | Unclassified | 1304 |
| 22 | Ga0070668_100263676 | 3300005347 | Unclassified | 1433 |
| 23 | Ga0070669_100340378 | 3300005353 | Unclassified | 1215 |
| 24 | Ga0070671_100366436 | 3300005355 | Unclassified | 1230 |
| 25 | Ga0070674_100008909 | 3300005356 | Bacteria | 5992 |
| 26 | Ga0070673_100311614 | 3300005364 | Unclassified | 1388 |
| 27 | Ga0070688_100002892 | 3300005365 | Bacteria | 8753 |
| 28 | Ga0070659_100078281 | 3300005366 | Bacteria | 2637 |
| 29 | Ga0070659_100680844 | 3300005366 | Unclassified | 888 |
| 30 | Ga0070659_100702412 | 3300005366 | Unclassified | 874 |
| 31 | Ga0070709_10019563 | 3300005434 | Bacteria | 3916 |
| 32 | Ga0070709_10085458 | 3300005434 | Bacteria | 2069 |
| 33 | Ga0070709_10123995 | 3300005434 | Unclassified | 1755 |
| 34 | Ga0070709_10136345 | 3300005434 | Unclassified | 1681 |
| 35 | Ga0070714_100001244 | 3300005435 | Bacteria | 18383 |
| 36 | Ga0070714_100175508 | 3300005435 | Bacteria | 1947 |
| 37 | Ga0070713_100000508 | 3300005436 | Bacteria | 24885 |
| 38 | Ga0070713_100005742 | 3300005436 | Bacteria | 8523 |
| 39 | Ga0070713_100018895 | 3300005436 | Bacteria | 5248 |
| 40 | Ga0070713_100028013 | 3300005436 | Bacteria | 4444 |
| 41 | Ga0070713_100112416 | 3300005436 | Bacteria | 2376 |
| 42 | Ga0070713_100259880 | 3300005436 | Unclassified | 1586 |
| 43 | Ga0070713_100363852 | 3300005436 | Bacteria | 1344 |
| 44 | Ga0070713_100516981 | 3300005436 | Unclassified | 1128 |
| 45 | Ga0070713_100681739 | 3300005436 | Unclassified | 980 |
| 46 | Ga0070710_10003026 | 3300005437 | Bacteria | 7994 |
| 47 | Ga0070710_10024303 | 3300005437 | Bacteria | 3195 |
| 48 | Ga0070710_10126920 | 3300005437 | Unclassified | 1551 |
| 49 | Ga0070710_10134612 | 3300005437 | Bacteria | 1510 |
| 50 | Ga0070710_10214896 | 3300005437 | Unclassified | 1221 |
| 51 | Ga0070711_100001945 | 3300005439 | Bacteria | 11581 |
| 52 | Ga0070711_100017764 | 3300005439 | Unclassified | 4532 |
| 53 | Ga0070711_100021933 | 3300005439 | Bacteria | 4133 |
| 54 | Ga0070711_100025099 | 3300005439 | Unclassified | 3896 |
| 55 | Ga0070711_100077887 | 3300005439 | Unclassified | 2354 |
| 56 | Ga0070711_100169305 | 3300005439 | Bacteria | 1664 |
| 57 | Ga0070711_100464480 | 3300005439 | Bacteria | 1038 |
| 58 | Ga0070700_100105817 | 3300005441 | Unclassified | 1861 |
| 59 | Ga0070708_100023099 | 3300005445 | Bacteria | 5282 |
| 60 | Ga0070663_100044253 | 3300005455 | Unclassified | 3137 |
| 61 | Ga0070662_100008358 | 3300005457 | Bacteria | 6746 |
| 62 | Ga0070681_10009976 | 3300005458 | Bacteria | 9365 |
| 63 | Ga0070681_10024936 | 3300005458 | Bacteria | 6017 |
| 64 | Ga0070681_10071909 | 3300005458 | Unclassified | 3423 |
| 65 | Ga0070681_10094704 | 3300005458 | Bacteria | 2934 |
| 66 | Ga0068867_100002611 | 3300005459 | Bacteria | 12706 |
| 67 | Ga0070685_10002276 | 3300005466 | Bacteria | 9898 |
| 68 | Ga0070685_10015632 | 3300005466 | Bacteria | 4033 |
| 69 | Ga0070706_100043044 | 3300005467 | Unclassified | 4172 |
| 70 | Ga0070707_100159229 | 3300005468 | Bacteria | 2199 |
| 71 | Ga0070679_100006533 | 3300005530 | Bacteria | 10867 |
| 72 | Ga0070679_100006726 | 3300005530 | Bacteria | 10723 |
| 73 | Ga0070679_100267122 | 3300005530 | Unclassified | 1666 |
| 74 | Ga0070684_100039793 | 3300005535 | Bacteria | 4046 |
| 75 | Ga0070684_100078256 | 3300005535 | Unclassified | 2921 |
| 76 | Ga0070697_100014294 | 3300005536 | Bacteria | 6238 |
| 77 | Ga0068853_100014106 | 3300005539 | Bacteria | 6542 |
| 78 | Ga0068853_100107321 | 3300005539 | Unclassified | 2476 |
| 79 | Ga0068853_100122997 | 3300005539 | Bacteria | 2316 |
| 80 | Ga0070672_100015040 | 3300005543 | Bacteria | 5499 |
| 81 | Ga0070672_100207767 | 3300005543 | Bacteria | 1639 |
| 82 | Ga0070696_100266678 | 3300005546 | Unclassified | 1300 |
| 83 | Ga0070693_100138514 | 3300005547 | Bacteria | 1529 |
| 84 | Ga0070693_100213449 | 3300005547 | Unclassified | 1260 |
| 85 | Ga0070665_100187197 | 3300005548 | Unclassified | 2071 |
| 86 | Ga0070704_100084782 | 3300005549 | Bacteria | 2343 |
| 87 | Ga0068855_100014817 | 3300005563 | Bacteria | 9388 |
| 88 | Ga0068855_100020697 | 3300005563 | Bacteria | 7888 |
| 89 | Ga0068855_100032998 | 3300005563 | Bacteria | 6180 |
| 90 | Ga0068855_100045068 | 3300005563 | Bacteria | 5217 |
| 91 | Ga0068855_100324647 | 3300005563 | Bacteria | 1700 |
| 92 | Ga0068855_100529520 | 3300005563 | Unclassified | 1278 |
| 93 | Ga0070664_100052227 | 3300005564 | Unclassified | 3461 |
| 94 | Ga0068857_100036989 | 3300005577 | Bacteria | 4324 |
| 95 | Ga0068854_100034115 | 3300005578 | Bacteria | 3552 |
| 96 | Ga0068854_100207623 | 3300005578 | Bacteria | 1543 |
| 97 | Ga0068856_100024943 | 3300005614 | Bacteria | 5827 |
| 98 | Ga0068856_100032885 | 3300005614 | Bacteria | 5079 |
| 99 | Ga0068856_100201069 | 3300005614 | Bacteria | 2007 |
| 100 | Ga0068856_100268940 | 3300005614 | Bacteria | 1720 |
| 101 | Ga0068856_100469196 | 3300005614 | Bacteria | 1279 |
| 102 | Ga0070702_100027294 | 3300005615 | Unclassified | 3079 |
| 103 | Ga0068852_100117355 | 3300005616 | Unclassified | 2430 |
| 104 | Ga0068852_100154823 | 3300005616 | Unclassified | 2134 |
| 105 | Ga0068852_100225831 | 3300005616 | Bacteria | 1783 |
| 106 | Ga0068852_100244302 | 3300005616 | Bacteria | 1717 |
| 107 | Ga0068852_100328932 | 3300005616 | Unclassified | 1486 |
| 108 | Ga0068859_100223089 | 3300005617 | Bacteria | 1972 |
| 109 | Ga0068866_10001073 | 3300005718 | Bacteria | 12054 |
| 110 | Ga0068851_10005150 | 3300005834 | Bacteria | 5930 |
| 111 | Ga0068870_10002197 | 3300005840 | Bacteria | 8082 |
| 112 | Ga0068863_100259026 | 3300005841 | Bacteria | 1681 |
| 113 | Ga0068858_100002926 | 3300005842 | Bacteria | 17180 |
| 114 | Ga0068860_100241666 | 3300005843 | Unclassified | 1756 |
| 115 | Ga0068862_100019015 | 3300005844 | Bacteria | 5728 |
| 116 | Ga0070717_10004778 | 3300006028 | Bacteria | 9850 |
| 117 | Ga0070717_10005444 | 3300006028 | Bacteria | 9292 |
| 118 | Ga0070717_10012832 | 3300006028 | Bacteria | 6397 |
| 119 | Ga0070717_10060316 | 3300006028 | Bacteria | 3141 |
| 120 | Ga0070717_10108057 | 3300006028 | Bacteria | 2370 |
| 121 | Ga0070717_10159166 | 3300006028 | Unclassified | 1958 |
| 122 | Ga0070717_10244196 | 3300006028 | Unclassified | 1584 |
| 123 | Ga0070715_10012378 | 3300006163 | Bacteria | 3104 |
| 124 | Ga0070715_10079798 | 3300006163 | Unclassified | 1483 |
| 125 | Ga0070716_100001082 | 3300006173 | Bacteria | 11947 |
| 126 | Ga0070716_100012159 | 3300006173 | Bacteria | 4356 |
| 127 | Ga0070716_100147599 | 3300006173 | Bacteria | 1508 |
| 128 | Ga0070712_100001573 | 3300006175 | Bacteria | 13964 |
| 129 | Ga0070712_100007712 | 3300006175 | Bacteria | 6733 |
| 130 | Ga0070712_100008905 | 3300006175 | Bacteria | 6323 |
| 131 | Ga0070712_100009706 | 3300006175 | Bacteria | 6066 |
| 132 | Ga0070712_100010482 | 3300006175 | Bacteria | 5850 |
| 133 | Ga0075433_10022979 | 3300006852 | Bacteria | 5243 |
| 134 | Ga0075433_10392725 | 3300006852 | Bacteria | 1224 |
| 135 | Ga0075434_100026835 | 3300006871 | Bacteria | 5649 |
| 136 | Ga0075434_100166153 | 3300006871 | Bacteria | 2227 |
| 137 | Ga0068865_100005233 | 3300006881 | Bacteria | 7843 |
| 138 | Ga0075436_100048770 | 3300006914 | Bacteria | 2922 |
| 139 | Ga0097620_100223080 | 3300006931 | Bacteria | 1972 |
| 140 | Ga0099795_10032332 | 3300007788 | Bacteria | 1809 |
| 141 | Ga0099795_10052115 | 3300007788 | Bacteria | 1494 |
| 142 | Ga0105250_10017617 | 3300009092 | Unclassified | 2902 |
| 143 | Ga0105240_10055234 | 3300009093 | Bacteria | 4973 |
| 144 | Ga0105240_10203089 | 3300009093 | Bacteria | 2321 |
| 145 | Ga0105240_10331966 | 3300009093 | Unclassified | 1730 |
| 146 | Ga0105240_10353006 | 3300009093 | Bacteria | 1668 |
| 147 | Ga0105240_10463436 | 3300009093 | Unclassified | 1415 |
| 148 | Ga0105240_10801969 | 3300009093 | Bacteria | 1020 |
| 149 | Ga0105245_10025889 | 3300009098 | Bacteria | 5160 |
| 150 | Ga0105245_10092720 | 3300009098 | Unclassified | 2782 |
| 151 | Ga0105245_10398305 | 3300009098 | Unclassified | 1375 |
| 152 | Ga0114129_10103958 | 3300009147 | Bacteria | 3926 |
| 153 | Ga0105241_10010562 | 3300009174 | Bacteria | 6775 |
| 154 | Ga0105241_10186146 | 3300009174 | Bacteria | 1726 |
| 155 | Ga0105241_10352474 | 3300009174 | Bacteria | 1278 |
| 156 | Ga0105241_10362951 | 3300009174 | Bacteria | 1261 |
| 157 | Ga0105242_10047736 | 3300009176 | Unclassified | 3477 |
| 158 | Ga0105242_10422065 | 3300009176 | Bacteria | 1250 |
| 159 | Ga0105248_10313242 | 3300009177 | Unclassified | 1768 |
| 160 | Ga0105248_10604079 | 3300009177 | Bacteria | 1238 |
| 161 | Ga0105237_10039028 | 3300009545 | Bacteria | 4794 |
| 162 | Ga0105237_10049032 | 3300009545 | Unclassified | 4246 |
| 163 | Ga0105237_10103263 | 3300009545 | Bacteria | 2842 |
| 164 | Ga0105238_10038663 | 3300009551 | Bacteria | 4845 |
| 165 | Ga0105238_10099645 | 3300009551 | Unclassified | 2888 |
| 166 | Ga0105249_10033064 | 3300009553 | Unclassified | 4682 |
| 167 | Ga0105239_10004620 | 3300010375 | Bacteria | 16372 |
| 168 | Ga0105239_10025096 | 3300010375 | Bacteria | 6566 |
| 169 | Ga0105239_10131125 | 3300010375 | Bacteria | 2788 |
| 170 | Ga0105239_10973112 | 3300010375 | Unclassified | 975 |
| 171 | Ga0105246_10008854 | 3300011119 | Bacteria | 6194 |
| 172 | Ga0157373_10003844 | 3300013100 | Bacteria | 11352 |
| 173 | Ga0157371_10015021 | 3300013102 | Bacteria | 5821 |
| 174 | Ga0157370_10036441 | 3300013104 | Bacteria | 4772 |
| 175 | Ga0157369_10000442 | 3300013105 | Bacteria | 55048 |
| 176 | Ga0157369_10015527 | 3300013105 | Bacteria | 8582 |
| 177 | Ga0157369_10023020 | 3300013105 | Bacteria | 6944 |
| 178 | Ga0157369_10058587 | 3300013105 | Bacteria | 4155 |
| 179 | Ga0157369_10172821 | 3300013105 | Bacteria | 2276 |
| 180 | Ga0157369_10403840 | 3300013105 | Unclassified | 1417 |
| 181 | Ga0157374_10236520 | 3300013296 | Unclassified | 1795 |
| 182 | Ga0157378_10130010 | 3300013297 | Unclassified | 2330 |
| 183 | Ga0163162_10006935 | 3300013306 | Bacteria | 10983 |
| 184 | Ga0157372_10000969 | 3300013307 | Bacteria | 31293 |
| 185 | Ga0157372_10003879 | 3300013307 | Bacteria | 16063 |
| 186 | Ga0157372_10015753 | 3300013307 | Bacteria | 8109 |
| 187 | Ga0157372_10019817 | 3300013307 | Bacteria | 7248 |
| 188 | Ga0157372_10075481 | 3300013307 | Bacteria | 3804 |
| 189 | Ga0157372_10206008 | 3300013307 | Bacteria | 2279 |
| 190 | Ga0157372_10270507 | 3300013307 | Bacteria | 1974 |
| 191 | Ga0157375_10034157 | 3300013308 | Unclassified | 4842 |
| 192 | Ga0163163_10003076 | 3300014325 | Bacteria | 14126 |
| 193 | Ga0163163_10021773 | 3300014325 | Bacteria | 6056 |
| 194 | Ga0163163_10315754 | 3300014325 | Bacteria | 1616 |
| 195 | Ga0157380_10120581 | 3300014326 | Unclassified | 2221 |
| 196 | Ga0182008_10007422 | 3300014497 | Bacteria | 6054 |
| 197 | Ga0157377_10000340 | 3300014745 | Bacteria | 20866 |
| 198 | Ga0157379_10029279 | 3300014968 | Unclassified | 4897 |
| 199 | Ga0157376_10003116 | 3300014969 | Bacteria | 11394 |
| 200 | Ga0157376_10040357 | 3300014969 | Unclassified | 3815 |
| 201 | Ga0157376_10161551 | 3300014969 | Bacteria | 2031 |
| 202 | Ga0182007_10006898 | 3300015262 | Bacteria | 4828 |
| 203 | Ga0163161_10003073 | 3300017792 | Bacteria | 11772 |
| 204 | Ga0207692_10003431 | 3300025898 | Bacteria | 6191 |
| 205 | Ga0207692_10006399 | 3300025898 | Bacteria | 4774 |
| 206 | Ga0207692_10010041 | 3300025898 | Bacteria | 3974 |
| 207 | Ga0207642_10017021 | 3300025899 | Unclassified | 2754 |
| 208 | Ga0207642_10108616 | 3300025899 | Bacteria | 1408 |
| 209 | Ga0207688_10013434 | 3300025901 | Unclassified | 4450 |
| 210 | Ga0207647_10000966 | 3300025904 | Bacteria | 22301 |
| 211 | Ga0207647_10007156 | 3300025904 | Bacteria | 8092 |
| 212 | Ga0207685_10109462 | 3300025905 | Unclassified | 1195 |
| 213 | Ga0207699_10020787 | 3300025906 | Bacteria | 3525 |
| 214 | Ga0207699_10040352 | 3300025906 | Bacteria | 2689 |
| 215 | Ga0207699_10114403 | 3300025906 | Unclassified | 1735 |
| 216 | Ga0207699_10291578 | 3300025906 | Bacteria | 1137 |
| 217 | Ga0207645_10000073 | 3300025907 | Bacteria | 71786 |
| 218 | Ga0207643_10001180 | 3300025908 | Bacteria | 15512 |
| 219 | Ga0207684_10107856 | 3300025910 | Bacteria | 2383 |
| 220 | Ga0207654_10426069 | 3300025911 | Unclassified | 927 |
| 221 | Ga0207707_10013122 | 3300025912 | Bacteria | 7219 |
| 222 | Ga0207695_10082799 | 3300025913 | Unclassified | 3242 |
| 223 | Ga0207695_10134031 | 3300025913 | Bacteria | 2432 |
| 224 | Ga0207695_10151557 | 3300025913 | Bacteria | 2257 |
| 225 | Ga0207695_10226772 | 3300025913 | Bacteria | 1774 |
| 226 | Ga0207695_10451223 | 3300025913 | Bacteria | 1169 |
| 227 | Ga0207671_10067771 | 3300025914 | Bacteria | 2658 |
| 228 | Ga0207671_10123793 | 3300025914 | Bacteria | 1978 |
| 229 | Ga0207671_10133087 | 3300025914 | Bacteria | 1910 |
| 230 | Ga0207671_10138805 | 3300025914 | Unclassified | 1871 |
| 231 | Ga0207671_10204977 | 3300025914 | Bacteria | 1541 |
| 232 | Ga0207693_10000658 | 3300025915 | Bacteria | 30974 |
| 233 | Ga0207693_10001326 | 3300025915 | Bacteria | 21912 |
| 234 | Ga0207693_10007435 | 3300025915 | Bacteria | 9009 |
| 235 | Ga0207693_10054544 | 3300025915 | Unclassified | 3135 |
| 236 | Ga0207663_10001294 | 3300025916 | Bacteria | 11603 |
| 237 | Ga0207663_10035124 | 3300025916 | Bacteria | 3004 |
| 238 | Ga0207663_10067221 | 3300025916 | Bacteria | 2298 |
| 239 | Ga0207663_10092813 | 3300025916 | Unclassified | 2008 |
| 240 | Ga0207663_10113446 | 3300025916 | Unclassified | 1843 |
| 241 | Ga0207660_10007333 | 3300025917 | Bacteria | 7136 |
| 242 | Ga0207660_10304901 | 3300025917 | Bacteria | 1269 |
| 243 | Ga0207662_10001315 | 3300025918 | Bacteria | 11968 |
| 244 | Ga0207657_10003001 | 3300025919 | Bacteria | 18081 |
| 245 | Ga0207657_10012792 | 3300025919 | Bacteria | 8259 |
| 246 | Ga0207649_10006519 | 3300025920 | Bacteria | 6341 |
| 247 | Ga0207649_10073528 | 3300025920 | Bacteria | 2190 |
| 248 | Ga0207652_10000659 | 3300025921 | Bacteria | 33877 |
| 249 | Ga0207652_10081322 | 3300025921 | Unclassified | 2834 |
| 250 | Ga0207652_10287162 | 3300025921 | Bacteria | 1484 |
| 251 | Ga0207694_10441000 | 3300025924 | Unclassified | 1086 |
| 252 | Ga0207694_10442416 | 3300025924 | Unclassified | 1084 |
| 253 | Ga0207650_10000045 | 3300025925 | Bacteria | 181507 |
| 254 | Ga0207659_10017249 | 3300025926 | Unclassified | 4713 |
| 255 | Ga0207687_10011481 | 3300025927 | Bacteria | 5788 |
| 256 | Ga0207687_10032051 | 3300025927 | Unclassified | 3557 |
| 257 | Ga0207700_10002892 | 3300025928 | Bacteria | 9900 |
| 258 | Ga0207700_10033624 | 3300025928 | Bacteria | 3671 |
| 259 | Ga0207700_10051950 | 3300025928 | Bacteria | 3062 |
| 260 | Ga0207700_10064504 | 3300025928 | Bacteria | 2790 |
| 261 | Ga0207700_10080398 | 3300025928 | Bacteria | 2541 |
| 262 | Ga0207700_10086527 | 3300025928 | Unclassified | 2463 |
| 263 | Ga0207700_10110200 | 3300025928 | Bacteria | 2213 |
| 264 | Ga0207700_10179131 | 3300025928 | Bacteria | 1773 |
| 265 | Ga0207700_10520104 | 3300025928 | Bacteria | 1054 |
| 266 | Ga0207664_10004723 | 3300025929 | Bacteria | 9247 |
| 267 | Ga0207664_10043803 | 3300025929 | Bacteria | 3503 |
| 268 | Ga0207664_10115212 | 3300025929 | Bacteria | 2241 |
| 269 | Ga0207664_10165053 | 3300025929 | Bacteria | 1891 |
| 270 | Ga0207664_10166771 | 3300025929 | Unclassified | 1882 |
| 271 | Ga0207644_10040200 | 3300025931 | Unclassified | 3305 |
| 272 | Ga0207644_10052981 | 3300025931 | Unclassified | 2918 |
| 273 | Ga0207706_10000213 | 3300025933 | Bacteria | 63821 |
| 274 | Ga0207706_10230224 | 3300025933 | Bacteria | 1622 |
| 275 | Ga0207670_10003534 | 3300025936 | Bacteria | 8292 |
| 276 | Ga0207669_10003050 | 3300025937 | Bacteria | 7215 |
| 277 | Ga0207665_10000054 | 3300025939 | Bacteria | 73528 |
| 278 | Ga0207665_10029592 | 3300025939 | Bacteria | 3620 |
| 279 | Ga0207665_10059122 | 3300025939 | Bacteria | 2593 |
| 280 | Ga0207665_10067906 | 3300025939 | Bacteria | 2428 |
| 281 | Ga0207665_10135276 | 3300025939 | Bacteria | 1753 |
| 282 | Ga0207691_10000556 | 3300025940 | Bacteria | 37289 |
| 283 | Ga0207711_10017493 | 3300025941 | Bacteria | 5954 |
| 284 | Ga0207689_10000185 | 3300025942 | Bacteria | 54094 |
| 285 | Ga0207689_10000780 | 3300025942 | Bacteria | 30597 |
| 286 | Ga0207661_10000992 | 3300025944 | Bacteria | 18770 |
| 287 | Ga0207661_10033508 | 3300025944 | Unclassified | 3987 |
| 288 | Ga0207679_10000525 | 3300025945 | Bacteria | 25943 |
| 289 | Ga0207667_10034427 | 3300025949 | Bacteria | 5438 |
| 290 | Ga0207667_10041150 | 3300025949 | Bacteria | 4916 |
| 291 | Ga0207667_10111188 | 3300025949 | Unclassified | 2826 |
| 292 | Ga0207667_10205653 | 3300025949 | Bacteria | 2019 |
| 293 | Ga0207667_10544157 | 3300025949 | Bacteria | 1175 |
| 294 | Ga0207712_10124817 | 3300025961 | Unclassified | 1953 |
| 295 | Ga0207668_10271073 | 3300025972 | Unclassified | 1387 |
| 296 | Ga0207640_10340405 | 3300025981 | Bacteria | 1201 |
| 297 | Ga0207658_10021007 | 3300025986 | Unclassified | 4526 |
| 298 | Ga0207703_10018946 | 3300026035 | Bacteria | 5376 |
| 299 | Ga0207703_10047343 | 3300026035 | Unclassified | 3466 |
| 300 | Ga0207639_10150597 | 3300026041 | Bacteria | 1948 |
| 301 | Ga0207639_10176228 | 3300026041 | Unclassified | 1815 |
| 302 | Ga0207639_10228334 | 3300026041 | Bacteria | 1612 |
| 303 | Ga0207678_10000026 | 3300026067 | Bacteria | 116850 |
| 304 | Ga0207708_10187927 | 3300026075 | Unclassified | 1643 |
| 305 | Ga0207702_10013286 | 3300026078 | Bacteria | 6848 |
| 306 | Ga0207702_10744572 | 3300026078 | Bacteria | 967 |
| 307 | Ga0207641_10000075 | 3300026088 | Bacteria | 145149 |
| 308 | Ga0207641_10264138 | 3300026088 | Bacteria | 1613 |
| 309 | Ga0207648_10000679 | 3300026089 | Bacteria | 38160 |
| 310 | Ga0207648_10016025 | 3300026089 | Archaea | 6867 |
| 311 | Ga0207676_10000669 | 3300026095 | Bacteria | 27440 |
| 312 | Ga0207674_10000559 | 3300026116 | Bacteria | 48687 |
| 313 | Ga0207674_10056443 | 3300026116 | Bacteria | 3988 |
| 314 | Ga0207675_100015010 | 3300026118 | Bacteria | 7228 |
| 315 | Ga0207675_100163906 | 3300026118 | Bacteria | 2122 |
| 316 | Ga0207683_10000438 | 3300026121 | Bacteria | 38515 |
| 317 | Ga0207698_10011814 | 3300026142 | Bacteria | 5682 |
| 318 | Ga0207698_10169027 | 3300026142 | Bacteria | 1923 |
| 319 | Ga0265356_1001512 | 3300028017 | Bacteria | 3400 |
| 320 | Ga0268266_10001444 | 3300028379 | Bacteria | 28286 |
| 321 | Ga0268266_10339196 | 3300028379 | Bacteria | 1410 |
| 322 | Ga0268265_10017979 | 3300028380 | Unclassified | 4891 |
| 323 | Ga0268264_10005658 | 3300028381 | Bacteria | 10591 |
| 324 | Ga0268264_10155665 | 3300028381 | Bacteria | 2053 |
| 325 | Ga0265338_10028135 | 3300028800 | Bacteria | 5616 |
| 326 | Ga0265338_10039015 | 3300028800 | Unclassified | 4489 |
| 327 | Ga0265338_10047135 | 3300028800 | Bacteria | 3940 |
| 328 | Ga0265332_10049037 | 3300031238 | Unclassified | 1816 |
| 329 | Ga0265328_10013670 | 3300031239 | Unclassified | 3208 |
| 330 | Ga0265325_10001599 | 3300031241 | Bacteria | 15804 |
| 331 | Ga0265325_10012794 | 3300031241 | Bacteria | 4788 |
| 332 | Ga0265340_10000590 | 3300031247 | Bacteria | 20174 |
| 333 | Ga0265339_10106341 | 3300031249 | Bacteria | 1456 |
| 334 | Ga0265327_10030880 | 3300031251 | Unclassified | 3020 |
| 335 | Ga0265313_10009611 | 3300031595 | Bacteria | 6256 |
| 336 | Ga0373926_0002213 | 3300035083 | Bacteria | 6138 |
| 337 | Ga0373926_0005482 | 3300035083 | Bacteria | 4187 |
| 338 | Ga0373956_0009028 | 3300035119 | Unclassified | 4042 |
| 339 | Ga0373957_0055449 | 3300035120 | Unclassified | 1524 |
| 340 | Ga0373943_0014123 | 3300035170 | Bacteria | 3611 |
| 341 | Ga0373946_0004111 | 3300035171 | Bacteria | 5185 |
| 342 | Ga0373946_0011099 | 3300035171 | Bacteria | 3351 |
| 343 | Ga0373924_0000059 | 3300035410 | Bacteria | 28501 |
| 344 | Ga0373935_0003805 | 3300035692 | Bacteria | 8813 |
| 345 | Ga0373935_0007693 | 3300035692 | Bacteria | 6458 |
| 346 | Ga0373935_0489133 | 3300035692 | Bacteria | 892 |
| 347 | Ga0373927_0006966 | 3300035695 | Bacteria | 7673 |
| 348 | Ga0373927_0018811 | 3300035695 | Bacteria | 4533 |
| 349 | Ga0373933_0328427 | 3300035724 | Unclassified | 992 |
| 350 | Ga0373947_0027507 | 3300035725 | Bacteria | 3328 |
| 351 | Ga0373937_0000408 | 3300036401 | Bacteria | 40094 |
| 352 | Ga0373937_0116844 | 3300036401 | Bacteria | 2484 |
| 353 | Ga0373937_0276386 | 3300036401 | Bacteria | 1586 |
| 354 | Ga0373925_0036616 | 3300037068 | Bacteria | 3622 |
| 355 | Ga0373925_0088378 | 3300037068 | Bacteria | 2366 |
| 356 | Ga0373925_0117326 | 3300037068 | Bacteria | 2062 |
| 357 | Ga0373925_0119039 | 3300037068 | Bacteria | 2048 |
| 358 | Ga0373925_0319501 | 3300037068 | Bacteria | 1256 |
| 359 | Ga0373925_0731438 | 3300037068 | Unclassified | 816 |
| 360 | Ga0395905_0014399 | 3300037471 | Bacteria | 7554 |
| 361 | Ga0395905_0085048 | 3300037471 | Unclassified | 2964 |
| 362 | Ga0395905_0100625 | 3300037471 | Bacteria | 2714 |
| 363 | Ga0436360_1170157 | 3300039438 | Unclassified | 1484 |
| 364 | Ga0436363_0647176 | 3300039450 | Bacteria | 1320 |
| 365 | Ga0436363_0711235 | 3300039450 | Unclassified | 2193 |
| 366 | Ga0466961_0192197 | 3300044693 | Bacteria | 1265 |
| 367 | Ga0466963_0001969 | 3300044694 | Bacteria | 11279 |
| 368 | Ga0466963_0017273 | 3300044694 | Bacteria | 4496 |
| 369 | Ga0466963_0045176 | 3300044694 | Bacteria | 2901 |
| 370 | Ga0466957_0000625 | 3300044842 | Bacteria | 17898 |
| 371 | Ga0466957_0295137 | 3300044842 | Bacteria | 1088 |
| 372 | Ga0466959_0014979 | 3300045049 | Bacteria | 5651 |
| 373 | Ga0451576_0300520 | 3300045051 | Bacteria | 1679 |
| 374 | Ga0466958_0237979 | 3300045836 | Bacteria | 1163 |
| 375 | Ga0466967_0001038 | 3300045976 | Bacteria | 15242 |
| 376 | Ga0466967_0067684 | 3300045976 | Unclassified | 3186 |
| 377 | Ga0495603_0041371 | 3300046455 | Bacteria | 2756 |
| 378 | Ga0495590_0027536 | 3300046457 | Bacteria | 1994 |
| 379 | Ga0495651_0013651 | 3300046462 | Bacteria | 6279 |
| 380 | Ga0495580_0000068 | 3300046472 | Bacteria | 63122 |
| 381 | Ga0495580_0003297 | 3300046472 | Bacteria | 13795 |
| 382 | Ga0495580_0004476 | 3300046472 | Bacteria | 11738 |
| 383 | Ga0495580_0014337 | 3300046472 | Bacteria | 6013 |
| 384 | Ga0495580_0023514 | 3300046472 | Unclassified | 4524 |
| 385 | Ga0495580_0057747 | 3300046472 | Unclassified | 2731 |
| 386 | Ga0495580_0137131 | 3300046472 | Unclassified | 1696 |
| 387 | Ga0495582_0068588 | 3300046473 | Unclassified | 1960 |
| 388 | Ga0495582_0074808 | 3300046473 | Bacteria | 1875 |
| 389 | Ga0495664_0270592 | 3300046477 | Bacteria | 1027 |
| 390 | Ga0495594_0040150 | 3300046499 | Bacteria | 2560 |
| 391 | Ga0495608_0235949 | 3300046511 | Bacteria | 1144 |
| 392 | Ga0495630_0454526 | 3300046517 | Unclassified | 982 |
| 393 | Ga0495665_0057207 | 3300046531 | Bacteria | 2058 |
| 394 | Ga0495665_0189698 | 3300046531 | Bacteria | 1066 |
| 395 | Ga0495635_0205242 | 3300046663 | Bacteria | 1336 |
| 396 | Ga0495659_0027422 | 3300046664 | Unclassified | 1965 |
| 397 | Ga0495623_0014046 | 3300046679 | Bacteria | 5188 |
| 398 | Ga0495647_0121513 | 3300046681 | Unclassified | 1099 |
| 399 | Ga0495669_0003332 | 3300046684 | Bacteria | 6612 |
| 400 | Ga0495624_0069533 | 3300046690 | Bacteria | 2193 |
| 401 | Ga0495581_0376677 | 3300047315 | Unclassified | 828 |
| 402 | Ga0495604_0071514 | 3300047317 | Bacteria | 2624 |
| 403 | Ga0495636_0061597 | 3300047318 | Unclassified | 1587 |
| 404 | Ga0495674_0254358 | 3300047319 | Unclassified | 1445 |
| 405 | Ga0495677_0068280 | 3300047445 | Unclassified | 1323 |
| 406 | Ga0495602_0138230 | 3300048088 | Unclassified | 1932 |
| 407 | Ga0495602_0318869 | 3300048088 | Unclassified | 1131 |
| 408 | Ga0496100_0018545 | 3300048903 | Bacteria | 4130 |
| 409 | Ga0496101_0045797 | 3300048904 | Unclassified | 3135 |
| 410 | Ga0496102_0212791 | 3300048905 | Bacteria | 1822 |
| 411 | Ga0496102_0234953 | 3300048905 | Unclassified | 1728 |
| 412 | Ga0496102_0414102 | 3300048905 | Bacteria | 1266 |
| 413 | Ga0496102_0604830 | 3300048905 | Unclassified | 1019 |
| 414 | Ga0496103_0082127 | 3300048906 | Bacteria | 2028 |
| 415 | Ga0496104_0076640 | 3300048907 | Bacteria | 3185 |
| 416 | Ga0496104_0101610 | 3300048907 | Bacteria | 2753 |
| 417 | Ga0496104_0164409 | 3300048907 | Bacteria | 2128 |
| 418 | Ga0496105_0000590 | 3300048908 | Bacteria | 24188 |
| 419 | Ga0496108_0000957 | 3300048911 | Bacteria | 22443 |
| 420 | Ga0496108_0045441 | 3300048911 | Bacteria | 3668 |
| 421 | Ga0496109_0000164 | 3300048912 | Bacteria | 65491 |
| 422 | Ga0496109_0421090 | 3300048912 | Bacteria | 1261 |
| 423 | Ga0496110_0017520 | 3300048913 | Bacteria | 5992 |
| 424 | Ga0496110_0065113 | 3300048913 | Bacteria | 3222 |
| 425 | Ga0496110_0074527 | 3300048913 | Bacteria | 3014 |
| 426 | Ga0496110_0128310 | 3300048913 | Bacteria | 2289 |
| 427 | Ga0496111_0000490 | 3300048914 | Bacteria | 20373 |
| 428 | Ga0496111_0186235 | 3300048914 | Unclassified | 1543 |
| 429 | Ga0496111_0336137 | 3300048914 | Bacteria | 1118 |
| 430 | Ga0496112_0000078 | 3300048915 | Bacteria | 64712 |
| 431 | Ga0496112_0002375 | 3300048915 | Bacteria | 15130 |
| 432 | Ga0496112_0024793 | 3300048915 | Bacteria | 5752 |
| 433 | Ga0496112_0034942 | 3300048915 | Bacteria | 4892 |
| 434 | Ga0496112_0176645 | 3300048915 | Bacteria | 2100 |
| 435 | Ga0496112_0220701 | 3300048915 | Bacteria | 1852 |
| 436 | Ga0496112_0268762 | 3300048915 | Bacteria | 1653 |
| 437 | Ga0496112_0374991 | 3300048915 | Unclassified | 1364 |
| 438 | Ga0496113_0005389 | 3300048916 | Bacteria | 7975 |
| 439 | Ga0496113_0059240 | 3300048916 | Unclassified | 2884 |
| 440 | Ga0496113_0185554 | 3300048916 | Unclassified | 1649 |
| 441 | Ga0496113_0193963 | 3300048916 | Bacteria | 1613 |
| 442 | Ga0496115_0441694 | 3300048918 | Unclassified | 1052 |
| 443 | nmdc:mga05p37_1167274_c1 | 3300050507 | Bacteria | 799 |
| 444 | nmdc:mga0n895_1237_c1 | 3300050512 | Bacteria | 18843 |
| 445 | nmdc:mga0n895_168177_c1 | 3300050512 | Bacteria | 2224 |
| 446 | nmdc:mga08x19_286069_c1 | 3300050514 | Bacteria | 1143 |
| 447 | nmdc:mga08x19_66726_c1 | 3300050514 | Bacteria | 2339 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300004799 | Ga0058863_10581641 | Ga0058863_105816412 | 201 |
| 2 | 3300005336 | Ga0070680_100001944 | Ga0070680_1000019448 | 201 |
| 3 | 3300005530 | Ga0070679_100006726 | Ga0070679_1000067265 | 201 |
| 4 | 3300025921 | Ga0207652_10000659 | Ga0207652_1000065927 | 201 |
| 5 | 3300025913 | Ga0207695_10451223 | Ga0207695_104512232 | 203 |
| 6 | 3300048905 | Ga0496102_0414102 | Ga0496102_0414102_559_1245 | 209 |
| 7 | 3300047319 | Ga0495674_0254358 | Ga0495674_0254358_14_676 | 219 |
| 8 | 3300037471 | Ga0395905_0100625 | Ga0395905_0100625_1422_2219 | 221 |
| 9 | 3300037068 | Ga0373925_0731438 | Ga0373925_0731438_14_718 | 233 |
| 10 | 3300048905 | Ga0496102_0212791 | Ga0496102_0212791_1032_1733 | 233 |
| 11 | 3300048915 | Ga0496112_0024793 | Ga0496112_0024793_2822_3604 | 238 |
| 12 | 3300050507 | nmdc:mga05p37_1167274_c1 | nmdc:mga05p37_1167274_c1_12_737 | 239 |
| 13 | 3300005841 | Ga0068863_100259026 | Ga0068863_1002590262 | 241 |
| 14 | 3300014325 | Ga0163163_10315754 | Ga0163163_103157542 | 241 |
| 15 | 3300025904 | Ga0207647_10007156 | Ga0207647_100071567 | 241 |
| 16 | 3300005535 | Ga0070684_100039793 | Ga0070684_1000397935 | 242 |
| 17 | 3300014969 | Ga0157376_10003116 | Ga0157376_100031169 | 242 |
| 18 | 3300035692 | Ga0373935_0489133 | Ga0373935_0489133_124_855 | 242 |
| 19 | 3300044694 | Ga0466963_0001969 | Ga0466963_0001969_1590_2372 | 242 |
| 20 | 3300048907 | Ga0496104_0076640 | Ga0496104_0076640_372_1103 | 242 |
| 21 | 3300048907 | Ga0496104_0164409 | Ga0496104_0164409_774_1556 | 242 |
| 22 | 3300048914 | Ga0496111_0336137 | Ga0496111_0336137_29_760 | 242 |
| 23 | 3300005434 | Ga0070709_10136345 | Ga0070709_101363452 | 244 |
| 24 | 3300005436 | Ga0070713_100516981 | Ga0070713_1005169812 | 244 |
| 25 | 3300005439 | Ga0070711_100017764 | Ga0070711_1000177644 | 244 |
| 26 | 3300006028 | Ga0070717_10159166 | Ga0070717_101591662 | 244 |
| 27 | 3300007788 | Ga0099795_10032332 | Ga0099795_100323321 | 244 |
| 28 | 3300025906 | Ga0207699_10040352 | Ga0207699_100403523 | 244 |
| 29 | 3300025906 | Ga0207699_10114403 | Ga0207699_101144032 | 244 |
| 30 | 3300025916 | Ga0207663_10113446 | Ga0207663_101134462 | 244 |
| 31 | 3300048905 | Ga0496102_0604830 | Ga0496102_0604830_117_908 | 244 |
| 32 | 3300025906 | Ga0207699_10020787 | Ga0207699_100207873 | 245 |
| 33 | 3300028017 | Ga0265356_1001512 | Ga0265356_10015122 | 246 |
| 34 | 3300005434 | Ga0070709_10085458 | Ga0070709_100854581 | 249 |
| 35 | 3300005436 | Ga0070713_100018895 | Ga0070713_1000188952 | 249 |
| 36 | 3300005439 | Ga0070711_100077887 | Ga0070711_1000778872 | 249 |
| 37 | 3300006173 | Ga0070716_100147599 | Ga0070716_1001475992 | 249 |
| 38 | 3300006175 | Ga0070712_100007712 | Ga0070712_1000077123 | 249 |
| 39 | 3300025915 | Ga0207693_10054544 | Ga0207693_100545443 | 249 |
| 40 | 3300025928 | Ga0207700_10086527 | Ga0207700_100865272 | 249 |
| 41 | 3300004803 | Ga0058862_12178919 | Ga0058862_121789192 | 250 |
| 42 | 3300005458 | Ga0070681_10009976 | Ga0070681_100099764 | 250 |
| 43 | 3300025912 | Ga0207707_10013122 | Ga0207707_100131222 | 250 |
| 44 | 3300025917 | Ga0207660_10007333 | Ga0207660_100073336 | 250 |
| 45 | 3300035695 | Ga0373927_0018811 | Ga0373927_0018811_2143_2940 | 252 |
| 46 | 3300037068 | Ga0373925_0036616 | Ga0373925_0036616_2743_3540 | 252 |
| 47 | 3300046472 | Ga0495580_0000068 | Ga0495580_0000068_37800_38597 | 252 |
| 48 | 3300046531 | Ga0495665_0189698 | Ga0495665_0189698_107_904 | 252 |
| 49 | 3300047315 | Ga0495581_0376677 | Ga0495581_0376677_14_811 | 252 |
| 50 | 3300005366 | Ga0070659_100680844 | Ga0070659_1006808441 | 257 |
| 51 | 3300037471 | Ga0395905_0014399 | Ga0395905_0014399_5245_6039 | 257 |
| 52 | 3300037471 | Ga0395905_0085048 | Ga0395905_0085048_1753_2550 | 257 |
| 53 | 3300045049 | Ga0466959_0014979 | Ga0466959_0014979_71_847 | 257 |
| 54 | 3300046684 | Ga0495669_0003332 | Ga0495669_0003332_1700_2482 | 257 |
| 55 | 3300005336 | Ga0070680_100201210 | Ga0070680_1002012102 | 258 |
| 56 | 3300005436 | Ga0070713_100112416 | Ga0070713_1001124162 | 258 |
| 57 | 3300005437 | Ga0070710_10126920 | Ga0070710_101269202 | 258 |
| 58 | 3300005437 | Ga0070710_10214896 | Ga0070710_102148962 | 258 |
| 59 | 3300005458 | Ga0070681_10024936 | Ga0070681_100249364 | 258 |
| 60 | 3300005530 | Ga0070679_100006533 | Ga0070679_1000065333 | 258 |
| 61 | 3300006163 | Ga0070715_10079798 | Ga0070715_100797982 | 258 |
| 62 | 3300025917 | Ga0207660_10304901 | Ga0207660_103049011 | 258 |
| 63 | 3300025929 | Ga0207664_10166771 | Ga0207664_101667712 | 258 |
| 64 | 3300025939 | Ga0207665_10029592 | Ga0207665_100295922 | 258 |
| 65 | 3300035724 | Ga0373933_0328427 | Ga0373933_0328427_101_886 | 258 |
| 66 | 3300044694 | Ga0466963_0045176 | Ga0466963_0045176_1422_2237 | 258 |
| 67 | 3300044842 | Ga0466957_0000625 | Ga0466957_0000625_15031_15810 | 258 |
| 68 | 3300044842 | Ga0466957_0295137 | Ga0466957_0295137_102_917 | 258 |
| 69 | 3300046462 | Ga0495651_0013651 | Ga0495651_0013651_2168_2947 | 258 |
| 70 | 3300047317 | Ga0495604_0071514 | Ga0495604_0071514_1764_2543 | 258 |
| 71 | 3300048912 | Ga0496109_0421090 | Ga0496109_0421090_115_894 | 258 |
| 72 | 3300048913 | Ga0496110_0065113 | Ga0496110_0065113_777_1556 | 258 |
| 73 | 3300048914 | Ga0496111_0000490 | Ga0496111_0000490_931_1710 | 258 |
| 74 | 3300048915 | Ga0496112_0034942 | Ga0496112_0034942_1939_2718 | 258 |
| 75 | 3300048916 | Ga0496113_0193963 | Ga0496113_0193963_681_1460 | 258 |
| 76 | 3300048918 | Ga0496115_0441694 | Ga0496115_0441694_124_903 | 258 |
| 77 | 3300005329 | Ga0070683_100056172 | Ga0070683_1000561723 | 259 |
| 78 | 3300005329 | Ga0070683_100111052 | Ga0070683_1001110523 | 259 |
| 79 | 3300005434 | Ga0070709_10019563 | Ga0070709_100195634 | 259 |
| 80 | 3300005436 | Ga0070713_100259880 | Ga0070713_1002598801 | 259 |
| 81 | 3300005436 | Ga0070713_100363852 | Ga0070713_1003638522 | 259 |
| 82 | 3300005437 | Ga0070710_10024303 | Ga0070710_100243033 | 259 |
| 83 | 3300005439 | Ga0070711_100001945 | Ga0070711_1000019458 | 259 |
| 84 | 3300005439 | Ga0070711_100021933 | Ga0070711_1000219333 | 259 |
| 85 | 3300005439 | Ga0070711_100025099 | Ga0070711_1000250994 | 259 |
| 86 | 3300005458 | Ga0070681_10071909 | Ga0070681_100719092 | 259 |
| 87 | 3300005530 | Ga0070679_100267122 | Ga0070679_1002671221 | 259 |
| 88 | 3300005539 | Ga0068853_100014106 | Ga0068853_1000141063 | 259 |
| 89 | 3300005543 | Ga0070672_100207767 | Ga0070672_1002077672 | 259 |
| 90 | 3300005547 | Ga0070693_100138514 | Ga0070693_1001385142 | 259 |
| 91 | 3300005548 | Ga0070665_100187197 | Ga0070665_1001871973 | 259 |
| 92 | 3300005563 | Ga0068855_100020697 | Ga0068855_1000206972 | 259 |
| 93 | 3300005563 | Ga0068855_100529520 | Ga0068855_1005295202 | 259 |
| 94 | 3300005614 | Ga0068856_100024943 | Ga0068856_1000249436 | 259 |
| 95 | 3300005616 | Ga0068852_100117355 | Ga0068852_1001173552 | 259 |
| 96 | 3300005616 | Ga0068852_100328932 | Ga0068852_1003289322 | 259 |
| 97 | 3300005842 | Ga0068858_100002926 | Ga0068858_1000029264 | 259 |
| 98 | 3300005843 | Ga0068860_100241666 | Ga0068860_1002416662 | 259 |
| 99 | 3300006028 | Ga0070717_10244196 | Ga0070717_102441961 | 259 |
| 100 | 3300006173 | Ga0070716_100001082 | Ga0070716_1000010828 | 259 |
| 101 | 3300006175 | Ga0070712_100001573 | Ga0070712_1000015739 | 259 |
| 102 | 3300006175 | Ga0070712_100010482 | Ga0070712_1000104825 | 259 |
| 103 | 3300006871 | Ga0075434_100166153 | Ga0075434_1001661532 | 259 |
| 104 | 3300006914 | Ga0075436_100048770 | Ga0075436_1000487702 | 259 |
| 105 | 3300007788 | Ga0099795_10052115 | Ga0099795_100521152 | 259 |
| 106 | 3300009093 | Ga0105240_10055234 | Ga0105240_100552344 | 259 |
| 107 | 3300009093 | Ga0105240_10331966 | Ga0105240_103319661 | 259 |
| 108 | 3300009098 | Ga0105245_10025889 | Ga0105245_100258892 | 259 |
| 109 | 3300009098 | Ga0105245_10398305 | Ga0105245_103983052 | 259 |
| 110 | 3300009174 | Ga0105241_10352474 | Ga0105241_103524742 | 259 |
| 111 | 3300009176 | Ga0105242_10422065 | Ga0105242_104220652 | 259 |
| 112 | 3300010375 | Ga0105239_10973112 | Ga0105239_109731122 | 259 |
| 113 | 3300013296 | Ga0157374_10236520 | Ga0157374_102365202 | 259 |
| 114 | 3300025898 | Ga0207692_10006399 | Ga0207692_100063994 | 259 |
| 115 | 3300025899 | Ga0207642_10108616 | Ga0207642_101086162 | 259 |
| 116 | 3300025913 | Ga0207695_10082799 | Ga0207695_100827993 | 259 |
| 117 | 3300025914 | Ga0207671_10204977 | Ga0207671_102049771 | 259 |
| 118 | 3300025915 | Ga0207693_10001326 | Ga0207693_100013261 | 259 |
| 119 | 3300025915 | Ga0207693_10007435 | Ga0207693_100074352 | 259 |
| 120 | 3300025916 | Ga0207663_10001294 | Ga0207663_100012945 | 259 |
| 121 | 3300025916 | Ga0207663_10035124 | Ga0207663_100351243 | 259 |
| 122 | 3300025921 | Ga0207652_10081322 | Ga0207652_100813223 | 259 |
| 123 | 3300025927 | Ga0207687_10011481 | Ga0207687_100114814 | 259 |
| 124 | 3300025928 | Ga0207700_10179131 | Ga0207700_101791313 | 259 |
| 125 | 3300025928 | Ga0207700_10520104 | Ga0207700_105201042 | 259 |
| 126 | 3300025939 | Ga0207665_10000054 | Ga0207665_1000005412 | 259 |
| 127 | 3300025942 | Ga0207689_10000185 | Ga0207689_1000018523 | 259 |
| 128 | 3300025944 | Ga0207661_10033508 | Ga0207661_100335082 | 259 |
| 129 | 3300025949 | Ga0207667_10041150 | Ga0207667_100411503 | 259 |
| 130 | 3300026035 | Ga0207703_10018946 | Ga0207703_100189466 | 259 |
| 131 | 3300026041 | Ga0207639_10176228 | Ga0207639_101762282 | 259 |
| 132 | 3300026078 | Ga0207702_10744572 | Ga0207702_107445722 | 259 |
| 133 | 3300026089 | Ga0207648_10016025 | Ga0207648_100160254 | 259 |
| 134 | 3300026118 | Ga0207675_100163906 | Ga0207675_1001639062 | 259 |
| 135 | 3300028381 | Ga0268264_10155665 | Ga0268264_101556652 | 259 |
| 136 | 3300031238 | Ga0265332_10049037 | Ga0265332_100490372 | 259 |
| 137 | 3300031239 | Ga0265328_10013670 | Ga0265328_100136702 | 259 |
| 138 | 3300031241 | Ga0265325_10001599 | Ga0265325_100015999 | 259 |
| 139 | 3300031247 | Ga0265340_10000590 | Ga0265340_1000059013 | 259 |
| 140 | 3300031251 | Ga0265327_10030880 | Ga0265327_100308803 | 259 |
| 141 | 3300031595 | Ga0265313_10009611 | Ga0265313_100096114 | 259 |
| 142 | 3300035083 | Ga0373926_0002213 | Ga0373926_0002213_121_903 | 259 |
| 143 | 3300035083 | Ga0373926_0005482 | Ga0373926_0005482_1613_2401 | 259 |
| 144 | 3300035119 | Ga0373956_0009028 | Ga0373956_0009028_2075_2857 | 259 |
| 145 | 3300035120 | Ga0373957_0055449 | Ga0373957_0055449_661_1443 | 259 |
| 146 | 3300035170 | Ga0373943_0014123 | Ga0373943_0014123_66_854 | 259 |
| 147 | 3300035171 | Ga0373946_0004111 | Ga0373946_0004111_3847_4635 | 259 |
| 148 | 3300035171 | Ga0373946_0011099 | Ga0373946_0011099_2531_3319 | 259 |
| 149 | 3300035410 | Ga0373924_0000059 | Ga0373924_0000059_20237_21025 | 259 |
| 150 | 3300035692 | Ga0373935_0003805 | Ga0373935_0003805_393_1181 | 259 |
| 151 | 3300035692 | Ga0373935_0007693 | Ga0373935_0007693_3945_4733 | 259 |
| 152 | 3300035695 | Ga0373927_0006966 | Ga0373927_0006966_556_1344 | 259 |
| 153 | 3300035725 | Ga0373947_0027507 | Ga0373947_0027507_1717_2505 | 259 |
| 154 | 3300036401 | Ga0373937_0000408 | Ga0373937_0000408_3640_4422 | 259 |
| 155 | 3300036401 | Ga0373937_0116844 | Ga0373937_0116844_840_1622 | 259 |
| 156 | 3300037068 | Ga0373925_0088378 | Ga0373925_0088378_889_1677 | 259 |
| 157 | 3300037068 | Ga0373925_0117326 | Ga0373925_0117326_392_1174 | 259 |
| 158 | 3300039450 | Ga0436363_0647176 | Ga0436363_0647176_22_801 | 259 |
| 159 | 3300045836 | Ga0466958_0237979 | Ga0466958_0237979_203_985 | 259 |
| 160 | 3300046455 | Ga0495603_0041371 | Ga0495603_0041371_1668_2447 | 259 |
| 161 | 3300046472 | Ga0495580_0003297 | Ga0495580_0003297_5189_5968 | 259 |
| 162 | 3300046472 | Ga0495580_0004476 | Ga0495580_0004476_3326_4105 | 259 |
| 163 | 3300046472 | Ga0495580_0023514 | Ga0495580_0023514_2270_3049 | 259 |
| 164 | 3300046472 | Ga0495580_0057747 | Ga0495580_0057747_929_1708 | 259 |
| 165 | 3300046472 | Ga0495580_0137131 | Ga0495580_0137131_729_1511 | 259 |
| 166 | 3300046473 | Ga0495582_0068588 | Ga0495582_0068588_57_839 | 259 |
| 167 | 3300046473 | Ga0495582_0074808 | Ga0495582_0074808_1024_1812 | 259 |
| 168 | 3300046477 | Ga0495664_0270592 | Ga0495664_0270592_67_855 | 259 |
| 169 | 3300046499 | Ga0495594_0040150 | Ga0495594_0040150_1613_2392 | 259 |
| 170 | 3300046511 | Ga0495608_0235949 | Ga0495608_0235949_327_1115 | 259 |
| 171 | 3300046517 | Ga0495630_0454526 | Ga0495630_0454526_79_867 | 259 |
| 172 | 3300046531 | Ga0495665_0057207 | Ga0495665_0057207_1058_1846 | 259 |
| 173 | 3300046664 | Ga0495659_0027422 | Ga0495659_0027422_1112_1891 | 259 |
| 174 | 3300046679 | Ga0495623_0014046 | Ga0495623_0014046_3511_4293 | 259 |
| 175 | 3300046681 | Ga0495647_0121513 | Ga0495647_0121513_96_875 | 259 |
| 176 | 3300046690 | Ga0495624_0069533 | Ga0495624_0069533_297_1085 | 259 |
| 177 | 3300047318 | Ga0495636_0061597 | Ga0495636_0061597_725_1504 | 259 |
| 178 | 3300048907 | Ga0496104_0101610 | Ga0496104_0101610_433_1221 | 259 |
| 179 | 3300048908 | Ga0496105_0000590 | Ga0496105_0000590_14890_15672 | 259 |
| 180 | 3300048913 | Ga0496110_0128310 | Ga0496110_0128310_1051_1839 | 259 |
| 181 | 3300048915 | Ga0496112_0002375 | Ga0496112_0002375_2174_2962 | 259 |
| 182 | 3300048915 | Ga0496112_0176645 | Ga0496112_0176645_977_1756 | 259 |
| 183 | 3300048915 | Ga0496112_0220701 | Ga0496112_0220701_490_1272 | 259 |
| 184 | 3300048916 | Ga0496113_0185554 | Ga0496113_0185554_621_1409 | 259 |
| 185 | 3300050512 | nmdc:mga0n895_168177_c1 | nmdc:mga0n895_168177_c1_801_1583 | 259 |
| 186 | 3300050514 | nmdc:mga08x19_66726_c1 | nmdc:mga08x19_66726_c1_757_1539 | 259 |
| 187 | 3300005434 | Ga0070709_10123995 | Ga0070709_101239952 | 260 |
| 188 | 3300005435 | Ga0070714_100001244 | Ga0070714_1000012448 | 260 |
| 189 | 3300005436 | Ga0070713_100005742 | Ga0070713_1000057425 | 260 |
| 190 | 3300005563 | Ga0068855_100032998 | Ga0068855_1000329984 | 260 |
| 191 | 3300005563 | Ga0068855_100045068 | Ga0068855_1000450683 | 260 |
| 192 | 3300005578 | Ga0068854_100207623 | Ga0068854_1002076232 | 260 |
| 193 | 3300005614 | Ga0068856_100032885 | Ga0068856_1000328854 | 260 |
| 194 | 3300005614 | Ga0068856_100201069 | Ga0068856_1002010692 | 260 |
| 195 | 3300005616 | Ga0068852_100244302 | Ga0068852_1002443023 | 260 |
| 196 | 3300006028 | Ga0070717_10005444 | Ga0070717_100054446 | 260 |
| 197 | 3300009093 | Ga0105240_10801969 | Ga0105240_108019692 | 260 |
| 198 | 3300009174 | Ga0105241_10186146 | Ga0105241_101861462 | 260 |
| 199 | 3300009545 | Ga0105237_10103263 | Ga0105237_101032633 | 260 |
| 200 | 3300009551 | Ga0105238_10038663 | Ga0105238_100386633 | 260 |
| 201 | 3300013104 | Ga0157370_10036441 | Ga0157370_100364412 | 260 |
| 202 | 3300013105 | Ga0157369_10023020 | Ga0157369_100230203 | 260 |
| 203 | 3300013307 | Ga0157372_10206008 | Ga0157372_102060082 | 260 |
| 204 | 3300014325 | Ga0163163_10021773 | Ga0163163_100217733 | 260 |
| 205 | 3300025906 | Ga0207699_10291578 | Ga0207699_102915782 | 260 |
| 206 | 3300025913 | Ga0207695_10134031 | Ga0207695_101340312 | 260 |
| 207 | 3300025914 | Ga0207671_10067771 | Ga0207671_100677712 | 260 |
| 208 | 3300025914 | Ga0207671_10123793 | Ga0207671_101237932 | 260 |
| 209 | 3300025928 | Ga0207700_10051950 | Ga0207700_100519503 | 260 |
| 210 | 3300025929 | Ga0207664_10004723 | Ga0207664_100047232 | 260 |
| 211 | 3300025929 | Ga0207664_10165053 | Ga0207664_101650532 | 260 |
| 212 | 3300025949 | Ga0207667_10034427 | Ga0207667_100344272 | 260 |
| 213 | 3300025949 | Ga0207667_10205653 | Ga0207667_102056532 | 260 |
| 214 | 3300026041 | Ga0207639_10228334 | Ga0207639_102283342 | 260 |
| 215 | 3300026078 | Ga0207702_10013286 | Ga0207702_100132863 | 260 |
| 216 | 3300028800 | Ga0265338_10028135 | Ga0265338_100281353 | 260 |
| 217 | 3300031241 | Ga0265325_10012794 | Ga0265325_100127943 | 260 |
| 218 | 3300031249 | Ga0265339_10106341 | Ga0265339_101063411 | 260 |
| 219 | 3300039450 | Ga0436363_0711235 | Ga0436363_0711235_661_1446 | 260 |
| 220 | 3300044693 | Ga0466961_0192197 | Ga0466961_0192197_77_859 | 260 |
| 221 | 3300044694 | Ga0466963_0017273 | Ga0466963_0017273_1024_1806 | 260 |
| 222 | 3300045976 | Ga0466967_0001038 | Ga0466967_0001038_3597_4379 | 260 |
| 223 | 3300047445 | Ga0495677_0068280 | Ga0495677_0068280_399_1199 | 260 |
| 224 | 3300048915 | Ga0496112_0374991 | Ga0496112_0374991_240_1040 | 260 |
| 225 | 3300050514 | nmdc:mga08x19_286069_c1 | nmdc:mga08x19_286069_c1_151_933 | 260 |
| 226 | 3300003323 | rootH1_10391135 | rootH1_103911351 | 261 |
| 227 | 3300005439 | Ga0070711_100464480 | Ga0070711_1004644801 | 261 |
| 228 | 3300013105 | Ga0157369_10000442 | Ga0157369_1000044227 | 261 |
| 229 | 3300045051 | Ga0451576_0300520 | Ga0451576_0300520_390_1181 | 261 |
| 230 | 3300045976 | Ga0466967_0067684 | Ga0466967_0067684_1354_2142 | 261 |
| 231 | 3300005437 | Ga0070710_10134612 | Ga0070710_101346122 | 262 |
| 232 | 3300005439 | Ga0070711_100169305 | Ga0070711_1001693052 | 262 |
| 233 | 3300005445 | Ga0070708_100023099 | Ga0070708_1000230992 | 262 |
| 234 | 3300005468 | Ga0070707_100159229 | Ga0070707_1001592292 | 262 |
| 235 | 3300006028 | Ga0070717_10004778 | Ga0070717_100047789 | 262 |
| 236 | 3300006028 | Ga0070717_10012832 | Ga0070717_100128324 | 262 |
| 237 | 3300006028 | Ga0070717_10108057 | Ga0070717_101080572 | 262 |
| 238 | 3300009174 | Ga0105241_10362951 | Ga0105241_103629512 | 262 |
| 239 | 3300009551 | Ga0105238_10099645 | Ga0105238_100996452 | 262 |
| 240 | 3300013105 | Ga0157369_10403840 | Ga0157369_104038402 | 262 |
| 241 | 3300025898 | Ga0207692_10010041 | Ga0207692_100100413 | 262 |
| 242 | 3300025916 | Ga0207663_10067221 | Ga0207663_100672212 | 262 |
| 243 | 3300025928 | Ga0207700_10110200 | Ga0207700_101102003 | 262 |
| 244 | 3300025939 | Ga0207665_10135276 | Ga0207665_101352763 | 262 |
| 245 | 3300036401 | Ga0373937_0276386 | Ga0373937_0276386_380_1183 | 262 |
| 246 | 3300037068 | Ga0373925_0119039 | Ga0373925_0119039_170_958 | 262 |
| 247 | 3300046663 | Ga0495635_0205242 | Ga0495635_0205242_513_1316 | 262 |
| 248 | 3300006852 | Ga0075433_10022979 | Ga0075433_100229795 | 263 |
| 249 | 3300006871 | Ga0075434_100026835 | Ga0075434_1000268355 | 263 |
| 250 | 3300050512 | nmdc:mga0n895_1237_c1 | nmdc:mga0n895_1237_c1_3476_4267 | 263 |
| 251 | 3300005334 | Ga0068869_100010850 | Ga0068869_1000108503 | 264 |
| 252 | 3300005345 | Ga0070692_10156071 | Ga0070692_101560711 | 264 |
| 253 | 3300005366 | Ga0070659_100078281 | Ga0070659_1000782812 | 264 |
| 254 | 3300005366 | Ga0070659_100702412 | Ga0070659_1007024121 | 264 |
| 255 | 3300005436 | Ga0070713_100000508 | Ga0070713_10000050815 | 264 |
| 256 | 3300005436 | Ga0070713_100681739 | Ga0070713_1006817392 | 264 |
| 257 | 3300005437 | Ga0070710_10003026 | Ga0070710_100030266 | 264 |
| 258 | 3300005458 | Ga0070681_10094704 | Ga0070681_100947043 | 264 |
| 259 | 3300005466 | Ga0070685_10015632 | Ga0070685_100156324 | 264 |
| 260 | 3300005536 | Ga0070697_100014294 | Ga0070697_1000142942 | 264 |
| 261 | 3300005539 | Ga0068853_100122997 | Ga0068853_1001229972 | 264 |
| 262 | 3300005546 | Ga0070696_100266678 | Ga0070696_1002666781 | 264 |
| 263 | 3300005549 | Ga0070704_100084782 | Ga0070704_1000847822 | 264 |
| 264 | 3300005563 | Ga0068855_100324647 | Ga0068855_1003246472 | 264 |
| 265 | 3300005577 | Ga0068857_100036989 | Ga0068857_1000369893 | 264 |
| 266 | 3300005578 | Ga0068854_100034115 | Ga0068854_1000341153 | 264 |
| 267 | 3300005614 | Ga0068856_100268940 | Ga0068856_1002689401 | 264 |
| 268 | 3300005616 | Ga0068852_100225831 | Ga0068852_1002258312 | 264 |
| 269 | 3300005617 | Ga0068859_100223089 | Ga0068859_1002230892 | 264 |
| 270 | 3300006163 | Ga0070715_10012378 | Ga0070715_100123783 | 264 |
| 271 | 3300006173 | Ga0070716_100012159 | Ga0070716_1000121593 | 264 |
| 272 | 3300006175 | Ga0070712_100009706 | Ga0070712_1000097064 | 264 |
| 273 | 3300006852 | Ga0075433_10392725 | Ga0075433_103927252 | 264 |
| 274 | 3300006931 | Ga0097620_100223080 | Ga0097620_1002230802 | 264 |
| 275 | 3300009093 | Ga0105240_10203089 | Ga0105240_102030893 | 264 |
| 276 | 3300009093 | Ga0105240_10463436 | Ga0105240_104634362 | 264 |
| 277 | 3300009147 | Ga0114129_10103958 | Ga0114129_101039584 | 264 |
| 278 | 3300009177 | Ga0105248_10604079 | Ga0105248_106040792 | 264 |
| 279 | 3300009545 | Ga0105237_10039028 | Ga0105237_100390283 | 264 |
| 280 | 3300010375 | Ga0105239_10025096 | Ga0105239_100250964 | 264 |
| 281 | 3300010375 | Ga0105239_10131125 | Ga0105239_101311252 | 264 |
| 282 | 3300013105 | Ga0157369_10058587 | Ga0157369_100585873 | 264 |
| 283 | 3300013306 | Ga0163162_10006935 | Ga0163162_100069357 | 264 |
| 284 | 3300013307 | Ga0157372_10015753 | Ga0157372_100157534 | 264 |
| 285 | 3300013307 | Ga0157372_10075481 | Ga0157372_100754814 | 264 |
| 286 | 3300014497 | Ga0182008_10007422 | Ga0182008_100074225 | 264 |
| 287 | 3300015262 | Ga0182007_10006898 | Ga0182007_100068983 | 264 |
| 288 | 3300025898 | Ga0207692_10003431 | Ga0207692_100034314 | 264 |
| 289 | 3300025905 | Ga0207685_10109462 | Ga0207685_101094621 | 264 |
| 290 | 3300025911 | Ga0207654_10426069 | Ga0207654_104260691 | 264 |
| 291 | 3300025913 | Ga0207695_10151557 | Ga0207695_101515573 | 264 |
| 292 | 3300025914 | Ga0207671_10133087 | Ga0207671_101330872 | 264 |
| 293 | 3300025915 | Ga0207693_10000658 | Ga0207693_1000065819 | 264 |
| 294 | 3300025916 | Ga0207663_10092813 | Ga0207663_100928132 | 264 |
| 295 | 3300025919 | Ga0207657_10003001 | Ga0207657_1000300110 | 264 |
| 296 | 3300025920 | Ga0207649_10073528 | Ga0207649_100735281 | 264 |
| 297 | 3300025921 | Ga0207652_10287162 | Ga0207652_102871622 | 264 |
| 298 | 3300025924 | Ga0207694_10441000 | Ga0207694_104410002 | 264 |
| 299 | 3300025928 | Ga0207700_10002892 | Ga0207700_100028926 | 264 |
| 300 | 3300025928 | Ga0207700_10080398 | Ga0207700_100803982 | 264 |
| 301 | 3300025929 | Ga0207664_10043803 | Ga0207664_100438033 | 264 |
| 302 | 3300025931 | Ga0207644_10040200 | Ga0207644_100402003 | 264 |
| 303 | 3300025933 | Ga0207706_10230224 | Ga0207706_102302242 | 264 |
| 304 | 3300025939 | Ga0207665_10067906 | Ga0207665_100679063 | 264 |
| 305 | 3300025949 | Ga0207667_10544157 | Ga0207667_105441572 | 264 |
| 306 | 3300025981 | Ga0207640_10340405 | Ga0207640_103404052 | 264 |
| 307 | 3300026041 | Ga0207639_10150597 | Ga0207639_101505973 | 264 |
| 308 | 3300026088 | Ga0207641_10264138 | Ga0207641_102641382 | 264 |
| 309 | 3300026116 | Ga0207674_10056443 | Ga0207674_100564433 | 264 |
| 310 | 3300026142 | Ga0207698_10169027 | Ga0207698_101690272 | 264 |
| 311 | 3300028379 | Ga0268266_10339196 | Ga0268266_103391962 | 264 |
| 312 | 3300028800 | Ga0265338_10039015 | Ga0265338_100390154 | 264 |
| 313 | 3300039438 | Ga0436360_1170157 | Ga0436360_1170157_636_1430 | 264 |
| 314 | 3300046472 | Ga0495580_0014337 | Ga0495580_0014337_3955_4749 | 264 |
| 315 | 3300048903 | Ga0496100_0018545 | Ga0496100_0018545_1063_1857 | 264 |
| 316 | 3300048906 | Ga0496103_0082127 | Ga0496103_0082127_1171_1965 | 264 |
| 317 | 3300048911 | Ga0496108_0045441 | Ga0496108_0045441_1543_2337 | 264 |
| 318 | 3300048913 | Ga0496110_0074527 | Ga0496110_0074527_1906_2700 | 264 |
| 319 | 3300048915 | Ga0496112_0268762 | Ga0496112_0268762_689_1483 | 264 |
| 320 | 3300048916 | Ga0496113_0059240 | Ga0496113_0059240_866_1660 | 264 |
| 321 | 3300005467 | Ga0070706_100043044 | Ga0070706_1000430442 | 265 |
| 322 | 3300006175 | Ga0070712_100008905 | Ga0070712_1000089052 | 265 |
| 323 | 3300014969 | Ga0157376_10161551 | Ga0157376_101615512 | 265 |
| 324 | 3300025910 | Ga0207684_10107856 | Ga0207684_101078563 | 265 |
| 325 | 3300025939 | Ga0207665_10059122 | Ga0207665_100591223 | 265 |
| 326 | 3300028800 | Ga0265338_10047135 | Ga0265338_100471352 | 265 |
| 327 | 3300046457 | Ga0495590_0027536 | Ga0495590_0027536_1030_1827 | 265 |
| 328 | 3300005435 | Ga0070714_100175508 | Ga0070714_1001755082 | 266 |
| 329 | 3300005436 | Ga0070713_100028013 | Ga0070713_1000280132 | 266 |
| 330 | 3300006028 | Ga0070717_10060316 | Ga0070717_100603163 | 266 |
| 331 | 3300009093 | Ga0105240_10353006 | Ga0105240_103530062 | 266 |
| 332 | 3300013105 | Ga0157369_10015527 | Ga0157369_100155272 | 266 |
| 333 | 3300013105 | Ga0157369_10172821 | Ga0157369_101728212 | 266 |
| 334 | 3300013307 | Ga0157372_10000969 | Ga0157372_1000096911 | 266 |
| 335 | 3300013307 | Ga0157372_10019817 | Ga0157372_100198172 | 266 |
| 336 | 3300013307 | Ga0157372_10270507 | Ga0157372_102705073 | 266 |
| 337 | 3300025913 | Ga0207695_10226772 | Ga0207695_102267722 | 266 |
| 338 | 3300025928 | Ga0207700_10033624 | Ga0207700_100336243 | 266 |
| 339 | 3300025928 | Ga0207700_10064504 | Ga0207700_100645042 | 266 |
| 340 | 3300025929 | Ga0207664_10115212 | Ga0207664_101152122 | 266 |
| 341 | 3300037068 | Ga0373925_0319501 | Ga0373925_0319501_405_1211 | 266 |
| 342 | 3300048088 | Ga0495602_0138230 | Ga0495602_0138230_769_1575 | 266 |
| 343 | 3300048088 | Ga0495602_0318869 | Ga0495602_0318869_268_1074 | 266 |
| 344 | 3300001991 | JGI24743J22301_10016281 | JGI24743J22301_100162812 | 267 |
| 345 | 3300002074 | JGI24748J21848_1009392 | JGI24748J21848_10093921 | 267 |
| 346 | 3300002239 | JGI24034J26672_10004198 | JGI24034J26672_100041981 | 267 |
| 347 | 3300005290 | Ga0065712_10159410 | Ga0065712_101594101 | 267 |
| 348 | 3300005329 | Ga0070683_100009652 | Ga0070683_1000096529 | 267 |
| 349 | 3300005330 | Ga0070690_100192881 | Ga0070690_1001928811 | 267 |
| 350 | 3300005331 | Ga0070670_100042120 | Ga0070670_1000421204 | 267 |
| 351 | 3300005334 | Ga0068869_100268765 | Ga0068869_1002687652 | 267 |
| 352 | 3300005337 | Ga0070682_100015853 | Ga0070682_1000158533 | 267 |
| 353 | 3300005338 | Ga0068868_100067431 | Ga0068868_1000674313 | 267 |
| 354 | 3300005339 | Ga0070660_100010642 | Ga0070660_1000106423 | 267 |
| 355 | 3300005343 | Ga0070687_100003095 | Ga0070687_1000030953 | 267 |
| 356 | 3300005347 | Ga0070668_100263676 | Ga0070668_1002636762 | 267 |
| 357 | 3300005353 | Ga0070669_100340378 | Ga0070669_1003403781 | 267 |
| 358 | 3300005355 | Ga0070671_100366436 | Ga0070671_1003664361 | 267 |
| 359 | 3300005356 | Ga0070674_100008909 | Ga0070674_1000089093 | 267 |
| 360 | 3300005364 | Ga0070673_100311614 | Ga0070673_1003116141 | 267 |
| 361 | 3300005365 | Ga0070688_100002892 | Ga0070688_1000028924 | 267 |
| 362 | 3300005441 | Ga0070700_100105817 | Ga0070700_1001058172 | 267 |
| 363 | 3300005455 | Ga0070663_100044253 | Ga0070663_1000442532 | 267 |
| 364 | 3300005457 | Ga0070662_100008358 | Ga0070662_1000083584 | 267 |
| 365 | 3300005459 | Ga0068867_100002611 | Ga0068867_1000026119 | 267 |
| 366 | 3300005466 | Ga0070685_10002276 | Ga0070685_100022766 | 267 |
| 367 | 3300005535 | Ga0070684_100078256 | Ga0070684_1000782563 | 267 |
| 368 | 3300005539 | Ga0068853_100107321 | Ga0068853_1001073213 | 267 |
| 369 | 3300005543 | Ga0070672_100015040 | Ga0070672_1000150403 | 267 |
| 370 | 3300005547 | Ga0070693_100213449 | Ga0070693_1002134492 | 267 |
| 371 | 3300005563 | Ga0068855_100014817 | Ga0068855_1000148178 | 267 |
| 372 | 3300005564 | Ga0070664_100052227 | Ga0070664_1000522271 | 267 |
| 373 | 3300005614 | Ga0068856_100469196 | Ga0068856_1004691962 | 267 |
| 374 | 3300005615 | Ga0070702_100027294 | Ga0070702_1000272942 | 267 |
| 375 | 3300005616 | Ga0068852_100154823 | Ga0068852_1001548232 | 267 |
| 376 | 3300005718 | Ga0068866_10001073 | Ga0068866_100010739 | 267 |
| 377 | 3300005834 | Ga0068851_10005150 | Ga0068851_100051503 | 267 |
| 378 | 3300005840 | Ga0068870_10002197 | Ga0068870_100021972 | 267 |
| 379 | 3300005844 | Ga0068862_100019015 | Ga0068862_1000190155 | 267 |
| 380 | 3300006881 | Ga0068865_100005233 | Ga0068865_1000052337 | 267 |
| 381 | 3300009092 | Ga0105250_10017617 | Ga0105250_100176173 | 267 |
| 382 | 3300009098 | Ga0105245_10092720 | Ga0105245_100927202 | 267 |
| 383 | 3300009174 | Ga0105241_10010562 | Ga0105241_100105626 | 267 |
| 384 | 3300009176 | Ga0105242_10047736 | Ga0105242_100477363 | 267 |
| 385 | 3300009177 | Ga0105248_10313242 | Ga0105248_103132422 | 267 |
| 386 | 3300009545 | Ga0105237_10049032 | Ga0105237_100490324 | 267 |
| 387 | 3300009553 | Ga0105249_10033064 | Ga0105249_100330643 | 267 |
| 388 | 3300010375 | Ga0105239_10004620 | Ga0105239_100046205 | 267 |
| 389 | 3300011119 | Ga0105246_10008854 | Ga0105246_100088542 | 267 |
| 390 | 3300013100 | Ga0157373_10003844 | Ga0157373_100038448 | 267 |
| 391 | 3300013102 | Ga0157371_10015021 | Ga0157371_100150214 | 267 |
| 392 | 3300013297 | Ga0157378_10130010 | Ga0157378_101300103 | 267 |
| 393 | 3300013307 | Ga0157372_10003879 | Ga0157372_1000387912 | 267 |
| 394 | 3300013308 | Ga0157375_10034157 | Ga0157375_100341574 | 267 |
| 395 | 3300014325 | Ga0163163_10003076 | Ga0163163_100030764 | 267 |
| 396 | 3300014326 | Ga0157380_10120581 | Ga0157380_101205811 | 267 |
| 397 | 3300014745 | Ga0157377_10000340 | Ga0157377_1000034015 | 267 |
| 398 | 3300014968 | Ga0157379_10029279 | Ga0157379_100292795 | 267 |
| 399 | 3300014969 | Ga0157376_10040357 | Ga0157376_100403573 | 267 |
| 400 | 3300017792 | Ga0163161_10003073 | Ga0163161_100030732 | 267 |
| 401 | 3300025899 | Ga0207642_10017021 | Ga0207642_100170212 | 267 |
| 402 | 3300025901 | Ga0207688_10013434 | Ga0207688_100134343 | 267 |
| 403 | 3300025904 | Ga0207647_10000966 | Ga0207647_100009662 | 267 |
| 404 | 3300025907 | Ga0207645_10000073 | Ga0207645_1000007310 | 267 |
| 405 | 3300025908 | Ga0207643_10001180 | Ga0207643_100011809 | 267 |
| 406 | 3300025914 | Ga0207671_10138805 | Ga0207671_101388052 | 267 |
| 407 | 3300025918 | Ga0207662_10001315 | Ga0207662_100013153 | 267 |
| 408 | 3300025919 | Ga0207657_10012792 | Ga0207657_100127925 | 267 |
| 409 | 3300025920 | Ga0207649_10006519 | Ga0207649_100065194 | 267 |
| 410 | 3300025924 | Ga0207694_10442416 | Ga0207694_104424162 | 267 |
| 411 | 3300025925 | Ga0207650_10000045 | Ga0207650_1000004543 | 267 |
| 412 | 3300025926 | Ga0207659_10017249 | Ga0207659_100172495 | 267 |
| 413 | 3300025927 | Ga0207687_10032051 | Ga0207687_100320513 | 267 |
| 414 | 3300025931 | Ga0207644_10052981 | Ga0207644_100529813 | 267 |
| 415 | 3300025933 | Ga0207706_10000213 | Ga0207706_1000021357 | 267 |
| 416 | 3300025936 | Ga0207670_10003534 | Ga0207670_100035347 | 267 |
| 417 | 3300025937 | Ga0207669_10003050 | Ga0207669_100030504 | 267 |
| 418 | 3300025940 | Ga0207691_10000556 | Ga0207691_1000055628 | 267 |
| 419 | 3300025941 | Ga0207711_10017493 | Ga0207711_100174932 | 267 |
| 420 | 3300025942 | Ga0207689_10000780 | Ga0207689_1000078026 | 267 |
| 421 | 3300025944 | Ga0207661_10000992 | Ga0207661_1000099210 | 267 |
| 422 | 3300025945 | Ga0207679_10000525 | Ga0207679_100005258 | 267 |
| 423 | 3300025949 | Ga0207667_10111188 | Ga0207667_101111882 | 267 |
| 424 | 3300025961 | Ga0207712_10124817 | Ga0207712_101248173 | 267 |
| 425 | 3300025972 | Ga0207668_10271073 | Ga0207668_102710732 | 267 |
| 426 | 3300025986 | Ga0207658_10021007 | Ga0207658_100210072 | 267 |
| 427 | 3300026035 | Ga0207703_10047343 | Ga0207703_100473433 | 267 |
| 428 | 3300026067 | Ga0207678_10000026 | Ga0207678_10000026105 | 267 |
| 429 | 3300026075 | Ga0207708_10187927 | Ga0207708_101879272 | 267 |
| 430 | 3300026088 | Ga0207641_10000075 | Ga0207641_1000007543 | 267 |
| 431 | 3300026089 | Ga0207648_10000679 | Ga0207648_1000067926 | 267 |
| 432 | 3300026095 | Ga0207676_10000669 | Ga0207676_1000066921 | 267 |
| 433 | 3300026116 | Ga0207674_10000559 | Ga0207674_1000055919 | 267 |
| 434 | 3300026118 | Ga0207675_100015010 | Ga0207675_1000150106 | 267 |
| 435 | 3300026121 | Ga0207683_10000438 | Ga0207683_1000043826 | 267 |
| 436 | 3300026142 | Ga0207698_10011814 | Ga0207698_100118142 | 267 |
| 437 | 3300028379 | Ga0268266_10001444 | Ga0268266_1000144423 | 267 |
| 438 | 3300028380 | Ga0268265_10017979 | Ga0268265_100179793 | 267 |
| 439 | 3300028381 | Ga0268264_10005658 | Ga0268264_100056583 | 267 |
| 440 | 3300048904 | Ga0496101_0045797 | Ga0496101_0045797_1862_2665 | 267 |
| 441 | 3300048905 | Ga0496102_0234953 | Ga0496102_0234953_580_1383 | 267 |
| 442 | 3300048911 | Ga0496108_0000957 | Ga0496108_0000957_2421_3224 | 267 |
| 443 | 3300048912 | Ga0496109_0000164 | Ga0496109_0000164_32417_33220 | 267 |
| 444 | 3300048913 | Ga0496110_0017520 | Ga0496110_0017520_2187_2990 | 267 |
| 445 | 3300048914 | Ga0496111_0186235 | Ga0496111_0186235_219_1022 | 267 |
| 446 | 3300048915 | Ga0496112_0000078 | Ga0496112_0000078_48628_49431 | 267 |
| 447 | 3300048916 | Ga0496113_0005389 | Ga0496113_0005389_1751_2554 | 267 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2otn-assembly1.cif.gz_A | crystal structure of the catalytically active form of diaminopimelate epimerase from bacillus anthracis | 0.9157 | 8 | 264 |
| 2q9h-assembly1.cif.gz_A | crystal structure of the c73s mutant of diaminopimelate epimerase | 0.9149 | 11 | 266 |
| 2q9j-assembly1.cif.gz_A | crystal structure of the c217s mutant of diaminopimelate epimerase | 0.9091 | 11 | 266 |
| 1bwz-assembly1.cif.gz_A | diaminopimelate epimerase from hemophilus influenzae | 0.9088 | 11 | 266 |
| 1gqz-assembly1.cif.gz_A | refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a | 0.9011 | 11 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55GS8_377_492_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9666 | 144 | 252 | 3.10.310.10 |
| af_C6T990_209_343_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9259 | 135 | 247 | 3.10.310.10 |
| af_Q55GS8_59_214_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9068 | 12 | 93 | 3.10.310.10 |
| af_Q55GS8_377_492_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9017 | 144 | 252 | 3.10.310.10 |
| af_Q58519_1_127_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8887 | 12 | 116 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2RGL6-F1-model_v4 | Diaminopimelate epimerase | 0.9925 | 169 | 252 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A7Y4TKE5-F1-model_v4 | Diaminopimelate epimerase | 0.9807 | 135 | 252 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A6L5DBQ8-F1-model_v4 | deleted | 0.9744 | 136 | 252 |
|
| AF-A0A4Q3Z9W9-F1-model_v4 | Diaminopimelate epimerase | 0.9724 | 154 | 252 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A3D0V0I3-F1-model_v4 | deleted | 0.9711 | 174 | 252 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar