F445975

General Info

Members Datasets Scaffolds Average Seq Length
447 226 447 261

Family's Representative Sequence

Representative Sequence 3300031238|Ga0265332_10049037|Ga0265332_100490372
Length 290
Sequence MFYTGNDTALGIRTSAVNSSVAAPLLQSAQPMMVPFVKATACGNDFLIIDVVHAPADIHSFARRICDRHNGVGADGVEWVVPAKDADLGVRLLNADGSEAEISGNGTRCVAAWYCAEHQRDSVVIRTGAGLKTCDLTSRNGSTFEFRSSMGVPEVGDEFPVKLTCGEMCGVPVSMGNPHYVVFVSEFELGWQAVAEQISKHHDFKEGMNVEFVRMMNESEIEVRFCERGVGETMSSGTGSCAAAVASIHSGKVKSPVRVRAPGGTQTVEWSGEVFLYGPASLLCRGEFFV

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.83
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10016281 3300001991 Bacteria 1386
2 JGI24748J21848_1009392 3300002074 Unclassified 1152
3 JGI24034J26672_10004198 3300002239 Unclassified 2032
4 rootH1_10391135 3300003323 Unclassified 1211
5 Ga0058863_10581641 3300004799 Unclassified 1863
6 Ga0058862_12178919 3300004803 Unclassified 1730
7 Ga0065712_10159410 3300005290 Unclassified 1312
8 Ga0070683_100009652 3300005329 Bacteria 8260
9 Ga0070683_100056172 3300005329 Bacteria 3655
10 Ga0070683_100111052 3300005329 Unclassified 2586
11 Ga0070690_100192881 3300005330 Unclassified 1413
12 Ga0070670_100042120 3300005331 Unclassified 3924
13 Ga0068869_100010850 3300005334 Bacteria 5958
14 Ga0068869_100268765 3300005334 Unclassified 1367
15 Ga0070680_100001944 3300005336 Bacteria 15199
16 Ga0070680_100201210 3300005336 Bacteria 1680
17 Ga0070682_100015853 3300005337 Unclassified 4374
18 Ga0068868_100067431 3300005338 Unclassified 2848
19 Ga0070660_100010642 3300005339 Bacteria 6504
20 Ga0070687_100003095 3300005343 Bacteria 6397
21 Ga0070692_10156071 3300005345 Unclassified 1304
22 Ga0070668_100263676 3300005347 Unclassified 1433
23 Ga0070669_100340378 3300005353 Unclassified 1215
24 Ga0070671_100366436 3300005355 Unclassified 1230
25 Ga0070674_100008909 3300005356 Bacteria 5992
26 Ga0070673_100311614 3300005364 Unclassified 1388
27 Ga0070688_100002892 3300005365 Bacteria 8753
28 Ga0070659_100078281 3300005366 Bacteria 2637
29 Ga0070659_100680844 3300005366 Unclassified 888
30 Ga0070659_100702412 3300005366 Unclassified 874
31 Ga0070709_10019563 3300005434 Bacteria 3916
32 Ga0070709_10085458 3300005434 Bacteria 2069
33 Ga0070709_10123995 3300005434 Unclassified 1755
34 Ga0070709_10136345 3300005434 Unclassified 1681
35 Ga0070714_100001244 3300005435 Bacteria 18383
36 Ga0070714_100175508 3300005435 Bacteria 1947
37 Ga0070713_100000508 3300005436 Bacteria 24885
38 Ga0070713_100005742 3300005436 Bacteria 8523
39 Ga0070713_100018895 3300005436 Bacteria 5248
40 Ga0070713_100028013 3300005436 Bacteria 4444
41 Ga0070713_100112416 3300005436 Bacteria 2376
42 Ga0070713_100259880 3300005436 Unclassified 1586
43 Ga0070713_100363852 3300005436 Bacteria 1344
44 Ga0070713_100516981 3300005436 Unclassified 1128
45 Ga0070713_100681739 3300005436 Unclassified 980
46 Ga0070710_10003026 3300005437 Bacteria 7994
47 Ga0070710_10024303 3300005437 Bacteria 3195
48 Ga0070710_10126920 3300005437 Unclassified 1551
49 Ga0070710_10134612 3300005437 Bacteria 1510
50 Ga0070710_10214896 3300005437 Unclassified 1221
51 Ga0070711_100001945 3300005439 Bacteria 11581
52 Ga0070711_100017764 3300005439 Unclassified 4532
53 Ga0070711_100021933 3300005439 Bacteria 4133
54 Ga0070711_100025099 3300005439 Unclassified 3896
55 Ga0070711_100077887 3300005439 Unclassified 2354
56 Ga0070711_100169305 3300005439 Bacteria 1664
57 Ga0070711_100464480 3300005439 Bacteria 1038
58 Ga0070700_100105817 3300005441 Unclassified 1861
59 Ga0070708_100023099 3300005445 Bacteria 5282
60 Ga0070663_100044253 3300005455 Unclassified 3137
61 Ga0070662_100008358 3300005457 Bacteria 6746
62 Ga0070681_10009976 3300005458 Bacteria 9365
63 Ga0070681_10024936 3300005458 Bacteria 6017
64 Ga0070681_10071909 3300005458 Unclassified 3423
65 Ga0070681_10094704 3300005458 Bacteria 2934
66 Ga0068867_100002611 3300005459 Bacteria 12706
67 Ga0070685_10002276 3300005466 Bacteria 9898
68 Ga0070685_10015632 3300005466 Bacteria 4033
69 Ga0070706_100043044 3300005467 Unclassified 4172
70 Ga0070707_100159229 3300005468 Bacteria 2199
71 Ga0070679_100006533 3300005530 Bacteria 10867
72 Ga0070679_100006726 3300005530 Bacteria 10723
73 Ga0070679_100267122 3300005530 Unclassified 1666
74 Ga0070684_100039793 3300005535 Bacteria 4046
75 Ga0070684_100078256 3300005535 Unclassified 2921
76 Ga0070697_100014294 3300005536 Bacteria 6238
77 Ga0068853_100014106 3300005539 Bacteria 6542
78 Ga0068853_100107321 3300005539 Unclassified 2476
79 Ga0068853_100122997 3300005539 Bacteria 2316
80 Ga0070672_100015040 3300005543 Bacteria 5499
81 Ga0070672_100207767 3300005543 Bacteria 1639
82 Ga0070696_100266678 3300005546 Unclassified 1300
83 Ga0070693_100138514 3300005547 Bacteria 1529
84 Ga0070693_100213449 3300005547 Unclassified 1260
85 Ga0070665_100187197 3300005548 Unclassified 2071
86 Ga0070704_100084782 3300005549 Bacteria 2343
87 Ga0068855_100014817 3300005563 Bacteria 9388
88 Ga0068855_100020697 3300005563 Bacteria 7888
89 Ga0068855_100032998 3300005563 Bacteria 6180
90 Ga0068855_100045068 3300005563 Bacteria 5217
91 Ga0068855_100324647 3300005563 Bacteria 1700
92 Ga0068855_100529520 3300005563 Unclassified 1278
93 Ga0070664_100052227 3300005564 Unclassified 3461
94 Ga0068857_100036989 3300005577 Bacteria 4324
95 Ga0068854_100034115 3300005578 Bacteria 3552
96 Ga0068854_100207623 3300005578 Bacteria 1543
97 Ga0068856_100024943 3300005614 Bacteria 5827
98 Ga0068856_100032885 3300005614 Bacteria 5079
99 Ga0068856_100201069 3300005614 Bacteria 2007
100 Ga0068856_100268940 3300005614 Bacteria 1720
101 Ga0068856_100469196 3300005614 Bacteria 1279
102 Ga0070702_100027294 3300005615 Unclassified 3079
103 Ga0068852_100117355 3300005616 Unclassified 2430
104 Ga0068852_100154823 3300005616 Unclassified 2134
105 Ga0068852_100225831 3300005616 Bacteria 1783
106 Ga0068852_100244302 3300005616 Bacteria 1717
107 Ga0068852_100328932 3300005616 Unclassified 1486
108 Ga0068859_100223089 3300005617 Bacteria 1972
109 Ga0068866_10001073 3300005718 Bacteria 12054
110 Ga0068851_10005150 3300005834 Bacteria 5930
111 Ga0068870_10002197 3300005840 Bacteria 8082
112 Ga0068863_100259026 3300005841 Bacteria 1681
113 Ga0068858_100002926 3300005842 Bacteria 17180
114 Ga0068860_100241666 3300005843 Unclassified 1756
115 Ga0068862_100019015 3300005844 Bacteria 5728
116 Ga0070717_10004778 3300006028 Bacteria 9850
117 Ga0070717_10005444 3300006028 Bacteria 9292
118 Ga0070717_10012832 3300006028 Bacteria 6397
119 Ga0070717_10060316 3300006028 Bacteria 3141
120 Ga0070717_10108057 3300006028 Bacteria 2370
121 Ga0070717_10159166 3300006028 Unclassified 1958
122 Ga0070717_10244196 3300006028 Unclassified 1584
123 Ga0070715_10012378 3300006163 Bacteria 3104
124 Ga0070715_10079798 3300006163 Unclassified 1483
125 Ga0070716_100001082 3300006173 Bacteria 11947
126 Ga0070716_100012159 3300006173 Bacteria 4356
127 Ga0070716_100147599 3300006173 Bacteria 1508
128 Ga0070712_100001573 3300006175 Bacteria 13964
129 Ga0070712_100007712 3300006175 Bacteria 6733
130 Ga0070712_100008905 3300006175 Bacteria 6323
131 Ga0070712_100009706 3300006175 Bacteria 6066
132 Ga0070712_100010482 3300006175 Bacteria 5850
133 Ga0075433_10022979 3300006852 Bacteria 5243
134 Ga0075433_10392725 3300006852 Bacteria 1224
135 Ga0075434_100026835 3300006871 Bacteria 5649
136 Ga0075434_100166153 3300006871 Bacteria 2227
137 Ga0068865_100005233 3300006881 Bacteria 7843
138 Ga0075436_100048770 3300006914 Bacteria 2922
139 Ga0097620_100223080 3300006931 Bacteria 1972
140 Ga0099795_10032332 3300007788 Bacteria 1809
141 Ga0099795_10052115 3300007788 Bacteria 1494
142 Ga0105250_10017617 3300009092 Unclassified 2902
143 Ga0105240_10055234 3300009093 Bacteria 4973
144 Ga0105240_10203089 3300009093 Bacteria 2321
145 Ga0105240_10331966 3300009093 Unclassified 1730
146 Ga0105240_10353006 3300009093 Bacteria 1668
147 Ga0105240_10463436 3300009093 Unclassified 1415
148 Ga0105240_10801969 3300009093 Bacteria 1020
149 Ga0105245_10025889 3300009098 Bacteria 5160
150 Ga0105245_10092720 3300009098 Unclassified 2782
151 Ga0105245_10398305 3300009098 Unclassified 1375
152 Ga0114129_10103958 3300009147 Bacteria 3926
153 Ga0105241_10010562 3300009174 Bacteria 6775
154 Ga0105241_10186146 3300009174 Bacteria 1726
155 Ga0105241_10352474 3300009174 Bacteria 1278
156 Ga0105241_10362951 3300009174 Bacteria 1261
157 Ga0105242_10047736 3300009176 Unclassified 3477
158 Ga0105242_10422065 3300009176 Bacteria 1250
159 Ga0105248_10313242 3300009177 Unclassified 1768
160 Ga0105248_10604079 3300009177 Bacteria 1238
161 Ga0105237_10039028 3300009545 Bacteria 4794
162 Ga0105237_10049032 3300009545 Unclassified 4246
163 Ga0105237_10103263 3300009545 Bacteria 2842
164 Ga0105238_10038663 3300009551 Bacteria 4845
165 Ga0105238_10099645 3300009551 Unclassified 2888
166 Ga0105249_10033064 3300009553 Unclassified 4682
167 Ga0105239_10004620 3300010375 Bacteria 16372
168 Ga0105239_10025096 3300010375 Bacteria 6566
169 Ga0105239_10131125 3300010375 Bacteria 2788
170 Ga0105239_10973112 3300010375 Unclassified 975
171 Ga0105246_10008854 3300011119 Bacteria 6194
172 Ga0157373_10003844 3300013100 Bacteria 11352
173 Ga0157371_10015021 3300013102 Bacteria 5821
174 Ga0157370_10036441 3300013104 Bacteria 4772
175 Ga0157369_10000442 3300013105 Bacteria 55048
176 Ga0157369_10015527 3300013105 Bacteria 8582
177 Ga0157369_10023020 3300013105 Bacteria 6944
178 Ga0157369_10058587 3300013105 Bacteria 4155
179 Ga0157369_10172821 3300013105 Bacteria 2276
180 Ga0157369_10403840 3300013105 Unclassified 1417
181 Ga0157374_10236520 3300013296 Unclassified 1795
182 Ga0157378_10130010 3300013297 Unclassified 2330
183 Ga0163162_10006935 3300013306 Bacteria 10983
184 Ga0157372_10000969 3300013307 Bacteria 31293
185 Ga0157372_10003879 3300013307 Bacteria 16063
186 Ga0157372_10015753 3300013307 Bacteria 8109
187 Ga0157372_10019817 3300013307 Bacteria 7248
188 Ga0157372_10075481 3300013307 Bacteria 3804
189 Ga0157372_10206008 3300013307 Bacteria 2279
190 Ga0157372_10270507 3300013307 Bacteria 1974
191 Ga0157375_10034157 3300013308 Unclassified 4842
192 Ga0163163_10003076 3300014325 Bacteria 14126
193 Ga0163163_10021773 3300014325 Bacteria 6056
194 Ga0163163_10315754 3300014325 Bacteria 1616
195 Ga0157380_10120581 3300014326 Unclassified 2221
196 Ga0182008_10007422 3300014497 Bacteria 6054
197 Ga0157377_10000340 3300014745 Bacteria 20866
198 Ga0157379_10029279 3300014968 Unclassified 4897
199 Ga0157376_10003116 3300014969 Bacteria 11394
200 Ga0157376_10040357 3300014969 Unclassified 3815
201 Ga0157376_10161551 3300014969 Bacteria 2031
202 Ga0182007_10006898 3300015262 Bacteria 4828
203 Ga0163161_10003073 3300017792 Bacteria 11772
204 Ga0207692_10003431 3300025898 Bacteria 6191
205 Ga0207692_10006399 3300025898 Bacteria 4774
206 Ga0207692_10010041 3300025898 Bacteria 3974
207 Ga0207642_10017021 3300025899 Unclassified 2754
208 Ga0207642_10108616 3300025899 Bacteria 1408
209 Ga0207688_10013434 3300025901 Unclassified 4450
210 Ga0207647_10000966 3300025904 Bacteria 22301
211 Ga0207647_10007156 3300025904 Bacteria 8092
212 Ga0207685_10109462 3300025905 Unclassified 1195
213 Ga0207699_10020787 3300025906 Bacteria 3525
214 Ga0207699_10040352 3300025906 Bacteria 2689
215 Ga0207699_10114403 3300025906 Unclassified 1735
216 Ga0207699_10291578 3300025906 Bacteria 1137
217 Ga0207645_10000073 3300025907 Bacteria 71786
218 Ga0207643_10001180 3300025908 Bacteria 15512
219 Ga0207684_10107856 3300025910 Bacteria 2383
220 Ga0207654_10426069 3300025911 Unclassified 927
221 Ga0207707_10013122 3300025912 Bacteria 7219
222 Ga0207695_10082799 3300025913 Unclassified 3242
223 Ga0207695_10134031 3300025913 Bacteria 2432
224 Ga0207695_10151557 3300025913 Bacteria 2257
225 Ga0207695_10226772 3300025913 Bacteria 1774
226 Ga0207695_10451223 3300025913 Bacteria 1169
227 Ga0207671_10067771 3300025914 Bacteria 2658
228 Ga0207671_10123793 3300025914 Bacteria 1978
229 Ga0207671_10133087 3300025914 Bacteria 1910
230 Ga0207671_10138805 3300025914 Unclassified 1871
231 Ga0207671_10204977 3300025914 Bacteria 1541
232 Ga0207693_10000658 3300025915 Bacteria 30974
233 Ga0207693_10001326 3300025915 Bacteria 21912
234 Ga0207693_10007435 3300025915 Bacteria 9009
235 Ga0207693_10054544 3300025915 Unclassified 3135
236 Ga0207663_10001294 3300025916 Bacteria 11603
237 Ga0207663_10035124 3300025916 Bacteria 3004
238 Ga0207663_10067221 3300025916 Bacteria 2298
239 Ga0207663_10092813 3300025916 Unclassified 2008
240 Ga0207663_10113446 3300025916 Unclassified 1843
241 Ga0207660_10007333 3300025917 Bacteria 7136
242 Ga0207660_10304901 3300025917 Bacteria 1269
243 Ga0207662_10001315 3300025918 Bacteria 11968
244 Ga0207657_10003001 3300025919 Bacteria 18081
245 Ga0207657_10012792 3300025919 Bacteria 8259
246 Ga0207649_10006519 3300025920 Bacteria 6341
247 Ga0207649_10073528 3300025920 Bacteria 2190
248 Ga0207652_10000659 3300025921 Bacteria 33877
249 Ga0207652_10081322 3300025921 Unclassified 2834
250 Ga0207652_10287162 3300025921 Bacteria 1484
251 Ga0207694_10441000 3300025924 Unclassified 1086
252 Ga0207694_10442416 3300025924 Unclassified 1084
253 Ga0207650_10000045 3300025925 Bacteria 181507
254 Ga0207659_10017249 3300025926 Unclassified 4713
255 Ga0207687_10011481 3300025927 Bacteria 5788
256 Ga0207687_10032051 3300025927 Unclassified 3557
257 Ga0207700_10002892 3300025928 Bacteria 9900
258 Ga0207700_10033624 3300025928 Bacteria 3671
259 Ga0207700_10051950 3300025928 Bacteria 3062
260 Ga0207700_10064504 3300025928 Bacteria 2790
261 Ga0207700_10080398 3300025928 Bacteria 2541
262 Ga0207700_10086527 3300025928 Unclassified 2463
263 Ga0207700_10110200 3300025928 Bacteria 2213
264 Ga0207700_10179131 3300025928 Bacteria 1773
265 Ga0207700_10520104 3300025928 Bacteria 1054
266 Ga0207664_10004723 3300025929 Bacteria 9247
267 Ga0207664_10043803 3300025929 Bacteria 3503
268 Ga0207664_10115212 3300025929 Bacteria 2241
269 Ga0207664_10165053 3300025929 Bacteria 1891
270 Ga0207664_10166771 3300025929 Unclassified 1882
271 Ga0207644_10040200 3300025931 Unclassified 3305
272 Ga0207644_10052981 3300025931 Unclassified 2918
273 Ga0207706_10000213 3300025933 Bacteria 63821
274 Ga0207706_10230224 3300025933 Bacteria 1622
275 Ga0207670_10003534 3300025936 Bacteria 8292
276 Ga0207669_10003050 3300025937 Bacteria 7215
277 Ga0207665_10000054 3300025939 Bacteria 73528
278 Ga0207665_10029592 3300025939 Bacteria 3620
279 Ga0207665_10059122 3300025939 Bacteria 2593
280 Ga0207665_10067906 3300025939 Bacteria 2428
281 Ga0207665_10135276 3300025939 Bacteria 1753
282 Ga0207691_10000556 3300025940 Bacteria 37289
283 Ga0207711_10017493 3300025941 Bacteria 5954
284 Ga0207689_10000185 3300025942 Bacteria 54094
285 Ga0207689_10000780 3300025942 Bacteria 30597
286 Ga0207661_10000992 3300025944 Bacteria 18770
287 Ga0207661_10033508 3300025944 Unclassified 3987
288 Ga0207679_10000525 3300025945 Bacteria 25943
289 Ga0207667_10034427 3300025949 Bacteria 5438
290 Ga0207667_10041150 3300025949 Bacteria 4916
291 Ga0207667_10111188 3300025949 Unclassified 2826
292 Ga0207667_10205653 3300025949 Bacteria 2019
293 Ga0207667_10544157 3300025949 Bacteria 1175
294 Ga0207712_10124817 3300025961 Unclassified 1953
295 Ga0207668_10271073 3300025972 Unclassified 1387
296 Ga0207640_10340405 3300025981 Bacteria 1201
297 Ga0207658_10021007 3300025986 Unclassified 4526
298 Ga0207703_10018946 3300026035 Bacteria 5376
299 Ga0207703_10047343 3300026035 Unclassified 3466
300 Ga0207639_10150597 3300026041 Bacteria 1948
301 Ga0207639_10176228 3300026041 Unclassified 1815
302 Ga0207639_10228334 3300026041 Bacteria 1612
303 Ga0207678_10000026 3300026067 Bacteria 116850
304 Ga0207708_10187927 3300026075 Unclassified 1643
305 Ga0207702_10013286 3300026078 Bacteria 6848
306 Ga0207702_10744572 3300026078 Bacteria 967
307 Ga0207641_10000075 3300026088 Bacteria 145149
308 Ga0207641_10264138 3300026088 Bacteria 1613
309 Ga0207648_10000679 3300026089 Bacteria 38160
310 Ga0207648_10016025 3300026089 Archaea 6867
311 Ga0207676_10000669 3300026095 Bacteria 27440
312 Ga0207674_10000559 3300026116 Bacteria 48687
313 Ga0207674_10056443 3300026116 Bacteria 3988
314 Ga0207675_100015010 3300026118 Bacteria 7228
315 Ga0207675_100163906 3300026118 Bacteria 2122
316 Ga0207683_10000438 3300026121 Bacteria 38515
317 Ga0207698_10011814 3300026142 Bacteria 5682
318 Ga0207698_10169027 3300026142 Bacteria 1923
319 Ga0265356_1001512 3300028017 Bacteria 3400
320 Ga0268266_10001444 3300028379 Bacteria 28286
321 Ga0268266_10339196 3300028379 Bacteria 1410
322 Ga0268265_10017979 3300028380 Unclassified 4891
323 Ga0268264_10005658 3300028381 Bacteria 10591
324 Ga0268264_10155665 3300028381 Bacteria 2053
325 Ga0265338_10028135 3300028800 Bacteria 5616
326 Ga0265338_10039015 3300028800 Unclassified 4489
327 Ga0265338_10047135 3300028800 Bacteria 3940
328 Ga0265332_10049037 3300031238 Unclassified 1816
329 Ga0265328_10013670 3300031239 Unclassified 3208
330 Ga0265325_10001599 3300031241 Bacteria 15804
331 Ga0265325_10012794 3300031241 Bacteria 4788
332 Ga0265340_10000590 3300031247 Bacteria 20174
333 Ga0265339_10106341 3300031249 Bacteria 1456
334 Ga0265327_10030880 3300031251 Unclassified 3020
335 Ga0265313_10009611 3300031595 Bacteria 6256
336 Ga0373926_0002213 3300035083 Bacteria 6138
337 Ga0373926_0005482 3300035083 Bacteria 4187
338 Ga0373956_0009028 3300035119 Unclassified 4042
339 Ga0373957_0055449 3300035120 Unclassified 1524
340 Ga0373943_0014123 3300035170 Bacteria 3611
341 Ga0373946_0004111 3300035171 Bacteria 5185
342 Ga0373946_0011099 3300035171 Bacteria 3351
343 Ga0373924_0000059 3300035410 Bacteria 28501
344 Ga0373935_0003805 3300035692 Bacteria 8813
345 Ga0373935_0007693 3300035692 Bacteria 6458
346 Ga0373935_0489133 3300035692 Bacteria 892
347 Ga0373927_0006966 3300035695 Bacteria 7673
348 Ga0373927_0018811 3300035695 Bacteria 4533
349 Ga0373933_0328427 3300035724 Unclassified 992
350 Ga0373947_0027507 3300035725 Bacteria 3328
351 Ga0373937_0000408 3300036401 Bacteria 40094
352 Ga0373937_0116844 3300036401 Bacteria 2484
353 Ga0373937_0276386 3300036401 Bacteria 1586
354 Ga0373925_0036616 3300037068 Bacteria 3622
355 Ga0373925_0088378 3300037068 Bacteria 2366
356 Ga0373925_0117326 3300037068 Bacteria 2062
357 Ga0373925_0119039 3300037068 Bacteria 2048
358 Ga0373925_0319501 3300037068 Bacteria 1256
359 Ga0373925_0731438 3300037068 Unclassified 816
360 Ga0395905_0014399 3300037471 Bacteria 7554
361 Ga0395905_0085048 3300037471 Unclassified 2964
362 Ga0395905_0100625 3300037471 Bacteria 2714
363 Ga0436360_1170157 3300039438 Unclassified 1484
364 Ga0436363_0647176 3300039450 Bacteria 1320
365 Ga0436363_0711235 3300039450 Unclassified 2193
366 Ga0466961_0192197 3300044693 Bacteria 1265
367 Ga0466963_0001969 3300044694 Bacteria 11279
368 Ga0466963_0017273 3300044694 Bacteria 4496
369 Ga0466963_0045176 3300044694 Bacteria 2901
370 Ga0466957_0000625 3300044842 Bacteria 17898
371 Ga0466957_0295137 3300044842 Bacteria 1088
372 Ga0466959_0014979 3300045049 Bacteria 5651
373 Ga0451576_0300520 3300045051 Bacteria 1679
374 Ga0466958_0237979 3300045836 Bacteria 1163
375 Ga0466967_0001038 3300045976 Bacteria 15242
376 Ga0466967_0067684 3300045976 Unclassified 3186
377 Ga0495603_0041371 3300046455 Bacteria 2756
378 Ga0495590_0027536 3300046457 Bacteria 1994
379 Ga0495651_0013651 3300046462 Bacteria 6279
380 Ga0495580_0000068 3300046472 Bacteria 63122
381 Ga0495580_0003297 3300046472 Bacteria 13795
382 Ga0495580_0004476 3300046472 Bacteria 11738
383 Ga0495580_0014337 3300046472 Bacteria 6013
384 Ga0495580_0023514 3300046472 Unclassified 4524
385 Ga0495580_0057747 3300046472 Unclassified 2731
386 Ga0495580_0137131 3300046472 Unclassified 1696
387 Ga0495582_0068588 3300046473 Unclassified 1960
388 Ga0495582_0074808 3300046473 Bacteria 1875
389 Ga0495664_0270592 3300046477 Bacteria 1027
390 Ga0495594_0040150 3300046499 Bacteria 2560
391 Ga0495608_0235949 3300046511 Bacteria 1144
392 Ga0495630_0454526 3300046517 Unclassified 982
393 Ga0495665_0057207 3300046531 Bacteria 2058
394 Ga0495665_0189698 3300046531 Bacteria 1066
395 Ga0495635_0205242 3300046663 Bacteria 1336
396 Ga0495659_0027422 3300046664 Unclassified 1965
397 Ga0495623_0014046 3300046679 Bacteria 5188
398 Ga0495647_0121513 3300046681 Unclassified 1099
399 Ga0495669_0003332 3300046684 Bacteria 6612
400 Ga0495624_0069533 3300046690 Bacteria 2193
401 Ga0495581_0376677 3300047315 Unclassified 828
402 Ga0495604_0071514 3300047317 Bacteria 2624
403 Ga0495636_0061597 3300047318 Unclassified 1587
404 Ga0495674_0254358 3300047319 Unclassified 1445
405 Ga0495677_0068280 3300047445 Unclassified 1323
406 Ga0495602_0138230 3300048088 Unclassified 1932
407 Ga0495602_0318869 3300048088 Unclassified 1131
408 Ga0496100_0018545 3300048903 Bacteria 4130
409 Ga0496101_0045797 3300048904 Unclassified 3135
410 Ga0496102_0212791 3300048905 Bacteria 1822
411 Ga0496102_0234953 3300048905 Unclassified 1728
412 Ga0496102_0414102 3300048905 Bacteria 1266
413 Ga0496102_0604830 3300048905 Unclassified 1019
414 Ga0496103_0082127 3300048906 Bacteria 2028
415 Ga0496104_0076640 3300048907 Bacteria 3185
416 Ga0496104_0101610 3300048907 Bacteria 2753
417 Ga0496104_0164409 3300048907 Bacteria 2128
418 Ga0496105_0000590 3300048908 Bacteria 24188
419 Ga0496108_0000957 3300048911 Bacteria 22443
420 Ga0496108_0045441 3300048911 Bacteria 3668
421 Ga0496109_0000164 3300048912 Bacteria 65491
422 Ga0496109_0421090 3300048912 Bacteria 1261
423 Ga0496110_0017520 3300048913 Bacteria 5992
424 Ga0496110_0065113 3300048913 Bacteria 3222
425 Ga0496110_0074527 3300048913 Bacteria 3014
426 Ga0496110_0128310 3300048913 Bacteria 2289
427 Ga0496111_0000490 3300048914 Bacteria 20373
428 Ga0496111_0186235 3300048914 Unclassified 1543
429 Ga0496111_0336137 3300048914 Bacteria 1118
430 Ga0496112_0000078 3300048915 Bacteria 64712
431 Ga0496112_0002375 3300048915 Bacteria 15130
432 Ga0496112_0024793 3300048915 Bacteria 5752
433 Ga0496112_0034942 3300048915 Bacteria 4892
434 Ga0496112_0176645 3300048915 Bacteria 2100
435 Ga0496112_0220701 3300048915 Bacteria 1852
436 Ga0496112_0268762 3300048915 Bacteria 1653
437 Ga0496112_0374991 3300048915 Unclassified 1364
438 Ga0496113_0005389 3300048916 Bacteria 7975
439 Ga0496113_0059240 3300048916 Unclassified 2884
440 Ga0496113_0185554 3300048916 Unclassified 1649
441 Ga0496113_0193963 3300048916 Bacteria 1613
442 Ga0496115_0441694 3300048918 Unclassified 1052
443 nmdc:mga05p37_1167274_c1 3300050507 Bacteria 799
444 nmdc:mga0n895_1237_c1 3300050512 Bacteria 18843
445 nmdc:mga0n895_168177_c1 3300050512 Bacteria 2224
446 nmdc:mga08x19_286069_c1 3300050514 Bacteria 1143
447 nmdc:mga08x19_66726_c1 3300050514 Bacteria 2339

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300004799 Ga0058863_10581641 Ga0058863_105816412 201
2 3300005336 Ga0070680_100001944 Ga0070680_1000019448 201
3 3300005530 Ga0070679_100006726 Ga0070679_1000067265 201
4 3300025921 Ga0207652_10000659 Ga0207652_1000065927 201
5 3300025913 Ga0207695_10451223 Ga0207695_104512232 203
6 3300048905 Ga0496102_0414102 Ga0496102_0414102_559_1245 209
7 3300047319 Ga0495674_0254358 Ga0495674_0254358_14_676 219
8 3300037471 Ga0395905_0100625 Ga0395905_0100625_1422_2219 221
9 3300037068 Ga0373925_0731438 Ga0373925_0731438_14_718 233
10 3300048905 Ga0496102_0212791 Ga0496102_0212791_1032_1733 233
11 3300048915 Ga0496112_0024793 Ga0496112_0024793_2822_3604 238
12 3300050507 nmdc:mga05p37_1167274_c1 nmdc:mga05p37_1167274_c1_12_737 239
13 3300005841 Ga0068863_100259026 Ga0068863_1002590262 241
14 3300014325 Ga0163163_10315754 Ga0163163_103157542 241
15 3300025904 Ga0207647_10007156 Ga0207647_100071567 241
16 3300005535 Ga0070684_100039793 Ga0070684_1000397935 242
17 3300014969 Ga0157376_10003116 Ga0157376_100031169 242
18 3300035692 Ga0373935_0489133 Ga0373935_0489133_124_855 242
19 3300044694 Ga0466963_0001969 Ga0466963_0001969_1590_2372 242
20 3300048907 Ga0496104_0076640 Ga0496104_0076640_372_1103 242
21 3300048907 Ga0496104_0164409 Ga0496104_0164409_774_1556 242
22 3300048914 Ga0496111_0336137 Ga0496111_0336137_29_760 242
23 3300005434 Ga0070709_10136345 Ga0070709_101363452 244
24 3300005436 Ga0070713_100516981 Ga0070713_1005169812 244
25 3300005439 Ga0070711_100017764 Ga0070711_1000177644 244
26 3300006028 Ga0070717_10159166 Ga0070717_101591662 244
27 3300007788 Ga0099795_10032332 Ga0099795_100323321 244
28 3300025906 Ga0207699_10040352 Ga0207699_100403523 244
29 3300025906 Ga0207699_10114403 Ga0207699_101144032 244
30 3300025916 Ga0207663_10113446 Ga0207663_101134462 244
31 3300048905 Ga0496102_0604830 Ga0496102_0604830_117_908 244
32 3300025906 Ga0207699_10020787 Ga0207699_100207873 245
33 3300028017 Ga0265356_1001512 Ga0265356_10015122 246
34 3300005434 Ga0070709_10085458 Ga0070709_100854581 249
35 3300005436 Ga0070713_100018895 Ga0070713_1000188952 249
36 3300005439 Ga0070711_100077887 Ga0070711_1000778872 249
37 3300006173 Ga0070716_100147599 Ga0070716_1001475992 249
38 3300006175 Ga0070712_100007712 Ga0070712_1000077123 249
39 3300025915 Ga0207693_10054544 Ga0207693_100545443 249
40 3300025928 Ga0207700_10086527 Ga0207700_100865272 249
41 3300004803 Ga0058862_12178919 Ga0058862_121789192 250
42 3300005458 Ga0070681_10009976 Ga0070681_100099764 250
43 3300025912 Ga0207707_10013122 Ga0207707_100131222 250
44 3300025917 Ga0207660_10007333 Ga0207660_100073336 250
45 3300035695 Ga0373927_0018811 Ga0373927_0018811_2143_2940 252
46 3300037068 Ga0373925_0036616 Ga0373925_0036616_2743_3540 252
47 3300046472 Ga0495580_0000068 Ga0495580_0000068_37800_38597 252
48 3300046531 Ga0495665_0189698 Ga0495665_0189698_107_904 252
49 3300047315 Ga0495581_0376677 Ga0495581_0376677_14_811 252
50 3300005366 Ga0070659_100680844 Ga0070659_1006808441 257
51 3300037471 Ga0395905_0014399 Ga0395905_0014399_5245_6039 257
52 3300037471 Ga0395905_0085048 Ga0395905_0085048_1753_2550 257
53 3300045049 Ga0466959_0014979 Ga0466959_0014979_71_847 257
54 3300046684 Ga0495669_0003332 Ga0495669_0003332_1700_2482 257
55 3300005336 Ga0070680_100201210 Ga0070680_1002012102 258
56 3300005436 Ga0070713_100112416 Ga0070713_1001124162 258
57 3300005437 Ga0070710_10126920 Ga0070710_101269202 258
58 3300005437 Ga0070710_10214896 Ga0070710_102148962 258
59 3300005458 Ga0070681_10024936 Ga0070681_100249364 258
60 3300005530 Ga0070679_100006533 Ga0070679_1000065333 258
61 3300006163 Ga0070715_10079798 Ga0070715_100797982 258
62 3300025917 Ga0207660_10304901 Ga0207660_103049011 258
63 3300025929 Ga0207664_10166771 Ga0207664_101667712 258
64 3300025939 Ga0207665_10029592 Ga0207665_100295922 258
65 3300035724 Ga0373933_0328427 Ga0373933_0328427_101_886 258
66 3300044694 Ga0466963_0045176 Ga0466963_0045176_1422_2237 258
67 3300044842 Ga0466957_0000625 Ga0466957_0000625_15031_15810 258
68 3300044842 Ga0466957_0295137 Ga0466957_0295137_102_917 258
69 3300046462 Ga0495651_0013651 Ga0495651_0013651_2168_2947 258
70 3300047317 Ga0495604_0071514 Ga0495604_0071514_1764_2543 258
71 3300048912 Ga0496109_0421090 Ga0496109_0421090_115_894 258
72 3300048913 Ga0496110_0065113 Ga0496110_0065113_777_1556 258
73 3300048914 Ga0496111_0000490 Ga0496111_0000490_931_1710 258
74 3300048915 Ga0496112_0034942 Ga0496112_0034942_1939_2718 258
75 3300048916 Ga0496113_0193963 Ga0496113_0193963_681_1460 258
76 3300048918 Ga0496115_0441694 Ga0496115_0441694_124_903 258
77 3300005329 Ga0070683_100056172 Ga0070683_1000561723 259
78 3300005329 Ga0070683_100111052 Ga0070683_1001110523 259
79 3300005434 Ga0070709_10019563 Ga0070709_100195634 259
80 3300005436 Ga0070713_100259880 Ga0070713_1002598801 259
81 3300005436 Ga0070713_100363852 Ga0070713_1003638522 259
82 3300005437 Ga0070710_10024303 Ga0070710_100243033 259
83 3300005439 Ga0070711_100001945 Ga0070711_1000019458 259
84 3300005439 Ga0070711_100021933 Ga0070711_1000219333 259
85 3300005439 Ga0070711_100025099 Ga0070711_1000250994 259
86 3300005458 Ga0070681_10071909 Ga0070681_100719092 259
87 3300005530 Ga0070679_100267122 Ga0070679_1002671221 259
88 3300005539 Ga0068853_100014106 Ga0068853_1000141063 259
89 3300005543 Ga0070672_100207767 Ga0070672_1002077672 259
90 3300005547 Ga0070693_100138514 Ga0070693_1001385142 259
91 3300005548 Ga0070665_100187197 Ga0070665_1001871973 259
92 3300005563 Ga0068855_100020697 Ga0068855_1000206972 259
93 3300005563 Ga0068855_100529520 Ga0068855_1005295202 259
94 3300005614 Ga0068856_100024943 Ga0068856_1000249436 259
95 3300005616 Ga0068852_100117355 Ga0068852_1001173552 259
96 3300005616 Ga0068852_100328932 Ga0068852_1003289322 259
97 3300005842 Ga0068858_100002926 Ga0068858_1000029264 259
98 3300005843 Ga0068860_100241666 Ga0068860_1002416662 259
99 3300006028 Ga0070717_10244196 Ga0070717_102441961 259
100 3300006173 Ga0070716_100001082 Ga0070716_1000010828 259
101 3300006175 Ga0070712_100001573 Ga0070712_1000015739 259
102 3300006175 Ga0070712_100010482 Ga0070712_1000104825 259
103 3300006871 Ga0075434_100166153 Ga0075434_1001661532 259
104 3300006914 Ga0075436_100048770 Ga0075436_1000487702 259
105 3300007788 Ga0099795_10052115 Ga0099795_100521152 259
106 3300009093 Ga0105240_10055234 Ga0105240_100552344 259
107 3300009093 Ga0105240_10331966 Ga0105240_103319661 259
108 3300009098 Ga0105245_10025889 Ga0105245_100258892 259
109 3300009098 Ga0105245_10398305 Ga0105245_103983052 259
110 3300009174 Ga0105241_10352474 Ga0105241_103524742 259
111 3300009176 Ga0105242_10422065 Ga0105242_104220652 259
112 3300010375 Ga0105239_10973112 Ga0105239_109731122 259
113 3300013296 Ga0157374_10236520 Ga0157374_102365202 259
114 3300025898 Ga0207692_10006399 Ga0207692_100063994 259
115 3300025899 Ga0207642_10108616 Ga0207642_101086162 259
116 3300025913 Ga0207695_10082799 Ga0207695_100827993 259
117 3300025914 Ga0207671_10204977 Ga0207671_102049771 259
118 3300025915 Ga0207693_10001326 Ga0207693_100013261 259
119 3300025915 Ga0207693_10007435 Ga0207693_100074352 259
120 3300025916 Ga0207663_10001294 Ga0207663_100012945 259
121 3300025916 Ga0207663_10035124 Ga0207663_100351243 259
122 3300025921 Ga0207652_10081322 Ga0207652_100813223 259
123 3300025927 Ga0207687_10011481 Ga0207687_100114814 259
124 3300025928 Ga0207700_10179131 Ga0207700_101791313 259
125 3300025928 Ga0207700_10520104 Ga0207700_105201042 259
126 3300025939 Ga0207665_10000054 Ga0207665_1000005412 259
127 3300025942 Ga0207689_10000185 Ga0207689_1000018523 259
128 3300025944 Ga0207661_10033508 Ga0207661_100335082 259
129 3300025949 Ga0207667_10041150 Ga0207667_100411503 259
130 3300026035 Ga0207703_10018946 Ga0207703_100189466 259
131 3300026041 Ga0207639_10176228 Ga0207639_101762282 259
132 3300026078 Ga0207702_10744572 Ga0207702_107445722 259
133 3300026089 Ga0207648_10016025 Ga0207648_100160254 259
134 3300026118 Ga0207675_100163906 Ga0207675_1001639062 259
135 3300028381 Ga0268264_10155665 Ga0268264_101556652 259
136 3300031238 Ga0265332_10049037 Ga0265332_100490372 259
137 3300031239 Ga0265328_10013670 Ga0265328_100136702 259
138 3300031241 Ga0265325_10001599 Ga0265325_100015999 259
139 3300031247 Ga0265340_10000590 Ga0265340_1000059013 259
140 3300031251 Ga0265327_10030880 Ga0265327_100308803 259
141 3300031595 Ga0265313_10009611 Ga0265313_100096114 259
142 3300035083 Ga0373926_0002213 Ga0373926_0002213_121_903 259
143 3300035083 Ga0373926_0005482 Ga0373926_0005482_1613_2401 259
144 3300035119 Ga0373956_0009028 Ga0373956_0009028_2075_2857 259
145 3300035120 Ga0373957_0055449 Ga0373957_0055449_661_1443 259
146 3300035170 Ga0373943_0014123 Ga0373943_0014123_66_854 259
147 3300035171 Ga0373946_0004111 Ga0373946_0004111_3847_4635 259
148 3300035171 Ga0373946_0011099 Ga0373946_0011099_2531_3319 259
149 3300035410 Ga0373924_0000059 Ga0373924_0000059_20237_21025 259
150 3300035692 Ga0373935_0003805 Ga0373935_0003805_393_1181 259
151 3300035692 Ga0373935_0007693 Ga0373935_0007693_3945_4733 259
152 3300035695 Ga0373927_0006966 Ga0373927_0006966_556_1344 259
153 3300035725 Ga0373947_0027507 Ga0373947_0027507_1717_2505 259
154 3300036401 Ga0373937_0000408 Ga0373937_0000408_3640_4422 259
155 3300036401 Ga0373937_0116844 Ga0373937_0116844_840_1622 259
156 3300037068 Ga0373925_0088378 Ga0373925_0088378_889_1677 259
157 3300037068 Ga0373925_0117326 Ga0373925_0117326_392_1174 259
158 3300039450 Ga0436363_0647176 Ga0436363_0647176_22_801 259
159 3300045836 Ga0466958_0237979 Ga0466958_0237979_203_985 259
160 3300046455 Ga0495603_0041371 Ga0495603_0041371_1668_2447 259
161 3300046472 Ga0495580_0003297 Ga0495580_0003297_5189_5968 259
162 3300046472 Ga0495580_0004476 Ga0495580_0004476_3326_4105 259
163 3300046472 Ga0495580_0023514 Ga0495580_0023514_2270_3049 259
164 3300046472 Ga0495580_0057747 Ga0495580_0057747_929_1708 259
165 3300046472 Ga0495580_0137131 Ga0495580_0137131_729_1511 259
166 3300046473 Ga0495582_0068588 Ga0495582_0068588_57_839 259
167 3300046473 Ga0495582_0074808 Ga0495582_0074808_1024_1812 259
168 3300046477 Ga0495664_0270592 Ga0495664_0270592_67_855 259
169 3300046499 Ga0495594_0040150 Ga0495594_0040150_1613_2392 259
170 3300046511 Ga0495608_0235949 Ga0495608_0235949_327_1115 259
171 3300046517 Ga0495630_0454526 Ga0495630_0454526_79_867 259
172 3300046531 Ga0495665_0057207 Ga0495665_0057207_1058_1846 259
173 3300046664 Ga0495659_0027422 Ga0495659_0027422_1112_1891 259
174 3300046679 Ga0495623_0014046 Ga0495623_0014046_3511_4293 259
175 3300046681 Ga0495647_0121513 Ga0495647_0121513_96_875 259
176 3300046690 Ga0495624_0069533 Ga0495624_0069533_297_1085 259
177 3300047318 Ga0495636_0061597 Ga0495636_0061597_725_1504 259
178 3300048907 Ga0496104_0101610 Ga0496104_0101610_433_1221 259
179 3300048908 Ga0496105_0000590 Ga0496105_0000590_14890_15672 259
180 3300048913 Ga0496110_0128310 Ga0496110_0128310_1051_1839 259
181 3300048915 Ga0496112_0002375 Ga0496112_0002375_2174_2962 259
182 3300048915 Ga0496112_0176645 Ga0496112_0176645_977_1756 259
183 3300048915 Ga0496112_0220701 Ga0496112_0220701_490_1272 259
184 3300048916 Ga0496113_0185554 Ga0496113_0185554_621_1409 259
185 3300050512 nmdc:mga0n895_168177_c1 nmdc:mga0n895_168177_c1_801_1583 259
186 3300050514 nmdc:mga08x19_66726_c1 nmdc:mga08x19_66726_c1_757_1539 259
187 3300005434 Ga0070709_10123995 Ga0070709_101239952 260
188 3300005435 Ga0070714_100001244 Ga0070714_1000012448 260
189 3300005436 Ga0070713_100005742 Ga0070713_1000057425 260
190 3300005563 Ga0068855_100032998 Ga0068855_1000329984 260
191 3300005563 Ga0068855_100045068 Ga0068855_1000450683 260
192 3300005578 Ga0068854_100207623 Ga0068854_1002076232 260
193 3300005614 Ga0068856_100032885 Ga0068856_1000328854 260
194 3300005614 Ga0068856_100201069 Ga0068856_1002010692 260
195 3300005616 Ga0068852_100244302 Ga0068852_1002443023 260
196 3300006028 Ga0070717_10005444 Ga0070717_100054446 260
197 3300009093 Ga0105240_10801969 Ga0105240_108019692 260
198 3300009174 Ga0105241_10186146 Ga0105241_101861462 260
199 3300009545 Ga0105237_10103263 Ga0105237_101032633 260
200 3300009551 Ga0105238_10038663 Ga0105238_100386633 260
201 3300013104 Ga0157370_10036441 Ga0157370_100364412 260
202 3300013105 Ga0157369_10023020 Ga0157369_100230203 260
203 3300013307 Ga0157372_10206008 Ga0157372_102060082 260
204 3300014325 Ga0163163_10021773 Ga0163163_100217733 260
205 3300025906 Ga0207699_10291578 Ga0207699_102915782 260
206 3300025913 Ga0207695_10134031 Ga0207695_101340312 260
207 3300025914 Ga0207671_10067771 Ga0207671_100677712 260
208 3300025914 Ga0207671_10123793 Ga0207671_101237932 260
209 3300025928 Ga0207700_10051950 Ga0207700_100519503 260
210 3300025929 Ga0207664_10004723 Ga0207664_100047232 260
211 3300025929 Ga0207664_10165053 Ga0207664_101650532 260
212 3300025949 Ga0207667_10034427 Ga0207667_100344272 260
213 3300025949 Ga0207667_10205653 Ga0207667_102056532 260
214 3300026041 Ga0207639_10228334 Ga0207639_102283342 260
215 3300026078 Ga0207702_10013286 Ga0207702_100132863 260
216 3300028800 Ga0265338_10028135 Ga0265338_100281353 260
217 3300031241 Ga0265325_10012794 Ga0265325_100127943 260
218 3300031249 Ga0265339_10106341 Ga0265339_101063411 260
219 3300039450 Ga0436363_0711235 Ga0436363_0711235_661_1446 260
220 3300044693 Ga0466961_0192197 Ga0466961_0192197_77_859 260
221 3300044694 Ga0466963_0017273 Ga0466963_0017273_1024_1806 260
222 3300045976 Ga0466967_0001038 Ga0466967_0001038_3597_4379 260
223 3300047445 Ga0495677_0068280 Ga0495677_0068280_399_1199 260
224 3300048915 Ga0496112_0374991 Ga0496112_0374991_240_1040 260
225 3300050514 nmdc:mga08x19_286069_c1 nmdc:mga08x19_286069_c1_151_933 260
226 3300003323 rootH1_10391135 rootH1_103911351 261
227 3300005439 Ga0070711_100464480 Ga0070711_1004644801 261
228 3300013105 Ga0157369_10000442 Ga0157369_1000044227 261
229 3300045051 Ga0451576_0300520 Ga0451576_0300520_390_1181 261
230 3300045976 Ga0466967_0067684 Ga0466967_0067684_1354_2142 261
231 3300005437 Ga0070710_10134612 Ga0070710_101346122 262
232 3300005439 Ga0070711_100169305 Ga0070711_1001693052 262
233 3300005445 Ga0070708_100023099 Ga0070708_1000230992 262
234 3300005468 Ga0070707_100159229 Ga0070707_1001592292 262
235 3300006028 Ga0070717_10004778 Ga0070717_100047789 262
236 3300006028 Ga0070717_10012832 Ga0070717_100128324 262
237 3300006028 Ga0070717_10108057 Ga0070717_101080572 262
238 3300009174 Ga0105241_10362951 Ga0105241_103629512 262
239 3300009551 Ga0105238_10099645 Ga0105238_100996452 262
240 3300013105 Ga0157369_10403840 Ga0157369_104038402 262
241 3300025898 Ga0207692_10010041 Ga0207692_100100413 262
242 3300025916 Ga0207663_10067221 Ga0207663_100672212 262
243 3300025928 Ga0207700_10110200 Ga0207700_101102003 262
244 3300025939 Ga0207665_10135276 Ga0207665_101352763 262
245 3300036401 Ga0373937_0276386 Ga0373937_0276386_380_1183 262
246 3300037068 Ga0373925_0119039 Ga0373925_0119039_170_958 262
247 3300046663 Ga0495635_0205242 Ga0495635_0205242_513_1316 262
248 3300006852 Ga0075433_10022979 Ga0075433_100229795 263
249 3300006871 Ga0075434_100026835 Ga0075434_1000268355 263
250 3300050512 nmdc:mga0n895_1237_c1 nmdc:mga0n895_1237_c1_3476_4267 263
251 3300005334 Ga0068869_100010850 Ga0068869_1000108503 264
252 3300005345 Ga0070692_10156071 Ga0070692_101560711 264
253 3300005366 Ga0070659_100078281 Ga0070659_1000782812 264
254 3300005366 Ga0070659_100702412 Ga0070659_1007024121 264
255 3300005436 Ga0070713_100000508 Ga0070713_10000050815 264
256 3300005436 Ga0070713_100681739 Ga0070713_1006817392 264
257 3300005437 Ga0070710_10003026 Ga0070710_100030266 264
258 3300005458 Ga0070681_10094704 Ga0070681_100947043 264
259 3300005466 Ga0070685_10015632 Ga0070685_100156324 264
260 3300005536 Ga0070697_100014294 Ga0070697_1000142942 264
261 3300005539 Ga0068853_100122997 Ga0068853_1001229972 264
262 3300005546 Ga0070696_100266678 Ga0070696_1002666781 264
263 3300005549 Ga0070704_100084782 Ga0070704_1000847822 264
264 3300005563 Ga0068855_100324647 Ga0068855_1003246472 264
265 3300005577 Ga0068857_100036989 Ga0068857_1000369893 264
266 3300005578 Ga0068854_100034115 Ga0068854_1000341153 264
267 3300005614 Ga0068856_100268940 Ga0068856_1002689401 264
268 3300005616 Ga0068852_100225831 Ga0068852_1002258312 264
269 3300005617 Ga0068859_100223089 Ga0068859_1002230892 264
270 3300006163 Ga0070715_10012378 Ga0070715_100123783 264
271 3300006173 Ga0070716_100012159 Ga0070716_1000121593 264
272 3300006175 Ga0070712_100009706 Ga0070712_1000097064 264
273 3300006852 Ga0075433_10392725 Ga0075433_103927252 264
274 3300006931 Ga0097620_100223080 Ga0097620_1002230802 264
275 3300009093 Ga0105240_10203089 Ga0105240_102030893 264
276 3300009093 Ga0105240_10463436 Ga0105240_104634362 264
277 3300009147 Ga0114129_10103958 Ga0114129_101039584 264
278 3300009177 Ga0105248_10604079 Ga0105248_106040792 264
279 3300009545 Ga0105237_10039028 Ga0105237_100390283 264
280 3300010375 Ga0105239_10025096 Ga0105239_100250964 264
281 3300010375 Ga0105239_10131125 Ga0105239_101311252 264
282 3300013105 Ga0157369_10058587 Ga0157369_100585873 264
283 3300013306 Ga0163162_10006935 Ga0163162_100069357 264
284 3300013307 Ga0157372_10015753 Ga0157372_100157534 264
285 3300013307 Ga0157372_10075481 Ga0157372_100754814 264
286 3300014497 Ga0182008_10007422 Ga0182008_100074225 264
287 3300015262 Ga0182007_10006898 Ga0182007_100068983 264
288 3300025898 Ga0207692_10003431 Ga0207692_100034314 264
289 3300025905 Ga0207685_10109462 Ga0207685_101094621 264
290 3300025911 Ga0207654_10426069 Ga0207654_104260691 264
291 3300025913 Ga0207695_10151557 Ga0207695_101515573 264
292 3300025914 Ga0207671_10133087 Ga0207671_101330872 264
293 3300025915 Ga0207693_10000658 Ga0207693_1000065819 264
294 3300025916 Ga0207663_10092813 Ga0207663_100928132 264
295 3300025919 Ga0207657_10003001 Ga0207657_1000300110 264
296 3300025920 Ga0207649_10073528 Ga0207649_100735281 264
297 3300025921 Ga0207652_10287162 Ga0207652_102871622 264
298 3300025924 Ga0207694_10441000 Ga0207694_104410002 264
299 3300025928 Ga0207700_10002892 Ga0207700_100028926 264
300 3300025928 Ga0207700_10080398 Ga0207700_100803982 264
301 3300025929 Ga0207664_10043803 Ga0207664_100438033 264
302 3300025931 Ga0207644_10040200 Ga0207644_100402003 264
303 3300025933 Ga0207706_10230224 Ga0207706_102302242 264
304 3300025939 Ga0207665_10067906 Ga0207665_100679063 264
305 3300025949 Ga0207667_10544157 Ga0207667_105441572 264
306 3300025981 Ga0207640_10340405 Ga0207640_103404052 264
307 3300026041 Ga0207639_10150597 Ga0207639_101505973 264
308 3300026088 Ga0207641_10264138 Ga0207641_102641382 264
309 3300026116 Ga0207674_10056443 Ga0207674_100564433 264
310 3300026142 Ga0207698_10169027 Ga0207698_101690272 264
311 3300028379 Ga0268266_10339196 Ga0268266_103391962 264
312 3300028800 Ga0265338_10039015 Ga0265338_100390154 264
313 3300039438 Ga0436360_1170157 Ga0436360_1170157_636_1430 264
314 3300046472 Ga0495580_0014337 Ga0495580_0014337_3955_4749 264
315 3300048903 Ga0496100_0018545 Ga0496100_0018545_1063_1857 264
316 3300048906 Ga0496103_0082127 Ga0496103_0082127_1171_1965 264
317 3300048911 Ga0496108_0045441 Ga0496108_0045441_1543_2337 264
318 3300048913 Ga0496110_0074527 Ga0496110_0074527_1906_2700 264
319 3300048915 Ga0496112_0268762 Ga0496112_0268762_689_1483 264
320 3300048916 Ga0496113_0059240 Ga0496113_0059240_866_1660 264
321 3300005467 Ga0070706_100043044 Ga0070706_1000430442 265
322 3300006175 Ga0070712_100008905 Ga0070712_1000089052 265
323 3300014969 Ga0157376_10161551 Ga0157376_101615512 265
324 3300025910 Ga0207684_10107856 Ga0207684_101078563 265
325 3300025939 Ga0207665_10059122 Ga0207665_100591223 265
326 3300028800 Ga0265338_10047135 Ga0265338_100471352 265
327 3300046457 Ga0495590_0027536 Ga0495590_0027536_1030_1827 265
328 3300005435 Ga0070714_100175508 Ga0070714_1001755082 266
329 3300005436 Ga0070713_100028013 Ga0070713_1000280132 266
330 3300006028 Ga0070717_10060316 Ga0070717_100603163 266
331 3300009093 Ga0105240_10353006 Ga0105240_103530062 266
332 3300013105 Ga0157369_10015527 Ga0157369_100155272 266
333 3300013105 Ga0157369_10172821 Ga0157369_101728212 266
334 3300013307 Ga0157372_10000969 Ga0157372_1000096911 266
335 3300013307 Ga0157372_10019817 Ga0157372_100198172 266
336 3300013307 Ga0157372_10270507 Ga0157372_102705073 266
337 3300025913 Ga0207695_10226772 Ga0207695_102267722 266
338 3300025928 Ga0207700_10033624 Ga0207700_100336243 266
339 3300025928 Ga0207700_10064504 Ga0207700_100645042 266
340 3300025929 Ga0207664_10115212 Ga0207664_101152122 266
341 3300037068 Ga0373925_0319501 Ga0373925_0319501_405_1211 266
342 3300048088 Ga0495602_0138230 Ga0495602_0138230_769_1575 266
343 3300048088 Ga0495602_0318869 Ga0495602_0318869_268_1074 266
344 3300001991 JGI24743J22301_10016281 JGI24743J22301_100162812 267
345 3300002074 JGI24748J21848_1009392 JGI24748J21848_10093921 267
346 3300002239 JGI24034J26672_10004198 JGI24034J26672_100041981 267
347 3300005290 Ga0065712_10159410 Ga0065712_101594101 267
348 3300005329 Ga0070683_100009652 Ga0070683_1000096529 267
349 3300005330 Ga0070690_100192881 Ga0070690_1001928811 267
350 3300005331 Ga0070670_100042120 Ga0070670_1000421204 267
351 3300005334 Ga0068869_100268765 Ga0068869_1002687652 267
352 3300005337 Ga0070682_100015853 Ga0070682_1000158533 267
353 3300005338 Ga0068868_100067431 Ga0068868_1000674313 267
354 3300005339 Ga0070660_100010642 Ga0070660_1000106423 267
355 3300005343 Ga0070687_100003095 Ga0070687_1000030953 267
356 3300005347 Ga0070668_100263676 Ga0070668_1002636762 267
357 3300005353 Ga0070669_100340378 Ga0070669_1003403781 267
358 3300005355 Ga0070671_100366436 Ga0070671_1003664361 267
359 3300005356 Ga0070674_100008909 Ga0070674_1000089093 267
360 3300005364 Ga0070673_100311614 Ga0070673_1003116141 267
361 3300005365 Ga0070688_100002892 Ga0070688_1000028924 267
362 3300005441 Ga0070700_100105817 Ga0070700_1001058172 267
363 3300005455 Ga0070663_100044253 Ga0070663_1000442532 267
364 3300005457 Ga0070662_100008358 Ga0070662_1000083584 267
365 3300005459 Ga0068867_100002611 Ga0068867_1000026119 267
366 3300005466 Ga0070685_10002276 Ga0070685_100022766 267
367 3300005535 Ga0070684_100078256 Ga0070684_1000782563 267
368 3300005539 Ga0068853_100107321 Ga0068853_1001073213 267
369 3300005543 Ga0070672_100015040 Ga0070672_1000150403 267
370 3300005547 Ga0070693_100213449 Ga0070693_1002134492 267
371 3300005563 Ga0068855_100014817 Ga0068855_1000148178 267
372 3300005564 Ga0070664_100052227 Ga0070664_1000522271 267
373 3300005614 Ga0068856_100469196 Ga0068856_1004691962 267
374 3300005615 Ga0070702_100027294 Ga0070702_1000272942 267
375 3300005616 Ga0068852_100154823 Ga0068852_1001548232 267
376 3300005718 Ga0068866_10001073 Ga0068866_100010739 267
377 3300005834 Ga0068851_10005150 Ga0068851_100051503 267
378 3300005840 Ga0068870_10002197 Ga0068870_100021972 267
379 3300005844 Ga0068862_100019015 Ga0068862_1000190155 267
380 3300006881 Ga0068865_100005233 Ga0068865_1000052337 267
381 3300009092 Ga0105250_10017617 Ga0105250_100176173 267
382 3300009098 Ga0105245_10092720 Ga0105245_100927202 267
383 3300009174 Ga0105241_10010562 Ga0105241_100105626 267
384 3300009176 Ga0105242_10047736 Ga0105242_100477363 267
385 3300009177 Ga0105248_10313242 Ga0105248_103132422 267
386 3300009545 Ga0105237_10049032 Ga0105237_100490324 267
387 3300009553 Ga0105249_10033064 Ga0105249_100330643 267
388 3300010375 Ga0105239_10004620 Ga0105239_100046205 267
389 3300011119 Ga0105246_10008854 Ga0105246_100088542 267
390 3300013100 Ga0157373_10003844 Ga0157373_100038448 267
391 3300013102 Ga0157371_10015021 Ga0157371_100150214 267
392 3300013297 Ga0157378_10130010 Ga0157378_101300103 267
393 3300013307 Ga0157372_10003879 Ga0157372_1000387912 267
394 3300013308 Ga0157375_10034157 Ga0157375_100341574 267
395 3300014325 Ga0163163_10003076 Ga0163163_100030764 267
396 3300014326 Ga0157380_10120581 Ga0157380_101205811 267
397 3300014745 Ga0157377_10000340 Ga0157377_1000034015 267
398 3300014968 Ga0157379_10029279 Ga0157379_100292795 267
399 3300014969 Ga0157376_10040357 Ga0157376_100403573 267
400 3300017792 Ga0163161_10003073 Ga0163161_100030732 267
401 3300025899 Ga0207642_10017021 Ga0207642_100170212 267
402 3300025901 Ga0207688_10013434 Ga0207688_100134343 267
403 3300025904 Ga0207647_10000966 Ga0207647_100009662 267
404 3300025907 Ga0207645_10000073 Ga0207645_1000007310 267
405 3300025908 Ga0207643_10001180 Ga0207643_100011809 267
406 3300025914 Ga0207671_10138805 Ga0207671_101388052 267
407 3300025918 Ga0207662_10001315 Ga0207662_100013153 267
408 3300025919 Ga0207657_10012792 Ga0207657_100127925 267
409 3300025920 Ga0207649_10006519 Ga0207649_100065194 267
410 3300025924 Ga0207694_10442416 Ga0207694_104424162 267
411 3300025925 Ga0207650_10000045 Ga0207650_1000004543 267
412 3300025926 Ga0207659_10017249 Ga0207659_100172495 267
413 3300025927 Ga0207687_10032051 Ga0207687_100320513 267
414 3300025931 Ga0207644_10052981 Ga0207644_100529813 267
415 3300025933 Ga0207706_10000213 Ga0207706_1000021357 267
416 3300025936 Ga0207670_10003534 Ga0207670_100035347 267
417 3300025937 Ga0207669_10003050 Ga0207669_100030504 267
418 3300025940 Ga0207691_10000556 Ga0207691_1000055628 267
419 3300025941 Ga0207711_10017493 Ga0207711_100174932 267
420 3300025942 Ga0207689_10000780 Ga0207689_1000078026 267
421 3300025944 Ga0207661_10000992 Ga0207661_1000099210 267
422 3300025945 Ga0207679_10000525 Ga0207679_100005258 267
423 3300025949 Ga0207667_10111188 Ga0207667_101111882 267
424 3300025961 Ga0207712_10124817 Ga0207712_101248173 267
425 3300025972 Ga0207668_10271073 Ga0207668_102710732 267
426 3300025986 Ga0207658_10021007 Ga0207658_100210072 267
427 3300026035 Ga0207703_10047343 Ga0207703_100473433 267
428 3300026067 Ga0207678_10000026 Ga0207678_10000026105 267
429 3300026075 Ga0207708_10187927 Ga0207708_101879272 267
430 3300026088 Ga0207641_10000075 Ga0207641_1000007543 267
431 3300026089 Ga0207648_10000679 Ga0207648_1000067926 267
432 3300026095 Ga0207676_10000669 Ga0207676_1000066921 267
433 3300026116 Ga0207674_10000559 Ga0207674_1000055919 267
434 3300026118 Ga0207675_100015010 Ga0207675_1000150106 267
435 3300026121 Ga0207683_10000438 Ga0207683_1000043826 267
436 3300026142 Ga0207698_10011814 Ga0207698_100118142 267
437 3300028379 Ga0268266_10001444 Ga0268266_1000144423 267
438 3300028380 Ga0268265_10017979 Ga0268265_100179793 267
439 3300028381 Ga0268264_10005658 Ga0268264_100056583 267
440 3300048904 Ga0496101_0045797 Ga0496101_0045797_1862_2665 267
441 3300048905 Ga0496102_0234953 Ga0496102_0234953_580_1383 267
442 3300048911 Ga0496108_0000957 Ga0496108_0000957_2421_3224 267
443 3300048912 Ga0496109_0000164 Ga0496109_0000164_32417_33220 267
444 3300048913 Ga0496110_0017520 Ga0496110_0017520_2187_2990 267
445 3300048914 Ga0496111_0186235 Ga0496111_0186235_219_1022 267
446 3300048915 Ga0496112_0000078 Ga0496112_0000078_48628_49431 267
447 3300048916 Ga0496113_0005389 Ga0496113_0005389_1751_2554 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

171

283

0.91

PF01678

DAP_epimerase

Diaminopimelate epimerase

36

155

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2otn-assembly1.cif.gz_A crystal structure of the catalytically active form of diaminopimelate epimerase from bacillus anthracis 0.9157 8 264
2q9h-assembly1.cif.gz_A crystal structure of the c73s mutant of diaminopimelate epimerase 0.9149 11 266
2q9j-assembly1.cif.gz_A crystal structure of the c217s mutant of diaminopimelate epimerase 0.9091 11 266
1bwz-assembly1.cif.gz_A diaminopimelate epimerase from hemophilus influenzae 0.9088 11 266
1gqz-assembly1.cif.gz_A refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a 0.9011 11 266
ID Description Score Start End Superfamily
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9666 144 252 3.10.310.10
af_C6T990_209_343_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9259 135 247 3.10.310.10
af_Q55GS8_59_214_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9068 12 93 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9017 144 252 3.10.310.10
af_Q58519_1_127_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8887 12 116 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A3D2RGL6-F1-model_v4 Diaminopimelate epimerase 0.9925 169 252 GO:0005829
GO:0008837
GO:0009089
AF-A0A7Y4TKE5-F1-model_v4 Diaminopimelate epimerase 0.9807 135 252 GO:0005829
GO:0008837
GO:0009089
AF-A0A6L5DBQ8-F1-model_v4 deleted 0.9744 136 252
AF-A0A4Q3Z9W9-F1-model_v4 Diaminopimelate epimerase 0.9724 154 252 GO:0005829
GO:0008837
GO:0009089
AF-A0A3D0V0I3-F1-model_v4 deleted 0.9711 174 252

Feature Viewer

pLDDT pTM Quality
92.75 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map