F445978

General Info

Members Datasets Scaffolds Average Seq Length
447 276 894 385

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10118368|Ga0307513_101183681
Length 430
Sequence MQSLSSARKPSALGQNIDPDEGWSLPAWLYHDPEYHRVEMARVMRPSWQVVCHVSDVAAVGDWHTLDFLGESIIVIRGDDREVRAFTNVCRHRASKLVDGASGCARKLVCPYHAWTYGLDGQLIGVPGKAEYPTLDLAKSGLVPVDLEIWRGFVFVRLDNGGPSVAAMMAPYEAMVAPYRFEELRAIGRVTLRERRVNWKNVADNYSDGLHIPVAHPGLTRLFGKGYGVEAEAHVDRMWGELIDRPSINLSERLYQTLLPKADHLPEDQQRLWLYFKLWPNVAFDIYPDQVDFMQFLPVSPTETLIREISYALPDDRPEMKAARYLNWRINRQVNAEDTALIARVQDGMRSASYTVGPLGESEVCLRGFCRKVRDLIPEARLHHAPATGWSHQSPSREREGLGEGMFGDRARVRTSPPPTPPVNGRGVIQ

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
164 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
165 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
166 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
167 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
172 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
195 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
207 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
208 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
209 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
210 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
231 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
232 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
233 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
234 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
235 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
238 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
239 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
240 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
245 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
246 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
247 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
248 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
261 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
264 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
267 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
269 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
273 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
274 2643221584 Caulobacter sp. Root656 Isolate Unclassified
275 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
276 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0.45
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.38
Nodule 0
Rhizoplane 0.67
Rhizosphere 85.01
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10118368 3300031456 Bacteria 2623
2 JGI24752J21851_1000544 3300001976 Bacteria 5009
3 Ga0055536_1002493 3300003781 Bacteria 10332
4 Ga0055536_1005127 3300003781 Bacteria 6478
5 Ga0055530_10000005 3300003791 Bacteria 206625
6 Ga0055530_10013830 3300003791 Bacteria 2729
7 Ga0065165_1001226 3300005262 Bacteria 29422
8 Ga0065707_10096859 3300005295 Bacteria 3226
9 Ga0070676_10083744 3300005328 Bacteria 1940
10 Ga0070683_100175817 3300005329 Bacteria 2032
11 Ga0070670_100000012 3300005331 Bacteria 256314
12 Ga0070670_100007165 3300005331 Bacteria 9445
13 Ga0068869_100041037 3300005334 Bacteria 3312
14 Ga0070680_100000567 3300005336 Bacteria 25352
15 Ga0070682_100020033 3300005337 Bacteria 3931
16 Ga0068868_100000924 3300005338 Bacteria 20001
17 Ga0070660_100001100 3300005339 Bacteria 18179
18 Ga0070661_100042511 3300005344 Bacteria 3317
19 Ga0070692_10128331 3300005345 Bacteria 1422
20 Ga0070668_100000080 3300005347 Bacteria 60157
21 Ga0070668_100000172 3300005347 Bacteria 41511
22 Ga0070669_100016087 3300005353 Bacteria 5336
23 Ga0070669_100119613 3300005353 Bacteria 2008
24 Ga0070675_100028286 3300005354 Bacteria 4512
25 Ga0070675_100036261 3300005354 Bacteria 4011
26 Ga0070675_100115886 3300005354 Bacteria 2272
27 Ga0070671_100000808 3300005355 Bacteria 22633
28 Ga0070674_100054296 3300005356 Bacteria 2770
29 Ga0070673_100026664 3300005364 Bacteria 4272
30 Ga0070673_100227850 3300005364 Bacteria 1616
31 Ga0070659_100000005 3300005366 Bacteria 259902
32 Ga0070667_100000127 3300005367 Bacteria 95853
33 Ga0070667_100000199 3300005367 Bacteria 71115
34 Ga0070667_100000459 3300005367 Bacteria 41954
35 Ga0070709_10000223 3300005434 Bacteria 36823
36 Ga0070713_100000027 3300005436 Bacteria 93318
37 Ga0070711_100051814 3300005439 Bacteria 2821
38 Ga0070700_100020163 3300005441 Bacteria 3857
39 Ga0070681_10000123 3300005458 Bacteria 57938
40 Ga0070679_100002116 3300005530 Bacteria 17885
41 Ga0068853_100007368 3300005539 Bacteria 8803
42 Ga0068853_100018187 3300005539 Bacteria 5813
43 Ga0068853_100019125 3300005539 Bacteria 5675
44 Ga0068853_100075086 3300005539 Bacteria 2950
45 Ga0070686_100000191 3300005544 Bacteria 42686
46 Ga0070686_100035970 3300005544 Bacteria 3062
47 Ga0070696_100007951 3300005546 Bacteria 7081
48 Ga0070693_100005056 3300005547 Bacteria 6302
49 Ga0070693_100038236 3300005547 Bacteria 2681
50 Ga0070665_100000168 3300005548 Bacteria 119133
51 Ga0070665_100075229 3300005548 Bacteria 3384
52 Ga0070665_100087816 3300005548 Bacteria 3115
53 Ga0068855_100000010 3300005563 Bacteria 246022
54 Ga0068855_100452443 3300005563 Bacteria 1401
55 Ga0068857_100000781 3300005577 Bacteria 23756
56 Ga0068854_100007599 3300005578 Bacteria 6932
57 Ga0068856_100000330 3300005614 Bacteria 52037
58 Ga0068856_100018029 3300005614 Bacteria 6845
59 Ga0068852_100002011 3300005616 Bacteria 13847
60 Ga0068852_100066952 3300005616 Bacteria 3139
61 Ga0068852_100384546 3300005616 Bacteria 1377
62 Ga0068859_100021603 3300005617 Bacteria 6460
63 Ga0068859_100026592 3300005617 Bacteria 5802
64 Ga0068859_100035796 3300005617 Bacteria 4982
65 Ga0068864_100000010 3300005618 Bacteria 358723
66 Ga0068864_100000062 3300005618 Bacteria 121206
67 Ga0068864_100341421 3300005618 Bacteria 1411
68 Ga0068861_100000418 3300005719 Bacteria 24692
69 Ga0068861_100000527 3300005719 Bacteria 22405
70 Ga0068861_100061758 3300005719 Bacteria 2876
71 Ga0068861_100104255 3300005719 Bacteria 2262
72 Ga0068863_100000001 3300005841 Bacteria 581116
73 Ga0068863_100000029 3300005841 Bacteria 177191
74 Ga0068863_100000064 3300005841 Bacteria 118153
75 Ga0068863_100004823 3300005841 Bacteria 13291
76 Ga0068858_100032031 3300005842 Bacteria 4884
77 Ga0068860_100005223 3300005843 Bacteria 13190
78 Ga0068860_100006892 3300005843 Bacteria 11397
79 Ga0068860_100022219 3300005843 Bacteria 6141
80 Ga0068862_100000079 3300005844 Bacteria 113551
81 Ga0068862_100000648 3300005844 Bacteria 35882
82 Ga0068862_100003211 3300005844 Bacteria 14169
83 Ga0068862_100003689 3300005844 Bacteria 13095
84 Ga0068862_100070225 3300005844 Bacteria 3023
85 Ga0068862_100210012 3300005844 Bacteria 1759
86 Ga0081455_10001291 3300005937 Bacteria 31153
87 Ga0081455_10225774 3300005937 Bacteria 1385
88 Ga0070712_100000373 3300006175 Bacteria 25372
89 Ga0070712_100001073 3300006175 Bacteria 16504
90 Ga0075367_10000092 3300006178 Bacteria 24598
91 Ga0075369_10001000 3300006186 Bacteria 9425
92 Ga0075370_10022490 3300006353 Bacteria 3462
93 Ga0075434_100005448 3300006871 Bacteria 11592
94 Ga0075434_100124478 3300006871 Bacteria 2595
95 Ga0075434_100125732 3300006871 Bacteria 2581
96 Ga0075429_100212883 3300006880 Bacteria 1693
97 Ga0075436_100000033 3300006914 Bacteria 87819
98 Ga0075436_100141338 3300006914 Bacteria 1692
99 Ga0097620_100021603 3300006931 Bacteria 6460
100 Ga0097620_100026593 3300006931 Bacteria 5802
101 Ga0097620_100035796 3300006931 Bacteria 4982
102 Ga0099795_10000477 3300007788 Bacteria 7445
103 Ga0105240_10000675 3300009093 Bacteria 62663
104 Ga0105240_10001296 3300009093 Bacteria 43229
105 Ga0105240_10007395 3300009093 Bacteria 15967
106 Ga0111539_10000539 3300009094 Bacteria 48163
107 Ga0111539_10105325 3300009094 Bacteria 3309
108 Ga0111539_10315391 3300009094 Bacteria 1820
109 Ga0105245_10060309 3300009098 Bacteria 3416
110 Ga0105247_10001545 3300009101 Bacteria 16411
111 Ga0105247_10042308 3300009101 Bacteria 2790
112 Ga0114129_10455413 3300009147 Bacteria 1677
113 Ga0105241_10015307 3300009174 Bacteria 5617
114 Ga0105241_10015642 3300009174 Bacteria 5560
115 Ga0105241_10112832 3300009174 Bacteria 2178
116 Ga0105242_10098009 3300009176 Bacteria 2479
117 Ga0105248_10000001 3300009177 Bacteria 1881304
118 Ga0105248_10000014 3300009177 Bacteria 324729
119 Ga0105248_10105632 3300009177 Bacteria 3175
120 Ga0105237_10004041 3300009545 Bacteria 17131
121 Ga0105237_10017051 3300009545 Bacteria 7538
122 Ga0105237_10128397 3300009545 Bacteria 2529
123 Ga0105238_10004019 3300009551 Bacteria 14587
124 Ga0105238_10005644 3300009551 Bacteria 12369
125 Ga0105249_10000086 3300009553 Bacteria 132132
126 Ga0105249_10000253 3300009553 Bacteria 58707
127 Ga0105249_10155925 3300009553 Bacteria 2202
128 Ga0105249_10347032 3300009553 Bacteria 1503
129 Ga0105030_100141 3300009987 Bacteria 5760
130 Ga0099796_10003170 3300010159 Bacteria 3763
131 Ga0105239_10000266 3300010375 Bacteria 77602
132 Ga0105239_10002668 3300010375 Bacteria 22483
133 Ga0105239_10004092 3300010375 Bacteria 17533
134 Ga0105239_10070259 3300010375 Bacteria 3846
135 Ga0105239_10085253 3300010375 Bacteria 3481
136 Ga0157373_10001181 3300013100 Bacteria 19964
137 Ga0157370_10007459 3300013104 Bacteria 11893
138 Ga0157369_10004621 3300013105 Bacteria 16182
139 Ga0157369_10019603 3300013105 Bacteria 7568
140 Ga0157369_10089503 3300013105 Bacteria 3286
141 Ga0157374_10106491 3300013296 Bacteria 2694
142 Ga0157378_10073680 3300013297 Bacteria 3070
143 Ga0163162_10022423 3300013306 Bacteria 6220
144 Ga0157372_10078259 3300013307 Unclassified 3736
145 Ga0157372_10198806 3300013307 Bacteria 2322
146 Ga0157514_103934 3300013874 Bacteria 2421
147 Ga0163163_10293447 3300014325 Bacteria 1678
148 Ga0157380_10068571 3300014326 Bacteria 2859
149 Ga0157379_10001302 3300014968 Bacteria 20316
150 Ga0157379_10004062 3300014968 Bacteria 12482
151 Ga0157379_10024367 3300014968 Bacteria 5372
152 Ga0157376_10288127 3300014969 Bacteria 1549
153 Ga0206354_10080085 3300020081 Bacteria 2543
154 Ga0206353_10734548 3300020082 Bacteria 11682
155 Ga0213873_10000065 3300021358 Bacteria 23450
156 Ga0213872_10058630 3300021361 Bacteria 1743
157 Ga0213876_10000005 3300021384 Bacteria 727326
158 Ga0213876_10000204 3300021384 Bacteria 60563
159 Ga0213876_10002039 3300021384 Bacteria 12000
160 Ga0213876_10012933 3300021384 Bacteria 4437
161 Ga0209676_1000171 3300025292 Bacteria 154045
162 Ga0209050_1001766 3300025298 Bacteria 21350
163 Ga0209257_1004942 3300025304 Bacteria 9781
164 Ga0207710_10000814 3300025900 Bacteria 16898
165 Ga0207699_10000302 3300025906 Bacteria 26500
166 Ga0207699_10037518 3300025906 Bacteria 2771
167 Ga0207645_10030641 3300025907 Bacteria 3466
168 Ga0207707_10000002 3300025912 Bacteria 1142054
169 Ga0207695_10000003 3300025913 Bacteria 1368691
170 Ga0207695_10000516 3300025913 Bacteria 81914
171 Ga0207695_10097035 3300025913 Bacteria 2949
172 Ga0207671_10000567 3300025914 Bacteria 49547
173 Ga0207671_10015492 3300025914 Bacteria 5965
174 Ga0207693_10001057 3300025915 Bacteria 24618
175 Ga0207693_10003792 3300025915 Bacteria 12875
176 Ga0207663_10012877 3300025916 Unclassified 4534
177 Ga0207663_10045578 3300025916 Bacteria 2698
178 Ga0207660_10000607 3300025917 Bacteria 24167
179 Ga0207657_10021158 3300025919 Bacteria 6128
180 Ga0207649_10017308 3300025920 Bacteria 4085
181 Ga0207652_10001610 3300025921 Bacteria 19842
182 Ga0207681_10006308 3300025923 Bacteria 7280
183 Ga0207694_10000011 3300025924 Bacteria 417640
184 Ga0207650_10000008 3300025925 Bacteria 498534
185 Ga0207650_10000513 3300025925 Bacteria 32232
186 Ga0207659_10130484 3300025926 Bacteria 1939
187 Ga0207659_10287393 3300025926 Bacteria 1346
188 Ga0207700_10000076 3300025928 Bacteria 61427
189 Ga0207700_10072026 3300025928 Bacteria 2663
190 Ga0207644_10000012 3300025931 Bacteria 186652
191 Ga0207690_10000002 3300025932 Bacteria 807473
192 Ga0207669_10069089 3300025937 Bacteria 2209
193 Ga0207711_10000001 3300025941 Bacteria 1325674
194 Ga0207711_10000021 3300025941 Bacteria 355952
195 Ga0207689_10035529 3300025942 Bacteria 4140
196 Ga0207689_10041391 3300025942 Bacteria 3812
197 Ga0207667_10000093 3300025949 Bacteria 145814
198 Ga0207667_10006107 3300025949 Bacteria 14635
199 Ga0207712_10000026 3300025961 Bacteria 271237
200 Ga0207712_10000199 3300025961 Bacteria 60814
201 Ga0207668_10000500 3300025972 Bacteria 24526
202 Ga0207668_10000700 3300025972 Bacteria 20551
203 Ga0207668_10004086 3300025972 Bacteria 8574
204 Ga0207658_10000159 3300025986 Bacteria 71280
205 Ga0207658_10000184 3300025986 Bacteria 67062
206 Ga0207677_10000100 3300026023 Bacteria 70908
207 Ga0207703_10096074 3300026035 Bacteria 2501
208 Ga0207639_10051261 3300026041 Unclassified 3139
209 Ga0207639_10058478 3300026041 Bacteria 2965
210 Ga0207639_10107042 3300026041 Bacteria 2270
211 Ga0207702_10000139 3300026078 Bacteria 87741
212 Ga0207702_10000336 3300026078 Bacteria 53941
213 Ga0207641_10000001 3300026088 Bacteria 1180841
214 Ga0207641_10000049 3300026088 Bacteria 177222
215 Ga0207641_10000107 3300026088 Bacteria 121220
216 Ga0207641_10056553 3300026088 Bacteria 3334
217 Ga0207676_10000012 3300026095 Bacteria 353971
218 Ga0207676_10000057 3300026095 Bacteria 121220
219 Ga0207674_10000297 3300026116 Bacteria 62992
220 Ga0207674_10135692 3300026116 Bacteria 2423
221 Ga0207675_100000022 3300026118 Bacteria 116711
222 Ga0207675_100001636 3300026118 Bacteria 22459
223 Ga0207675_100072169 3300026118 Bacteria 3229
224 Ga0207675_100258851 3300026118 Bacteria 1686
225 Ga0207698_10023763 3300026142 Bacteria 4288
226 Ga0207698_10047412 3300026142 Bacteria 3255
227 Ga0209813_10000114 3300027866 Bacteria 29415
228 Ga0209974_10004453 3300027876 Bacteria 4985
229 Ga0207428_10001945 3300027907 Bacteria 20943
230 Ga0268266_10000130 3300028379 Bacteria 147912
231 Ga0268266_10136579 3300028379 Bacteria 2197
232 Ga0268265_10000080 3300028380 Bacteria 121220
233 Ga0268265_10000588 3300028380 Bacteria 36649
234 Ga0268265_10046498 3300028380 Bacteria 3245
235 Ga0268265_10049571 3300028380 Bacteria 3159
236 Ga0268265_10100048 3300028380 Bacteria 2339
237 Ga0268264_10001977 3300028381 Bacteria 18436
238 Ga0268264_10022125 3300028381 Bacteria 5189
239 Ga0268264_10023214 3300028381 Bacteria 5062
240 Ga0265337_1033686 3300028556 Bacteria 1510
241 Ga0265318_10000035 3300028577 Bacteria 139989
242 Ga0307515_10080044 3300028794 Bacteria 4268
243 Ga0265338_10000011 3300028800 Bacteria 433370
244 Ga0265338_10012128 3300028800 Bacteria 9847
245 Ga0265325_10000017 3300031241 Bacteria 130284
246 Ga0265339_10010455 3300031249 Bacteria 5764
247 Ga0265331_10004331 3300031250 Bacteria 8886
248 Ga0307513_10157487 3300031456 Bacteria 2169
249 Ga0307509_10036874 3300031507 Bacteria 5349
250 Ga0307408_100002251 3300031548 Bacteria 13767
251 Ga0307408_100202754 3300031548 Bacteria 1607
252 Ga0265313_10005923 3300031595 Bacteria 8847
253 Ga0265342_10005655 3300031712 Bacteria 9463
254 Ga0307405_10019857 3300031731 Bacteria 3743
255 Ga0307405_10148296 3300031731 Bacteria 1646
256 Ga0307413_10147459 3300031824 Bacteria 1635
257 Ga0307410_10036206 3300031852 Bacteria 3211
258 Ga0307406_10011329 3300031901 Bacteria 5058
259 Ga0307406_10080488 3300031901 Bacteria 2163
260 Ga0307407_10082546 3300031903 Bacteria 1948
261 Ga0307407_10103431 3300031903 Bacteria 1773
262 Ga0307412_10057915 3300031911 Bacteria 2589
263 Ga0307412_10088422 3300031911 Bacteria 2161
264 Ga0307409_100009533 3300031995 Bacteria 5972
265 Ga0307409_100035944 3300031995 Bacteria 3635
266 Ga0307416_100000215 3300032002 Bacteria 30330
267 Ga0307414_10001413 3300032004 Bacteria 12451
268 Ga0307414_10005862 3300032004 Bacteria 6796
269 Ga0307414_10044362 3300032004 Bacteria 3036
270 Ga0307411_10047667 3300032005 Bacteria 2771
271 Ga0307415_100000500 3300032126 Bacteria 17010
272 Ga0373947_0014609 3300035725 Bacteria 4503
273 Ga0373937_0000389 3300036401 Bacteria 40860
274 Ga0373937_0208228 3300036401 Bacteria 1839
275 Ga0373925_0022546 3300037068 Bacteria 4593
276 Ga0373925_0138802 3300037068 Bacteria 1901
277 Ga0436364_1336595 3300037853 Bacteria 2113
278 Ga0436365_0009505 3300039437 Bacteria 114283
279 Ga0436365_0260374 3300039437 Bacteria 5545
280 Ga0436365_0902712 3300039437 Bacteria 60533
281 Ga0436365_1369819 3300039437 Bacteria 23136
282 Ga0436361_0121186 3300039447 Bacteria 2030
283 Ga0436361_0526532 3300039447 Bacteria 1373
284 Ga0436361_0973464 3300039447 Bacteria 3617
285 Ga0436363_0242059 3300039450 Bacteria 4158
286 Ga0436362_0037733 3300039453 Bacteria 23770
287 Ga0451791_1392274 3300041451 Bacteria 3199
288 Ga0450923_000352 3300042125 Bacteria 4781
289 Ga0450894_001620 3300042131 Bacteria 3182
290 Ga0450896_000462 3300042133 Bacteria 4188
291 Ga0450898_002768 3300042134 Bacteria 2462
292 Ga0439446_0000368 3300042156 Bacteria 8643
293 Ga0450908_000816 3300042184 Bacteria 5994
294 Ga0439434_0003350 3300042435 Bacteria 4698
295 Ga0439434_0047974 3300042435 Bacteria 1320
296 Ga0439444_0001410 3300042437 Bacteria 3112
297 Ga0450918_001869 3300042531 Bacteria 4089
298 Ga0466965_0086082 3300044683 Bacteria 1594
299 Ga0495627_000099 3300046453 Bacteria 107062
300 Ga0495590_0001203 3300046457 Bacteria 11308
301 Ga0495590_0003623 3300046457 Bacteria 6292
302 Ga0495638_0003845 3300046460 Bacteria 11662
303 Ga0495638_0095898 3300046460 Bacteria 1781
304 Ga0495650_0000842 3300046471 Bacteria 36937
305 Ga0495650_0002268 3300046471 Bacteria 16025
306 Ga0495580_0121625 3300046472 Bacteria 1812
307 Ga0495596_0003188 3300046500 Bacteria 8440
308 Ga0495596_0008096 3300046500 Bacteria 4693
309 Ga0495583_0000069 3300046506 Bacteria 186863
310 Ga0495606_0070586 3300046507 Bacteria 2202
311 Ga0495610_0000018 3300046512 Bacteria 355044
312 Ga0495610_0000795 3300046512 Bacteria 29605
313 Ga0495616_0000176 3300046513 Bacteria 54755
314 Ga0495616_0000653 3300046513 Bacteria 25740
315 Ga0495632_0001982 3300046519 Bacteria 16257
316 Ga0495632_0006411 3300046519 Bacteria 7570
317 Ga0495632_0011840 3300046519 Bacteria 5073
318 Ga0495643_0002265 3300046522 Bacteria 15570
319 Ga0495643_0045467 3300046522 Bacteria 2383
320 Ga0495652_0078303 3300046529 Bacteria 2737
321 Ga0495598_0030925 3300046537 Bacteria 1503
322 Ga0495609_0017566 3300046538 Bacteria 3322
323 Ga0495645_0056620 3300046543 Bacteria 2847
324 Ga0495645_0085091 3300046543 Bacteria 2264
325 Ga0495668_0000015 3300046616 Bacteria 441932
326 Ga0495668_0000026 3300046616 Bacteria 297287
327 Ga0495668_0042565 3300046616 Bacteria 2529
328 Ga0495625_0000099 3300046660 Bacteria 140467
329 Ga0495625_0000190 3300046660 Bacteria 97529
330 Ga0495625_0013691 3300046660 Bacteria 6504
331 Ga0495681_0000020 3300047470 Bacteria 170007
332 Ga0495686_0051446 3300047472 Bacteria 2585
333 Ga0495686_0155072 3300047472 Bacteria 1342
334 Ga0495615_0000194 3300048090 Bacteria 14507
335 Ga0495626_0000477 3300048091 Bacteria 40436
336 Ga0496101_0142245 3300048904 Bacteria 1829
337 Ga0496106_0122003 3300048909 Bacteria 2038
338 Ga0496117_0007403 3300048920 Bacteria 10740
339 Ga0496117_0008655 3300048920 Bacteria 9626
340 Ga0496117_0049724 3300048920 Bacteria 2979
341 Ga0496118_0000597 3300048921 Bacteria 59798
342 Ga0496118_0000898 3300048921 Bacteria 46679
343 Ga0496118_0053935 3300048921 Bacteria 3050
344 Ga0496121_0002226 3300048924 Bacteria 30274
345 Ga0496121_0040069 3300048924 Bacteria 4115
346 Ga0496122_0006529 3300048925 Bacteria 13352
347 Ga0496123_0001156 3300048926 Bacteria 39200
348 Ga0496124_0083205 3300048927 Bacteria 2626
349 Ga0496124_0155750 3300048927 Bacteria 1787
350 Ga0496125_0028669 3300048928 Bacteria 5022
351 Ga0496126_0003884 3300048929 Bacteria 18400
352 Ga0496126_0026622 3300048929 Bacteria 5542
353 Ga0495678_002505 3300049459 Bacteria 12369
354 Ga0495682_0003114 3300049460 Bacteria 7511
355 Ga0501292_000094 3300049515 Bacteria 15813
356 Ga0501294_000134 3300049517 Bacteria 8643
357 Ga0501300_000889 3300049523 Bacteria 4573
358 Ga0501031_0054477 3300049568 Bacteria 2606
359 Ga0501032_0070458 3300049569 Bacteria 2332
360 Ga0501038_0189186 3300049574 Bacteria 1657
361 Ga0501039_0135635 3300049575 Bacteria 1932
362 Ga0501040_0162389 3300049576 Bacteria 1579
363 Ga0501040_0165117 3300049576 Bacteria 1566
364 Ga0501042_0056876 3300049578 Bacteria 2791
365 Ga0501042_0123376 3300049578 Bacteria 1865
366 Ga0501047_0000426 3300049581 Bacteria 47196
367 Ga0501047_0012209 3300049581 Bacteria 8133
368 Ga0501047_0076462 3300049581 Bacteria 3222
369 Ga0501047_0159063 3300049581 Bacteria 2131
370 Ga0501048_0069617 3300049582 Bacteria 2485
371 Ga0501048_0113902 3300049582 Bacteria 1910
372 Ga0501067_0019001 3300049583 Bacteria 3803
373 Ga0501068_0010535 3300049584 Bacteria 5196
374 Ga0501069_0003410 3300049585 Bacteria 8161
375 Ga0501070_0013424 3300049586 Bacteria 6905
376 Ga0501071_0020230 3300049587 Bacteria 4624
377 Ga0501071_0030186 3300049587 Bacteria 3833
378 Ga0501072_0040649 3300049588 Bacteria 3652
379 Ga0501072_0051817 3300049588 Bacteria 3231
380 Ga0501073_0012232 3300049589 Bacteria 6264
381 Ga0501073_0045272 3300049589 Bacteria 3098
382 Ga0501073_0097908 3300049589 Bacteria 2037
383 Ga0501074_0024036 3300049590 Bacteria 4428
384 Ga0501075_0082561 3300049591 Bacteria 2434
385 Ga0501075_0119100 3300049591 Bacteria 2008
386 Ga0501076_0141121 3300049592 Bacteria 1957
387 Ga0501076_0210179 3300049592 Bacteria 1590
388 Ga0501077_0015183 3300049593 Bacteria 4844
389 Ga0501206_001579 3300049653 Bacteria 2847
390 Ga0501222_000371 3300049662 Bacteria 6921
391 Ga0501224_000151 3300049664 Bacteria 7571
392 Ga0501227_002382 3300049665 Bacteria 4154
393 Ga0501233_002081 3300049668 Bacteria 3490
394 Ga0501235_000422 3300049669 Bacteria 8189
395 Ga0501249_000115 3300049679 Bacteria 24692
396 Ga0501257_006631 3300049686 Bacteria 2569
397 Ga0501259_001878 3300049688 Bacteria 3481
398 Ga0501261_000051 3300049690 Bacteria 22280
399 Ga0501245_000510 3300049708 Bacteria 4727
400 Ga0501079_0008352 3300049741 Bacteria 7844
401 Ga0501080_0000871 3300049742 Bacteria 24729
402 Ga0501083_0031619 3300049744 Bacteria 3632
403 Ga0501276_001170 3300049773 Bacteria 1741
404 Ga0501279_000077 3300049775 Bacteria 16519
405 Ga0501280_000100 3300049776 Bacteria 22874
406 Ga0501281_00058 3300049777 Bacteria 13111
407 Ga0501283_003688 3300049779 Bacteria 2038
408 Ga0501035_0010584 3300049822 Bacteria 8544
409 Ga0501035_0231268 3300049822 Bacteria 1575
410 nmdc:mga06z11_603_c1 3300050494 Bacteria 13136
411 nmdc:mga04h51_8_c1 3300050495 Bacteria 107557
412 nmdc:mga07m45_28706_c1 3300050496 Bacteria 3071
413 nmdc:mga07m45_51365_c1 3300050496 Bacteria 2325
414 nmdc:mga09592_149240_c1 3300050508 Bacteria 2016
415 nmdc:mga0n895_56416_c1 3300050512 Bacteria 3870
416 nmdc:mga0n895_68591_c1 3300050512 Bacteria 3513
417 nmdc:mga08x19_151_c1 3300050514 Bacteria 57376
418 nmdc:mga08x19_7113_c1 3300050514 Bacteria 6644
419 nmdc:mga0a205_44998_c1 3300050515 Bacteria 4257
420 Ga0495619_0223326 3300053085 Bacteria 1305
421 Ga0500643_000045 3300053087 Bacteria 153649
422 Ga0500643_009675 3300053087 Bacteria 3660
423 Ga0500643_043176 3300053087 Bacteria 1315
424 Ga0500641_0043951 3300053096 Bacteria 1815
425 Ga0500594_0000440 3300053118 Bacteria 9180
426 Ga0500607_000070 3300053121 Bacteria 73162
427 Ga0500559_0000547 3300053136 Bacteria 26048
428 Ga0500559_0003224 3300053136 Bacteria 8107
429 Ga0500590_015751 3300053148 Bacteria 3905
430 Ga0500604_0031759 3300053151 Bacteria 1552
431 Ga0500622_0000995 3300053156 Bacteria 23890
432 Ga0500624_000016 3300053157 Bacteria 134804
433 Ga0500627_0000008 3300053158 Bacteria 161914
434 Ga0500627_0000158 3300053158 Bacteria 20062
435 Ga0500637_0000007 3300053178 Bacteria 93788
436 Ga0500637_0004513 3300053178 Bacteria 6622
437 Ga0500645_003435 3300053730 Bacteria 6427
438 Ga0501084_0001152 3300054114 Bacteria 20593
439 Ga0501084_0003683 3300054114 Bacteria 12443
440 Ga0501084_0008383 3300054114 Bacteria 8536
441 Ga0501084_0039507 3300054114 Bacteria 3947
442 Ga0501082_0012805 3300060353 Bacteria 7209
443 2511129916 2510917021 Bacteria 5705459
444 2512643357 2512564014 Bacteria 4639632
445 2643931023 2643221584 Bacteria 5511711
446 2643950835 2643221588 Bacteria 3692460
447 2898333340 2898329390 Bacteria 5168154
448 Ga0307513_10118368
449 JGI24752J21851_1000544
450 Ga0055536_1002493
451 Ga0055536_1005127
452 Ga0055530_10000005
453 Ga0055530_10013830
454 Ga0065165_1001226
455 Ga0065707_10096859
456 Ga0070676_10083744
457 Ga0070683_100175817
458 Ga0070670_100000012
459 Ga0070670_100007165
460 Ga0068869_100041037
461 Ga0070680_100000567
462 Ga0070682_100020033
463 Ga0068868_100000924
464 Ga0070660_100001100
465 Ga0070661_100042511
466 Ga0070692_10128331
467 Ga0070668_100000080
468 Ga0070668_100000172
469 Ga0070669_100016087
470 Ga0070669_100119613
471 Ga0070675_100028286
472 Ga0070675_100036261
473 Ga0070675_100115886
474 Ga0070671_100000808
475 Ga0070674_100054296
476 Ga0070673_100026664
477 Ga0070673_100227850
478 Ga0070659_100000005
479 Ga0070667_100000127
480 Ga0070667_100000199
481 Ga0070667_100000459
482 Ga0070709_10000223
483 Ga0070713_100000027
484 Ga0070711_100051814
485 Ga0070700_100020163
486 Ga0070681_10000123
487 Ga0070679_100002116
488 Ga0068853_100007368
489 Ga0068853_100018187
490 Ga0068853_100019125
491 Ga0068853_100075086
492 Ga0070686_100000191
493 Ga0070686_100035970
494 Ga0070696_100007951
495 Ga0070693_100005056
496 Ga0070693_100038236
497 Ga0070665_100000168
498 Ga0070665_100075229
499 Ga0070665_100087816
500 Ga0068855_100000010
501 Ga0068855_100452443
502 Ga0068857_100000781
503 Ga0068854_100007599
504 Ga0068856_100000330
505 Ga0068856_100018029
506 Ga0068852_100002011
507 Ga0068852_100066952
508 Ga0068852_100384546
509 Ga0068859_100021603
510 Ga0068859_100026592
511 Ga0068859_100035796
512 Ga0068864_100000010
513 Ga0068864_100000062
514 Ga0068864_100341421
515 Ga0068861_100000418
516 Ga0068861_100000527
517 Ga0068861_100061758
518 Ga0068861_100104255
519 Ga0068863_100000001
520 Ga0068863_100000029
521 Ga0068863_100000064
522 Ga0068863_100004823
523 Ga0068858_100032031
524 Ga0068860_100005223
525 Ga0068860_100006892
526 Ga0068860_100022219
527 Ga0068862_100000079
528 Ga0068862_100000648
529 Ga0068862_100003211
530 Ga0068862_100003689
531 Ga0068862_100070225
532 Ga0068862_100210012
533 Ga0081455_10001291
534 Ga0081455_10225774
535 Ga0070712_100000373
536 Ga0070712_100001073
537 Ga0075367_10000092
538 Ga0075369_10001000
539 Ga0075370_10022490
540 Ga0075434_100005448
541 Ga0075434_100124478
542 Ga0075434_100125732
543 Ga0075429_100212883
544 Ga0075436_100000033
545 Ga0075436_100141338
546 Ga0097620_100021603
547 Ga0097620_100026593
548 Ga0097620_100035796
549 Ga0099795_10000477
550 Ga0105240_10000675
551 Ga0105240_10001296
552 Ga0105240_10007395
553 Ga0111539_10000539
554 Ga0111539_10105325
555 Ga0111539_10315391
556 Ga0105245_10060309
557 Ga0105247_10001545
558 Ga0105247_10042308
559 Ga0114129_10455413
560 Ga0105241_10015307
561 Ga0105241_10015642
562 Ga0105241_10112832
563 Ga0105242_10098009
564 Ga0105248_10000001
565 Ga0105248_10000014
566 Ga0105248_10105632
567 Ga0105237_10004041
568 Ga0105237_10017051
569 Ga0105237_10128397
570 Ga0105238_10004019
571 Ga0105238_10005644
572 Ga0105249_10000086
573 Ga0105249_10000253
574 Ga0105249_10155925
575 Ga0105249_10347032
576 Ga0105030_100141
577 Ga0099796_10003170
578 Ga0105239_10000266
579 Ga0105239_10002668
580 Ga0105239_10004092
581 Ga0105239_10070259
582 Ga0105239_10085253
583 Ga0157373_10001181
584 Ga0157370_10007459
585 Ga0157369_10004621
586 Ga0157369_10019603
587 Ga0157369_10089503
588 Ga0157374_10106491
589 Ga0157378_10073680
590 Ga0163162_10022423
591 Ga0157372_10078259
592 Ga0157372_10198806
593 Ga0157514_103934
594 Ga0163163_10293447
595 Ga0157380_10068571
596 Ga0157379_10001302
597 Ga0157379_10004062
598 Ga0157379_10024367
599 Ga0157376_10288127
600 Ga0206354_10080085
601 Ga0206353_10734548
602 Ga0213873_10000065
603 Ga0213872_10058630
604 Ga0213876_10000005
605 Ga0213876_10000204
606 Ga0213876_10002039
607 Ga0213876_10012933
608 Ga0209676_1000171
609 Ga0209050_1001766
610 Ga0209257_1004942
611 Ga0207710_10000814
612 Ga0207699_10000302
613 Ga0207699_10037518
614 Ga0207645_10030641
615 Ga0207707_10000002
616 Ga0207695_10000003
617 Ga0207695_10000516
618 Ga0207695_10097035
619 Ga0207671_10000567
620 Ga0207671_10015492
621 Ga0207693_10001057
622 Ga0207693_10003792
623 Ga0207663_10012877
624 Ga0207663_10045578
625 Ga0207660_10000607
626 Ga0207657_10021158
627 Ga0207649_10017308
628 Ga0207652_10001610
629 Ga0207681_10006308
630 Ga0207694_10000011
631 Ga0207650_10000008
632 Ga0207650_10000513
633 Ga0207659_10130484
634 Ga0207659_10287393
635 Ga0207700_10000076
636 Ga0207700_10072026
637 Ga0207644_10000012
638 Ga0207690_10000002
639 Ga0207669_10069089
640 Ga0207711_10000001
641 Ga0207711_10000021
642 Ga0207689_10035529
643 Ga0207689_10041391
644 Ga0207667_10000093
645 Ga0207667_10006107
646 Ga0207712_10000026
647 Ga0207712_10000199
648 Ga0207668_10000500
649 Ga0207668_10000700
650 Ga0207668_10004086
651 Ga0207658_10000159
652 Ga0207658_10000184
653 Ga0207677_10000100
654 Ga0207703_10096074
655 Ga0207639_10051261
656 Ga0207639_10058478
657 Ga0207639_10107042
658 Ga0207702_10000139
659 Ga0207702_10000336
660 Ga0207641_10000001
661 Ga0207641_10000049
662 Ga0207641_10000107
663 Ga0207641_10056553
664 Ga0207676_10000012
665 Ga0207676_10000057
666 Ga0207674_10000297
667 Ga0207674_10135692
668 Ga0207675_100000022
669 Ga0207675_100001636
670 Ga0207675_100072169
671 Ga0207675_100258851
672 Ga0207698_10023763
673 Ga0207698_10047412
674 Ga0209813_10000114
675 Ga0209974_10004453
676 Ga0207428_10001945
677 Ga0268266_10000130
678 Ga0268266_10136579
679 Ga0268265_10000080
680 Ga0268265_10000588
681 Ga0268265_10046498
682 Ga0268265_10049571
683 Ga0268265_10100048
684 Ga0268264_10001977
685 Ga0268264_10022125
686 Ga0268264_10023214
687 Ga0265337_1033686
688 Ga0265318_10000035
689 Ga0307515_10080044
690 Ga0265338_10000011
691 Ga0265338_10012128
692 Ga0265325_10000017
693 Ga0265339_10010455
694 Ga0265331_10004331
695 Ga0307513_10157487
696 Ga0307509_10036874
697 Ga0307408_100002251
698 Ga0307408_100202754
699 Ga0265313_10005923
700 Ga0265342_10005655
701 Ga0307405_10019857
702 Ga0307405_10148296
703 Ga0307413_10147459
704 Ga0307410_10036206
705 Ga0307406_10011329
706 Ga0307406_10080488
707 Ga0307407_10082546
708 Ga0307407_10103431
709 Ga0307412_10057915
710 Ga0307412_10088422
711 Ga0307409_100009533
712 Ga0307409_100035944
713 Ga0307416_100000215
714 Ga0307414_10001413
715 Ga0307414_10005862
716 Ga0307414_10044362
717 Ga0307411_10047667
718 Ga0307415_100000500
719 Ga0373947_0014609
720 Ga0373937_0000389
721 Ga0373937_0208228
722 Ga0373925_0022546
723 Ga0373925_0138802
724 Ga0436364_1336595
725 Ga0436365_0009505
726 Ga0436365_0260374
727 Ga0436365_0902712
728 Ga0436365_1369819
729 Ga0436361_0121186
730 Ga0436361_0526532
731 Ga0436361_0973464
732 Ga0436363_0242059
733 Ga0436362_0037733
734 Ga0451791_1392274
735 Ga0450923_000352
736 Ga0450894_001620
737 Ga0450896_000462
738 Ga0450898_002768
739 Ga0439446_0000368
740 Ga0450908_000816
741 Ga0439434_0003350
742 Ga0439434_0047974
743 Ga0439444_0001410
744 Ga0450918_001869
745 Ga0466965_0086082
746 Ga0495627_000099
747 Ga0495590_0001203
748 Ga0495590_0003623
749 Ga0495638_0003845
750 Ga0495638_0095898
751 Ga0495650_0000842
752 Ga0495650_0002268
753 Ga0495580_0121625
754 Ga0495596_0003188
755 Ga0495596_0008096
756 Ga0495583_0000069
757 Ga0495606_0070586
758 Ga0495610_0000018
759 Ga0495610_0000795
760 Ga0495616_0000176
761 Ga0495616_0000653
762 Ga0495632_0001982
763 Ga0495632_0006411
764 Ga0495632_0011840
765 Ga0495643_0002265
766 Ga0495643_0045467
767 Ga0495652_0078303
768 Ga0495598_0030925
769 Ga0495609_0017566
770 Ga0495645_0056620
771 Ga0495645_0085091
772 Ga0495668_0000015
773 Ga0495668_0000026
774 Ga0495668_0042565
775 Ga0495625_0000099
776 Ga0495625_0000190
777 Ga0495625_0013691
778 Ga0495681_0000020
779 Ga0495686_0051446
780 Ga0495686_0155072
781 Ga0495615_0000194
782 Ga0495626_0000477
783 Ga0496101_0142245
784 Ga0496106_0122003
785 Ga0496117_0007403
786 Ga0496117_0008655
787 Ga0496117_0049724
788 Ga0496118_0000597
789 Ga0496118_0000898
790 Ga0496118_0053935
791 Ga0496121_0002226
792 Ga0496121_0040069
793 Ga0496122_0006529
794 Ga0496123_0001156
795 Ga0496124_0083205
796 Ga0496124_0155750
797 Ga0496125_0028669
798 Ga0496126_0003884
799 Ga0496126_0026622
800 Ga0495678_002505
801 Ga0495682_0003114
802 Ga0501292_000094
803 Ga0501294_000134
804 Ga0501300_000889
805 Ga0501031_0054477
806 Ga0501032_0070458
807 Ga0501038_0189186
808 Ga0501039_0135635
809 Ga0501040_0162389
810 Ga0501040_0165117
811 Ga0501042_0056876
812 Ga0501042_0123376
813 Ga0501047_0000426
814 Ga0501047_0012209
815 Ga0501047_0076462
816 Ga0501047_0159063
817 Ga0501048_0069617
818 Ga0501048_0113902
819 Ga0501067_0019001
820 Ga0501068_0010535
821 Ga0501069_0003410
822 Ga0501070_0013424
823 Ga0501071_0020230
824 Ga0501071_0030186
825 Ga0501072_0040649
826 Ga0501072_0051817
827 Ga0501073_0012232
828 Ga0501073_0045272
829 Ga0501073_0097908
830 Ga0501074_0024036
831 Ga0501075_0082561
832 Ga0501075_0119100
833 Ga0501076_0141121
834 Ga0501076_0210179
835 Ga0501077_0015183
836 Ga0501206_001579
837 Ga0501222_000371
838 Ga0501224_000151
839 Ga0501227_002382
840 Ga0501233_002081
841 Ga0501235_000422
842 Ga0501249_000115
843 Ga0501257_006631
844 Ga0501259_001878
845 Ga0501261_000051
846 Ga0501245_000510
847 Ga0501079_0008352
848 Ga0501080_0000871
849 Ga0501083_0031619
850 Ga0501276_001170
851 Ga0501279_000077
852 Ga0501280_000100
853 Ga0501281_00058
854 Ga0501283_003688
855 Ga0501035_0010584
856 Ga0501035_0231268
857 nmdc:mga06z11_603_c1
858 nmdc:mga04h51_8_c1
859 nmdc:mga07m45_28706_c1
860 nmdc:mga07m45_51365_c1
861 nmdc:mga09592_149240_c1
862 nmdc:mga0n895_56416_c1
863 nmdc:mga0n895_68591_c1
864 nmdc:mga08x19_151_c1
865 nmdc:mga08x19_7113_c1
866 nmdc:mga0a205_44998_c1
867 Ga0495619_0223326
868 Ga0500643_000045
869 Ga0500643_009675
870 Ga0500643_043176
871 Ga0500641_0043951
872 Ga0500594_0000440
873 Ga0500607_000070
874 Ga0500559_0000547
875 Ga0500559_0003224
876 Ga0500590_015751
877 Ga0500604_0031759
878 Ga0500622_0000995
879 Ga0500624_000016
880 Ga0500627_0000008
881 Ga0500627_0000158
882 Ga0500637_0000007
883 Ga0500637_0004513
884 Ga0500645_003435
885 Ga0501084_0001152
886 Ga0501084_0003683
887 Ga0501084_0008383
888 Ga0501084_0039507
889 Ga0501082_0012805
890 2511129916
891 2512643357
892 2643931023
893 2643950835
894 2898333340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00848

Ring_hydroxyl_A

Ring hydroxylating alpha subunit (catalytic domain)

181

379

0.95

PF00355

Rieske

Rieske [2Fe-2S] domain

47

139

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zgp-assembly1.cif.gz_B crystal structure of the quaternary ammonium rieske monooxygenase cnta in complex with inhibitor mmv12 (mmv020670) 0.8579 11 376
6zgp-assembly4.cif.gz_L crystal structure of the quaternary ammonium rieske monooxygenase cnta in complex with inhibitor mmv12 (mmv020670) 0.8571 11 376
6zgp-assembly4.cif.gz_K crystal structure of the quaternary ammonium rieske monooxygenase cnta in complex with inhibitor mmv12 (mmv020670) 0.8555 11 376
6zgp-assembly3.cif.gz_I crystal structure of the quaternary ammonium rieske monooxygenase cnta in complex with inhibitor mmv12 (mmv020670) 0.8515 11 376
6zgp-assembly2.cif.gz_F crystal structure of the quaternary ammonium rieske monooxygenase cnta in complex with inhibitor mmv12 (mmv020670) 0.8513 11 376
ID Description Score Start End Superfamily
3n0qA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9418 40 158 2.102.10.10
2b1xA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9323 41 162 2.102.10.10
af_A0A1D8PL08_48_170_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9236 41 158 2.102.10.10
2ckfA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9226 40 157 2.102.10.10
3n0qA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.919 40 158 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A7X9WWX7-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.988 11 386 GO:0005506
GO:0051213
GO:0051537
AF-A0A246K1I7-F1-model_v4 2Fe-2S ferredoxin 0.9778 6 387 GO:0005506
GO:0016491
GO:0051537
AF-A0A7X9WWX7-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9726 11 386 GO:0005506
GO:0051213
GO:0051537
AF-A0A516IPU1-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9724 1 386 GO:0005506
GO:0051213
GO:0051537
AF-A0A7S8F392-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9696 1 387 GO:0005506
GO:0051213
GO:0051537

Map