F445980

General Info

Members Datasets Scaffolds Average Seq Length
447 269 894 256

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10026379|Ga0265342_100263792
Length 303
Sequence MSLIWVKNTQPQRGGCERNVGSSAVGRKGFGRPSLAFRGPIVKERDLREPMTATIQSIYRYPVKGLSPEPLERAHLTAGAYFPGDRLFAVENGPSGFDPAAPQHEPKIKFLMLMRNERLATLRTRYEDASGMLTIQHEGRQAVQADLATKDGRLAVEAFFRRFMPAELRGPPRVLAAPDGYRFTDSRRGFVSIINLASVGALETVIGAPVDPLRFRANLYVDGWPAWHEFDLVDREIALGSAVRLKGVKRIERCAATNVDPATGIRDMTIPATLMRTWGHPDCGIYAEVMAGGEIATGDTVNP

Samples

Sample ID Description Type Environment
1 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
252 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
253 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
254 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
255 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
256 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
257 2773857925 Microvirga vignae BR3299 Isolate Unclassified
258 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
259 2842694124 Methylopila sp. R-72369 Isolate Unclassified
260 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
261 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
262 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
263 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
264 2902330777 Methylobacterium sp. 2A Isolate Unclassified
265 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
266 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
267 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
268 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
269 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.08
Metatranscriptomes 0.67
Isolates 4.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.26
Nodule 0.45
Rhizoplane 8.72
Rhizosphere 78.3
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265342_10026379 3300031712 Bacteria 3641
2 JGI24735J21928_10007362 3300002067 Bacteria 3592
3 JGI24742J22300_10011093 3300002244 Bacteria 1494
4 JGI25406J46586_10014257 3300003203 Bacteria 3385
5 JGI25153J46596_10010499 3300003215 Bacteria 4183
6 Ga0070658_10047621 3300005327 Bacteria 3469
7 Ga0070658_10051509 3300005327 Bacteria 3336
8 Ga0070658_10052259 3300005327 Bacteria 3313
9 Ga0070658_10356904 3300005327 Bacteria 1252
10 Ga0070676_10073150 3300005328 Bacteria 2062
11 Ga0070670_100148501 3300005331 Bacteria 2028
12 Ga0070680_100022101 3300005336 Bacteria 5061
13 Ga0070680_100144510 3300005336 Bacteria 1995
14 Ga0068868_100242964 3300005338 Unclassified 1513
15 Ga0070660_100005164 3300005339 Bacteria 9027
16 Ga0070689_100560035 3300005340 Bacteria 986
17 Ga0070691_10086047 3300005341 Unclassified 1545
18 Ga0070661_100009758 3300005344 Bacteria 6657
19 Ga0070668_100014605 3300005347 Bacteria 5870
20 Ga0070668_100708840 3300005347 Bacteria 888
21 Ga0070674_100086635 3300005356 Unclassified 2250
22 Ga0070688_100110264 3300005365 Bacteria 1829
23 Ga0070667_100240961 3300005367 Bacteria 1615
24 Ga0070711_100302477 3300005439 Bacteria 1272
25 Ga0070700_100273194 3300005441 Bacteria 1222
26 Ga0070663_100049105 3300005455 Bacteria 2995
27 Ga0070678_100359244 3300005456 Bacteria 1254
28 Ga0070662_100033055 3300005457 Bacteria 3640
29 Ga0070662_100153345 3300005457 Bacteria 1796
30 Ga0070681_10056666 3300005458 Bacteria 3899
31 Ga0070681_10139308 3300005458 Bacteria 2356
32 Ga0070685_10204059 3300005466 Bacteria 1286
33 Ga0070698_100111090 3300005471 Bacteria 2706
34 Ga0070679_100172960 3300005530 Bacteria 2132
35 Ga0070679_100173047 3300005530 Bacteria 2132
36 Ga0070679_100234584 3300005530 Bacteria 1794
37 Ga0070684_100060559 3300005535 Bacteria 3312
38 Ga0068853_100001993 3300005539 Bacteria 15074
39 Ga0068853_100202021 3300005539 Bacteria 1809
40 Ga0068853_100550343 3300005539 Bacteria 1093
41 Ga0070672_100619796 3300005543 Unclassified 943
42 Ga0070693_100401041 3300005547 Bacteria 951
43 Ga0068855_100019257 3300005563 Bacteria 8204
44 Ga0068855_100021063 3300005563 Bacteria 7817
45 Ga0068855_100022853 3300005563 Bacteria 7495
46 Ga0068855_100068114 3300005563 Bacteria 4144
47 Ga0070664_100375507 3300005564 Bacteria 1297
48 Ga0068857_100077787 3300005577 Bacteria 2960
49 Ga0068857_100093852 3300005577 Bacteria 2687
50 Ga0068854_100021126 3300005578 Bacteria 4414
51 Ga0068854_100206095 3300005578 Bacteria 1548
52 Ga0068854_100217829 3300005578 Bacteria 1509
53 Ga0068856_100025250 3300005614 Bacteria 5790
54 Ga0068852_100057936 3300005616 Bacteria 3353
55 Ga0068852_100060105 3300005616 Bacteria 3298
56 Ga0068852_100170364 3300005616 Bacteria 2040
57 Ga0068859_100118140 3300005617 Bacteria 2717
58 Ga0068864_100062655 3300005618 Bacteria 3222
59 Ga0068864_100134450 3300005618 Bacteria 2225
60 Ga0068861_100010366 3300005719 Bacteria 6466
61 Ga0068863_100855867 3300005841 Bacteria 908
62 Ga0081539_10000619 3300005985 Bacteria 71899
63 Ga0075365_10047789 3300006038 Bacteria 2814
64 Ga0075368_10025274 3300006042 Bacteria 2279
65 Ga0075363_100049652 3300006048 Bacteria 2235
66 Ga0075364_10049382 3300006051 Bacteria 2744
67 Ga0075369_10049993 3300006186 Bacteria 1807
68 Ga0075369_10106661 3300006186 Bacteria 1260
69 Ga0075366_10205713 3300006195 Bacteria 1197
70 Ga0097621_100330468 3300006237 Bacteria 1352
71 Ga0097621_100437894 3300006237 Bacteria 1176
72 Ga0075428_100168748 3300006844 Bacteria 2373
73 Ga0075428_100215660 3300006844 Bacteria 2074
74 Ga0075430_100020248 3300006846 Bacteria 5660
75 Ga0075430_100344156 3300006846 Unclassified 1231
76 Ga0075431_100000534 3300006847 Bacteria 31901
77 Ga0075431_100282226 3300006847 Unclassified 1681
78 Ga0075429_100005584 3300006880 Bacteria 10841
79 Ga0075429_100027772 3300006880 Bacteria 4912
80 Ga0068865_100038578 3300006881 Bacteria 3235
81 Ga0097620_100118159 3300006931 Bacteria 2717
82 Ga0099794_10049732 3300007265 Bacteria 2015
83 Ga0105251_10073742 3300009011 Bacteria 1585
84 Ga0105240_10013959 3300009093 Bacteria 10997
85 Ga0105240_10050894 3300009093 Bacteria 5217
86 Ga0105240_10184413 3300009093 Bacteria 2459
87 Ga0105240_10501199 3300009093 Bacteria 1350
88 Ga0111539_10173327 3300009094 Bacteria 2520
89 Ga0111539_10328642 3300009094 Bacteria 1780
90 Ga0111539_10460672 3300009094 Bacteria 1481
91 Ga0111539_10562088 3300009094 Bacteria 1329
92 Ga0105245_10059951 3300009098 Bacteria 3427
93 Ga0105247_10238884 3300009101 Bacteria 1237
94 Ga0114129_10002965 3300009147 Bacteria 23749
95 Ga0114129_10156957 3300009147 Bacteria 3111
96 Ga0114129_10208072 3300009147 Bacteria 2646
97 Ga0114129_10381408 3300009147 Bacteria 1862
98 Ga0114129_10436483 3300009147 Unclassified 1720
99 Ga0114129_10618856 3300009147 Bacteria 1401
100 Ga0105243_10367060 3300009148 Unclassified 1327
101 Ga0105242_10125689 3300009176 Bacteria 2207
102 Ga0105248_10148034 3300009177 Bacteria 2649
103 Ga0105248_10516447 3300009177 Bacteria 1347
104 Ga0105237_10030213 3300009545 Bacteria 5506
105 Ga0105237_10123198 3300009545 Bacteria 2587
106 Ga0105238_10054632 3300009551 Bacteria 4010
107 Ga0105238_10060508 3300009551 Bacteria 3792
108 Ga0105238_10078100 3300009551 Bacteria 3301
109 Ga0105238_10582077 3300009551 Bacteria 1126
110 Ga0105249_10014159 3300009553 Bacteria 7050
111 Ga0105239_10238284 3300010375 Bacteria 2042
112 Ga0105239_10248726 3300010375 Bacteria 1997
113 Ga0105239_11250731 3300010375 Bacteria 856
114 Ga0157373_10216072 3300013100 Bacteria 1352
115 Ga0157371_10238289 3300013102 Bacteria 1308
116 Ga0157370_10043297 3300013104 Bacteria 4333
117 Ga0157370_10068695 3300013104 Bacteria 3348
118 Ga0157369_10169133 3300013105 Bacteria 2304
119 Ga0157369_10221591 3300013105 Bacteria 1980
120 Ga0157369_10281821 3300013105 Bacteria 1731
121 Ga0157378_10189107 3300013297 Unclassified 1941
122 Ga0163162_10017750 3300013306 Bacteria 6962
123 Ga0157372_10104133 3300013307 Bacteria 3243
124 Ga0157375_10143619 3300013308 Bacteria 2516
125 Ga0157375_10437592 3300013308 Unclassified 1473
126 Ga0163163_10030745 3300014325 Bacteria 5177
127 Ga0163163_10054958 3300014325 Bacteria 3935
128 Ga0163163_10149868 3300014325 Bacteria 2377
129 Ga0163163_10169116 3300014325 Bacteria 2232
130 Ga0163163_10875288 3300014325 Bacteria 962
131 Ga0157380_10009748 3300014326 Bacteria 6893
132 Ga0157380_10560944 3300014326 Bacteria 1122
133 Ga0157379_10014508 3300014968 Bacteria 6914
134 Ga0197907_11418627 3300020069 Bacteria 1826
135 Ga0206356_10477357 3300020070 Bacteria 3131
136 Ga0206354_10956989 3300020081 Bacteria 2648
137 Ga0213876_10000092 3300021384 Bacteria 100818
138 Ga0209758_1006688 3300025297 Bacteria 8139
139 Ga0209758_1063780 3300025297 Bacteria 1198
140 Ga0207710_10035018 3300025900 Bacteria 2209
141 Ga0207688_10111159 3300025901 Bacteria 1591
142 Ga0207647_10005828 3300025904 Bacteria 8982
143 Ga0207643_10052453 3300025908 Bacteria 2316
144 Ga0207705_10003687 3300025909 Bacteria 11655
145 Ga0207705_10037668 3300025909 Bacteria 3460
146 Ga0207705_10038373 3300025909 Bacteria 3429
147 Ga0207707_10004787 3300025912 Bacteria 11871
148 Ga0207707_10026034 3300025912 Bacteria 5116
149 Ga0207707_10055998 3300025912 Bacteria 3430
150 Ga0207707_10315114 3300025912 Bacteria 1351
151 Ga0207671_10063211 3300025914 Bacteria 2750
152 Ga0207671_10436168 3300025914 Bacteria 1043
153 Ga0207660_10030035 3300025917 Bacteria 3733
154 Ga0207660_10164616 3300025917 Bacteria 1713
155 Ga0207660_10266019 3300025917 Bacteria 1357
156 Ga0207660_10314752 3300025917 Bacteria 1249
157 Ga0207657_10004291 3300025919 Bacteria 15098
158 Ga0207657_10027099 3300025919 Bacteria 5254
159 Ga0207649_10302100 3300025920 Bacteria 1170
160 Ga0207652_10034951 3300025921 Bacteria 4239
161 Ga0207652_10097426 3300025921 Bacteria 2592
162 Ga0207652_10192094 3300025921 Bacteria 1837
163 Ga0207681_10141428 3300025923 Bacteria 1793
164 Ga0207694_10038168 3300025924 Bacteria 3692
165 Ga0207694_10079679 3300025924 Bacteria 2569
166 Ga0207694_10090125 3300025924 Bacteria 2419
167 Ga0207659_10141553 3300025926 Bacteria 1868
168 Ga0207687_10150946 3300025927 Bacteria 1773
169 Ga0207664_10176399 3300025929 Bacteria 1833
170 Ga0207690_10130607 3300025932 Bacteria 1838
171 Ga0207706_10042192 3300025933 Bacteria 4043
172 Ga0207706_10079729 3300025933 Bacteria 2879
173 Ga0207670_10076066 3300025936 Bacteria 2335
174 Ga0207670_10108121 3300025936 Bacteria 1999
175 Ga0207669_10470975 3300025937 Unclassified 999
176 Ga0207704_10153839 3300025938 Unclassified 1627
177 Ga0207704_10157578 3300025938 Bacteria 1611
178 Ga0207689_10100927 3300025942 Bacteria 2370
179 Ga0207661_10026929 3300025944 Bacteria 4388
180 Ga0207679_10496282 3300025945 Bacteria 1089
181 Ga0207667_10038365 3300025949 Bacteria 5117
182 Ga0207667_10043082 3300025949 Bacteria 4791
183 Ga0207667_10050234 3300025949 Bacteria 4401
184 Ga0207667_10051638 3300025949 Bacteria 4333
185 Ga0207712_10074597 3300025961 Unclassified 2450
186 Ga0207668_10078504 3300025972 Bacteria 2384
187 Ga0207640_10009214 3300025981 Bacteria 5519
188 Ga0207640_10095836 3300025981 Bacteria 2067
189 Ga0207658_10325867 3300025986 Bacteria 1331
190 Ga0207639_10003011 3300026041 Bacteria 11341
191 Ga0207639_10052926 3300026041 Bacteria 3095
192 Ga0207639_10593813 3300026041 Bacteria 1020
193 Ga0207678_10055003 3300026067 Bacteria 3428
194 Ga0207708_10361844 3300026075 Bacteria 1193
195 Ga0207702_10066974 3300026078 Bacteria 3081
196 Ga0207702_10359535 3300026078 Bacteria 1395
197 Ga0207676_10042663 3300026095 Bacteria 3489
198 Ga0207674_10024882 3300026116 Bacteria 6390
199 Ga0207674_10302827 3300026116 Bacteria 1547
200 Ga0207675_100227466 3300026118 Bacteria 1799
201 Ga0207675_100243585 3300026118 Bacteria 1738
202 Ga0207698_10023485 3300026142 Bacteria 4309
203 Ga0207698_10030867 3300026142 Bacteria 3860
204 Ga0209179_1006637 3300027512 Bacteria 1876
205 Ga0209971_1029455 3300027682 Bacteria 1315
206 Ga0268266_10219285 3300028379 Bacteria 1748
207 Ga0265318_10028057 3300028577 Bacteria 2206
208 Ga0307515_10001513 3300028794 Bacteria 52028
209 Ga0265338_10057122 3300028800 Bacteria 3454
210 Ga0265330_10061442 3300031235 Bacteria 1634
211 Ga0265330_10066951 3300031235 Bacteria 1557
212 Ga0265332_10070290 3300031238 Bacteria 1491
213 Ga0265328_10017939 3300031239 Bacteria 2737
214 Ga0265320_10111676 3300031240 Bacteria 1251
215 Ga0265325_10005553 3300031241 Bacteria 7783
216 Ga0265325_10094279 3300031241 Bacteria 1472
217 Ga0265329_10037566 3300031242 Bacteria 1559
218 Ga0265340_10135045 3300031247 Bacteria 1130
219 Ga0265339_10004646 3300031249 Bacteria 9334
220 Ga0265339_10045004 3300031249 Bacteria 2431
221 Ga0265339_10053851 3300031249 Bacteria 2187
222 Ga0265331_10018470 3300031250 Bacteria 3615
223 Ga0265316_10049046 3300031344 Bacteria 3328
224 Ga0265316_10095794 3300031344 Bacteria 2260
225 Ga0265316_10272320 3300031344 Bacteria 1239
226 Ga0307513_10079924 3300031456 Bacteria 3375
227 Ga0307513_10280954 3300031456 Bacteria 1442
228 Ga0307513_10386411 3300031456 Bacteria 1138
229 Ga0265313_10005683 3300031595 Bacteria 9097
230 Ga0265313_10013097 3300031595 Bacteria 5004
231 Ga0265313_10071988 3300031595 Bacteria 1590
232 Ga0316579_10005103 3300031691 Bacteria 5270
233 Ga0265314_10020198 3300031711 Bacteria 5144
234 Ga0265314_10036627 3300031711 Bacteria 3562
235 Ga0265342_10000546 3300031712 Bacteria 39732
236 Ga0265342_10013353 3300031712 Bacteria 5517
237 Ga0265342_10034945 3300031712 Bacteria 3080
238 Ga0265342_10052503 3300031712 Bacteria 2429
239 Ga0307516_10000257 3300031730 Bacteria 68036
240 Ga0307413_10377987 3300031824 Bacteria 1103
241 Ga0307415_100281929 3300032126 Bacteria 1367
242 Ga0373936_0037926 3300035113 Bacteria 1926
243 Ga0373957_0038020 3300035120 Bacteria 1800
244 Ga0373943_0087057 3300035170 Bacteria 1612
245 Ga0373924_0071797 3300035410 Bacteria 1461
246 Ga0373931_0023640 3300035691 Bacteria 3105
247 Ga0373931_0223213 3300035691 Bacteria 1135
248 Ga0373947_0066156 3300035725 Bacteria 2206
249 Ga0373937_0157136 3300036401 Bacteria 2132
250 Ga0373937_0248686 3300036401 Bacteria 1676
251 Ga0373937_0668700 3300036401 Bacteria 984
252 Ga0395898_0109788 3300037466 Bacteria 2644
253 Ga0436364_0748887 3300037853 Bacteria 2144
254 Ga0436364_1425500 3300037853 Bacteria 1695
255 Ga0436365_0711553 3300039437 Bacteria 97884
256 Ga0436365_1193747 3300039437 Bacteria 936
257 Ga0439443_002420 3300042003 Bacteria 2230
258 Ga0439448_0024973 3300042005 Bacteria 1872
259 Ga0439446_0055878 3300042156 Bacteria 1186
260 Ga0439435_0014476 3300042436 Bacteria 1949
261 Ga0439459_0019144 3300042438 Bacteria 1294
262 Ga0439464_0023834 3300042439 Bacteria 1691
263 Ga0495580_0144213 3300046472 Bacteria 1650
264 Ga0495639_0031436 3300046475 Bacteria 2363
265 Ga0495664_0039244 3300046477 Bacteria 2797
266 Ga0495608_0002687 3300046511 Bacteria 12772
267 Ga0495610_0027343 3300046512 Bacteria 3033
268 Ga0495616_0022059 3300046513 Bacteria 3441
269 Ga0495618_0063818 3300046514 Bacteria 2340
270 Ga0495628_0029946 3300046516 Bacteria 4410
271 Ga0495648_0117583 3300046524 Bacteria 1434
272 Ga0495652_0045998 3300046529 Bacteria 3748
273 Ga0495640_0045052 3300046533 Bacteria 3062
274 Ga0495640_0093095 3300046533 Bacteria 1986
275 Ga0495586_0046413 3300046535 Bacteria 2342
276 Ga0495587_0264579 3300046536 Unclassified 965
277 Ga0495634_0198551 3300046642 Bacteria 1247
278 Ga0495625_0007210 3300046660 Bacteria 9731
279 Ga0495599_0216988 3300046678 Bacteria 1171
280 Ga0495646_0007226 3300046680 Bacteria 7054
281 Ga0495671_0156692 3300046692 Bacteria 1108
282 Ga0495604_0091701 3300047317 Bacteria 2252
283 Ga0495636_0017603 3300047318 Bacteria 2861
284 Ga0495676_0203858 3300047321 Bacteria 1373
285 Ga0495614_0196335 3300048089 Bacteria 912
286 Ga0496100_0048437 3300048903 Bacteria 2743
287 Ga0496100_0074890 3300048903 Bacteria 2269
288 Ga0496101_0109709 3300048904 Bacteria 2076
289 Ga0496101_0215397 3300048904 Bacteria 1489
290 Ga0496102_0069408 3300048905 Bacteria 3235
291 Ga0496104_0002590 3300048907 Bacteria 15598
292 Ga0496104_0002721 3300048907 Bacteria 15217
293 Ga0496105_0005232 3300048908 Bacteria 9836
294 Ga0496105_0006735 3300048908 Bacteria 8834
295 Ga0496105_0082600 3300048908 Bacteria 2654
296 Ga0496106_0056899 3300048909 Bacteria 2957
297 Ga0496106_0534216 3300048909 Bacteria 941
298 Ga0496107_0000113 3300048910 Bacteria 39326
299 Ga0496107_0093486 3300048910 Bacteria 2199
300 Ga0496108_0006962 3300048911 Bacteria 9151
301 Ga0496109_0001214 3300048912 Bacteria 21407
302 Ga0496109_0015586 3300048912 Bacteria 6628
303 Ga0496109_0150719 3300048912 Bacteria 2177
304 Ga0496109_0163706 3300048912 Bacteria 2084
305 Ga0496109_0491080 3300048912 Unclassified 1159
306 Ga0496109_0676065 3300048912 Bacteria 970
307 Ga0496110_0004773 3300048913 Bacteria 10558
308 Ga0496110_0143452 3300048913 Bacteria 2159
309 Ga0496111_0372671 3300048914 Bacteria 1056
310 Ga0496112_0017214 3300048915 Bacteria 6786
311 Ga0496112_0022133 3300048915 Bacteria 6055
312 Ga0496112_0041410 3300048915 Bacteria 4507
313 Ga0496112_0275648 3300048915 Bacteria 1630
314 Ga0496113_0012455 3300048916 Bacteria 5715
315 Ga0496113_0087099 3300048916 Bacteria 2400
316 Ga0496113_0139411 3300048916 Bacteria 1907
317 Ga0496113_0150846 3300048916 Bacteria 1833
318 Ga0496113_0235901 3300048916 Bacteria 1459
319 Ga0496114_0084639 3300048917 Bacteria 2685
320 Ga0496114_0365792 3300048917 Bacteria 1276
321 Ga0496115_0012492 3300048918 Bacteria 6393
322 Ga0496115_0040379 3300048918 Bacteria 3709
323 Ga0496115_0087944 3300048918 Bacteria 2536
324 Ga0496115_0215674 3300048918 Bacteria 1584
325 Ga0496117_0073633 3300048920 Bacteria 2278
326 Ga0496121_0005698 3300048924 Bacteria 15829
327 Ga0496126_0182316 3300048929 Bacteria 1783
328 Ga0496126_0219323 3300048929 Bacteria 1598
329 Ga0501032_0014331 3300049569 Bacteria 5614
330 Ga0501033_0063762 3300049570 Bacteria 2712
331 Ga0501034_0000135 3300049571 Bacteria 137151
332 Ga0501034_0000270 3300049571 Bacteria 94119
333 Ga0501034_0100791 3300049571 Bacteria 2882
334 Ga0501034_0195951 3300049571 Bacteria 1980
335 Ga0501034_0255894 3300049571 Bacteria 1695
336 Ga0501036_0024635 3300049572 Bacteria 5074
337 Ga0501036_0240358 3300049572 Bacteria 1519
338 Ga0501037_0004347 3300049573 Bacteria 10282
339 Ga0501037_0147911 3300049573 Bacteria 1680
340 Ga0501038_0174742 3300049574 Bacteria 1736
341 Ga0501039_0009281 3300049575 Bacteria 7490
342 Ga0501039_0303333 3300049575 Bacteria 1256
343 Ga0501042_0177001 3300049578 Bacteria 1539
344 Ga0501043_0041495 3300049579 Bacteria 3615
345 Ga0501046_0004523 3300049580 Bacteria 12600
346 Ga0501046_0120196 3300049580 Bacteria 1999
347 Ga0501046_0384706 3300049580 Bacteria 1015
348 Ga0501047_0000897 3300049581 Bacteria 30435
349 Ga0501047_0047910 3300049581 Bacteria 4128
350 Ga0501047_0157437 3300049581 Bacteria 2144
351 Ga0501047_0164992 3300049581 Bacteria 2086
352 Ga0501048_0001944 3300049582 Bacteria 15684
353 Ga0501048_0308581 3300049582 Bacteria 1126
354 Ga0501067_0003149 3300049583 Bacteria 9111
355 Ga0501067_0003996 3300049583 Bacteria 8141
356 Ga0501067_0059125 3300049583 Bacteria 2122
357 Ga0501069_0264605 3300049585 Bacteria 1004
358 Ga0501070_0011589 3300049586 Bacteria 7445
359 Ga0501070_0097041 3300049586 Bacteria 2438
360 Ga0501072_0004449 3300049588 Bacteria 10644
361 Ga0501072_0209065 3300049588 Bacteria 1555
362 Ga0501072_0225035 3300049588 Bacteria 1495
363 Ga0501072_0351981 3300049588 Bacteria 1169
364 Ga0501073_0097807 3300049589 Bacteria 2038
365 Ga0501073_0292007 3300049589 Bacteria 1125
366 Ga0501074_0062831 3300049590 Bacteria 2675
367 Ga0501074_0146685 3300049590 Bacteria 1687
368 Ga0501074_0326675 3300049590 Bacteria 1089
369 Ga0501075_0024664 3300049591 Bacteria 4415
370 Ga0501076_0324637 3300049592 Unclassified 1263
371 Ga0501080_0000298 3300049742 Bacteria 37784
372 Ga0501080_0020925 3300049742 Bacteria 6054
373 Ga0501083_0091067 3300049744 Bacteria 2013
374 Ga0501083_0104555 3300049744 Bacteria 1865
375 Ga0501083_0121289 3300049744 Bacteria 1715
376 Ga0501035_0000056 3300049822 Bacteria 137385
377 Ga0501035_0109589 3300049822 Bacteria 2420
378 Ga0501044_0000536 3300049823 Bacteria 46054
379 Ga0501044_0021512 3300049823 Bacteria 6879
380 Ga0501044_0023120 3300049823 Bacteria 6617
381 Ga0501044_0044186 3300049823 Bacteria 4626
382 Ga0501044_0119365 3300049823 Bacteria 2639
383 Ga0501044_0174218 3300049823 Bacteria 2121
384 Ga0501044_0213153 3300049823 Bacteria 1885
385 nmdc:mga00v17_137096_c1 3300050491 Bacteria 1567
386 nmdc:mga0k408_7684_c1 3300050493 Bacteria 5761
387 nmdc:mga0k408_87526_c1 3300050493 Bacteria 1829
388 nmdc:mga0k408_88421_c1 3300050493 Bacteria 1819
389 nmdc:mga04h51_85176_c1 3300050495 Bacteria 1129
390 nmdc:mga05p37_135327_c1 3300050507 Bacteria 3022
391 nmdc:mga05p37_260892_c1 3300050507 Bacteria 2074
392 nmdc:mga05p37_292545_c1 3300050507 Unclassified 1938
393 nmdc:mga05p37_390003_c1 3300050507 Bacteria 1629
394 nmdc:mga09592_11541_c1 3300050508 Bacteria 7189
395 nmdc:mga09592_160673_c1 3300050508 Bacteria 1941
396 nmdc:mga09592_77695_c1 3300050508 Bacteria 2824
397 nmdc:mga0qj67_175087_c1 3300050509 Unclassified 1742
398 nmdc:mga06r32_11653_c1 3300050510 Bacteria 7914
399 nmdc:mga06r32_844505_c1 3300050510 Bacteria 874
400 nmdc:mga08y16_135393_c1 3300050511 Bacteria 2560
401 nmdc:mga0sz30_14638_c1 3300050516 Bacteria 3090
402 nmdc:mga0sz30_86222_c1 3300050516 Bacteria 1363
403 Ga0495601_0028534 3300053077 Bacteria 3457
404 Ga0495601_0041854 3300053077 Bacteria 2872
405 Ga0495601_0115899 3300053077 Bacteria 1737
406 Ga0495612_0059260 3300053078 Bacteria 1583
407 Ga0495595_0026807 3300053084 Bacteria 2563
408 Ga0495619_0077387 3300053085 Bacteria 2234
409 Ga0495619_0298214 3300053085 Bacteria 1117
410 Ga0500644_0000902 3300053088 Bacteria 9489
411 Ga0500651_0007243 3300053093 Bacteria 6464
412 Ga0500556_0068677 3300053104 Bacteria 1320
413 Ga0500572_001509 3300053111 Bacteria 6265
414 Ga0500658_0152624 3300053134 Bacteria 1042
415 Ga0500559_0002528 3300053136 Bacteria 9396
416 Ga0500568_0045522 3300053139 Bacteria 1746
417 Ga0500616_0000001 3300053153 Bacteria 1986011
418 Ga0500616_0004374 3300053153 Bacteria 10100
419 Ga0500616_0163840 3300053153 Bacteria 1017
420 Ga0500636_0009740 3300053177 Bacteria 5596
421 Ga0501084_0074154 3300054114 Bacteria 2849
422 Ga0501084_0431139 3300054114 Bacteria 1114
423 Ga0501082_0000428 3300060353 Bacteria 37284
424 Ga0501082_0013311 3300060353 Bacteria 7071
425 Ga0501082_0045327 3300060353 Bacteria 3792
426 Ga0501082_0116509 3300060353 Bacteria 2314
427 Ga0501082_0371919 3300060353 Bacteria 1247
428 Ga0530510_0058269 3300061734 Bacteria 2793
429 2509079172 2508501114 Bacteria 7082538
430 2509146412 2508501128 Bacteria 8613869
431 2596377158 2595698237 Bacteria 6712432
432 2643757776 2643221547 Bacteria 4740017
433 2738746365 2738541281 Bacteria 5112672
434 2739355595 2738543032 Bacteria 5115625
435 2774869304 2773857925 Bacteria 6472445
436 2776257851 2775506901 Bacteria 9631051
437 2842697721 2842694124 Bacteria 4063419
438 2843746453 2843744320 Bacteria 5659202
439 2882457328 2882456835 Bacteria 6863978
440 2884301603 2884298095 Bacteria 3823049
441 2889308319 2889306138 Bacteria 6358934
442 2902334644 2902330777 Bacteria 6395352
443 2902405740 2902405164 Bacteria 6784948
444 2919452151 2919450847 Bacteria 5631160
445 2928125088 2928125067 Bacteria 5937560
446 3003671181 3003665799 Bacteria 7279786
447 8001845830 8001845381 Bacteria 5804942
448 Ga0265342_10026379
449 JGI24735J21928_10007362
450 JGI24742J22300_10011093
451 JGI25406J46586_10014257
452 JGI25153J46596_10010499
453 Ga0070658_10047621
454 Ga0070658_10051509
455 Ga0070658_10052259
456 Ga0070658_10356904
457 Ga0070676_10073150
458 Ga0070670_100148501
459 Ga0070680_100022101
460 Ga0070680_100144510
461 Ga0068868_100242964
462 Ga0070660_100005164
463 Ga0070689_100560035
464 Ga0070691_10086047
465 Ga0070661_100009758
466 Ga0070668_100014605
467 Ga0070668_100708840
468 Ga0070674_100086635
469 Ga0070688_100110264
470 Ga0070667_100240961
471 Ga0070711_100302477
472 Ga0070700_100273194
473 Ga0070663_100049105
474 Ga0070678_100359244
475 Ga0070662_100033055
476 Ga0070662_100153345
477 Ga0070681_10056666
478 Ga0070681_10139308
479 Ga0070685_10204059
480 Ga0070698_100111090
481 Ga0070679_100172960
482 Ga0070679_100173047
483 Ga0070679_100234584
484 Ga0070684_100060559
485 Ga0068853_100001993
486 Ga0068853_100202021
487 Ga0068853_100550343
488 Ga0070672_100619796
489 Ga0070693_100401041
490 Ga0068855_100019257
491 Ga0068855_100021063
492 Ga0068855_100022853
493 Ga0068855_100068114
494 Ga0070664_100375507
495 Ga0068857_100077787
496 Ga0068857_100093852
497 Ga0068854_100021126
498 Ga0068854_100206095
499 Ga0068854_100217829
500 Ga0068856_100025250
501 Ga0068852_100057936
502 Ga0068852_100060105
503 Ga0068852_100170364
504 Ga0068859_100118140
505 Ga0068864_100062655
506 Ga0068864_100134450
507 Ga0068861_100010366
508 Ga0068863_100855867
509 Ga0081539_10000619
510 Ga0075365_10047789
511 Ga0075368_10025274
512 Ga0075363_100049652
513 Ga0075364_10049382
514 Ga0075369_10049993
515 Ga0075369_10106661
516 Ga0075366_10205713
517 Ga0097621_100330468
518 Ga0097621_100437894
519 Ga0075428_100168748
520 Ga0075428_100215660
521 Ga0075430_100020248
522 Ga0075430_100344156
523 Ga0075431_100000534
524 Ga0075431_100282226
525 Ga0075429_100005584
526 Ga0075429_100027772
527 Ga0068865_100038578
528 Ga0097620_100118159
529 Ga0099794_10049732
530 Ga0105251_10073742
531 Ga0105240_10013959
532 Ga0105240_10050894
533 Ga0105240_10184413
534 Ga0105240_10501199
535 Ga0111539_10173327
536 Ga0111539_10328642
537 Ga0111539_10460672
538 Ga0111539_10562088
539 Ga0105245_10059951
540 Ga0105247_10238884
541 Ga0114129_10002965
542 Ga0114129_10156957
543 Ga0114129_10208072
544 Ga0114129_10381408
545 Ga0114129_10436483
546 Ga0114129_10618856
547 Ga0105243_10367060
548 Ga0105242_10125689
549 Ga0105248_10148034
550 Ga0105248_10516447
551 Ga0105237_10030213
552 Ga0105237_10123198
553 Ga0105238_10054632
554 Ga0105238_10060508
555 Ga0105238_10078100
556 Ga0105238_10582077
557 Ga0105249_10014159
558 Ga0105239_10238284
559 Ga0105239_10248726
560 Ga0105239_11250731
561 Ga0157373_10216072
562 Ga0157371_10238289
563 Ga0157370_10043297
564 Ga0157370_10068695
565 Ga0157369_10169133
566 Ga0157369_10221591
567 Ga0157369_10281821
568 Ga0157378_10189107
569 Ga0163162_10017750
570 Ga0157372_10104133
571 Ga0157375_10143619
572 Ga0157375_10437592
573 Ga0163163_10030745
574 Ga0163163_10054958
575 Ga0163163_10149868
576 Ga0163163_10169116
577 Ga0163163_10875288
578 Ga0157380_10009748
579 Ga0157380_10560944
580 Ga0157379_10014508
581 Ga0197907_11418627
582 Ga0206356_10477357
583 Ga0206354_10956989
584 Ga0213876_10000092
585 Ga0209758_1006688
586 Ga0209758_1063780
587 Ga0207710_10035018
588 Ga0207688_10111159
589 Ga0207647_10005828
590 Ga0207643_10052453
591 Ga0207705_10003687
592 Ga0207705_10037668
593 Ga0207705_10038373
594 Ga0207707_10004787
595 Ga0207707_10026034
596 Ga0207707_10055998
597 Ga0207707_10315114
598 Ga0207671_10063211
599 Ga0207671_10436168
600 Ga0207660_10030035
601 Ga0207660_10164616
602 Ga0207660_10266019
603 Ga0207660_10314752
604 Ga0207657_10004291
605 Ga0207657_10027099
606 Ga0207649_10302100
607 Ga0207652_10034951
608 Ga0207652_10097426
609 Ga0207652_10192094
610 Ga0207681_10141428
611 Ga0207694_10038168
612 Ga0207694_10079679
613 Ga0207694_10090125
614 Ga0207659_10141553
615 Ga0207687_10150946
616 Ga0207664_10176399
617 Ga0207690_10130607
618 Ga0207706_10042192
619 Ga0207706_10079729
620 Ga0207670_10076066
621 Ga0207670_10108121
622 Ga0207669_10470975
623 Ga0207704_10153839
624 Ga0207704_10157578
625 Ga0207689_10100927
626 Ga0207661_10026929
627 Ga0207679_10496282
628 Ga0207667_10038365
629 Ga0207667_10043082
630 Ga0207667_10050234
631 Ga0207667_10051638
632 Ga0207712_10074597
633 Ga0207668_10078504
634 Ga0207640_10009214
635 Ga0207640_10095836
636 Ga0207658_10325867
637 Ga0207639_10003011
638 Ga0207639_10052926
639 Ga0207639_10593813
640 Ga0207678_10055003
641 Ga0207708_10361844
642 Ga0207702_10066974
643 Ga0207702_10359535
644 Ga0207676_10042663
645 Ga0207674_10024882
646 Ga0207674_10302827
647 Ga0207675_100227466
648 Ga0207675_100243585
649 Ga0207698_10023485
650 Ga0207698_10030867
651 Ga0209179_1006637
652 Ga0209971_1029455
653 Ga0268266_10219285
654 Ga0265318_10028057
655 Ga0307515_10001513
656 Ga0265338_10057122
657 Ga0265330_10061442
658 Ga0265330_10066951
659 Ga0265332_10070290
660 Ga0265328_10017939
661 Ga0265320_10111676
662 Ga0265325_10005553
663 Ga0265325_10094279
664 Ga0265329_10037566
665 Ga0265340_10135045
666 Ga0265339_10004646
667 Ga0265339_10045004
668 Ga0265339_10053851
669 Ga0265331_10018470
670 Ga0265316_10049046
671 Ga0265316_10095794
672 Ga0265316_10272320
673 Ga0307513_10079924
674 Ga0307513_10280954
675 Ga0307513_10386411
676 Ga0265313_10005683
677 Ga0265313_10013097
678 Ga0265313_10071988
679 Ga0316579_10005103
680 Ga0265314_10020198
681 Ga0265314_10036627
682 Ga0265342_10000546
683 Ga0265342_10013353
684 Ga0265342_10034945
685 Ga0265342_10052503
686 Ga0307516_10000257
687 Ga0307413_10377987
688 Ga0307415_100281929
689 Ga0373936_0037926
690 Ga0373957_0038020
691 Ga0373943_0087057
692 Ga0373924_0071797
693 Ga0373931_0023640
694 Ga0373931_0223213
695 Ga0373947_0066156
696 Ga0373937_0157136
697 Ga0373937_0248686
698 Ga0373937_0668700
699 Ga0395898_0109788
700 Ga0436364_0748887
701 Ga0436364_1425500
702 Ga0436365_0711553
703 Ga0436365_1193747
704 Ga0439443_002420
705 Ga0439448_0024973
706 Ga0439446_0055878
707 Ga0439435_0014476
708 Ga0439459_0019144
709 Ga0439464_0023834
710 Ga0495580_0144213
711 Ga0495639_0031436
712 Ga0495664_0039244
713 Ga0495608_0002687
714 Ga0495610_0027343
715 Ga0495616_0022059
716 Ga0495618_0063818
717 Ga0495628_0029946
718 Ga0495648_0117583
719 Ga0495652_0045998
720 Ga0495640_0045052
721 Ga0495640_0093095
722 Ga0495586_0046413
723 Ga0495587_0264579
724 Ga0495634_0198551
725 Ga0495625_0007210
726 Ga0495599_0216988
727 Ga0495646_0007226
728 Ga0495671_0156692
729 Ga0495604_0091701
730 Ga0495636_0017603
731 Ga0495676_0203858
732 Ga0495614_0196335
733 Ga0496100_0048437
734 Ga0496100_0074890
735 Ga0496101_0109709
736 Ga0496101_0215397
737 Ga0496102_0069408
738 Ga0496104_0002590
739 Ga0496104_0002721
740 Ga0496105_0005232
741 Ga0496105_0006735
742 Ga0496105_0082600
743 Ga0496106_0056899
744 Ga0496106_0534216
745 Ga0496107_0000113
746 Ga0496107_0093486
747 Ga0496108_0006962
748 Ga0496109_0001214
749 Ga0496109_0015586
750 Ga0496109_0150719
751 Ga0496109_0163706
752 Ga0496109_0491080
753 Ga0496109_0676065
754 Ga0496110_0004773
755 Ga0496110_0143452
756 Ga0496111_0372671
757 Ga0496112_0017214
758 Ga0496112_0022133
759 Ga0496112_0041410
760 Ga0496112_0275648
761 Ga0496113_0012455
762 Ga0496113_0087099
763 Ga0496113_0139411
764 Ga0496113_0150846
765 Ga0496113_0235901
766 Ga0496114_0084639
767 Ga0496114_0365792
768 Ga0496115_0012492
769 Ga0496115_0040379
770 Ga0496115_0087944
771 Ga0496115_0215674
772 Ga0496117_0073633
773 Ga0496121_0005698
774 Ga0496126_0182316
775 Ga0496126_0219323
776 Ga0501032_0014331
777 Ga0501033_0063762
778 Ga0501034_0000135
779 Ga0501034_0000270
780 Ga0501034_0100791
781 Ga0501034_0195951
782 Ga0501034_0255894
783 Ga0501036_0024635
784 Ga0501036_0240358
785 Ga0501037_0004347
786 Ga0501037_0147911
787 Ga0501038_0174742
788 Ga0501039_0009281
789 Ga0501039_0303333
790 Ga0501042_0177001
791 Ga0501043_0041495
792 Ga0501046_0004523
793 Ga0501046_0120196
794 Ga0501046_0384706
795 Ga0501047_0000897
796 Ga0501047_0047910
797 Ga0501047_0157437
798 Ga0501047_0164992
799 Ga0501048_0001944
800 Ga0501048_0308581
801 Ga0501067_0003149
802 Ga0501067_0003996
803 Ga0501067_0059125
804 Ga0501069_0264605
805 Ga0501070_0011589
806 Ga0501070_0097041
807 Ga0501072_0004449
808 Ga0501072_0209065
809 Ga0501072_0225035
810 Ga0501072_0351981
811 Ga0501073_0097807
812 Ga0501073_0292007
813 Ga0501074_0062831
814 Ga0501074_0146685
815 Ga0501074_0326675
816 Ga0501075_0024664
817 Ga0501076_0324637
818 Ga0501080_0000298
819 Ga0501080_0020925
820 Ga0501083_0091067
821 Ga0501083_0104555
822 Ga0501083_0121289
823 Ga0501035_0000056
824 Ga0501035_0109589
825 Ga0501044_0000536
826 Ga0501044_0021512
827 Ga0501044_0023120
828 Ga0501044_0044186
829 Ga0501044_0119365
830 Ga0501044_0174218
831 Ga0501044_0213153
832 nmdc:mga00v17_137096_c1
833 nmdc:mga0k408_7684_c1
834 nmdc:mga0k408_87526_c1
835 nmdc:mga0k408_88421_c1
836 nmdc:mga04h51_85176_c1
837 nmdc:mga05p37_135327_c1
838 nmdc:mga05p37_260892_c1
839 nmdc:mga05p37_292545_c1
840 nmdc:mga05p37_390003_c1
841 nmdc:mga09592_11541_c1
842 nmdc:mga09592_160673_c1
843 nmdc:mga09592_77695_c1
844 nmdc:mga0qj67_175087_c1
845 nmdc:mga06r32_11653_c1
846 nmdc:mga06r32_844505_c1
847 nmdc:mga08y16_135393_c1
848 nmdc:mga0sz30_14638_c1
849 nmdc:mga0sz30_86222_c1
850 Ga0495601_0028534
851 Ga0495601_0041854
852 Ga0495601_0115899
853 Ga0495612_0059260
854 Ga0495595_0026807
855 Ga0495619_0077387
856 Ga0495619_0298214
857 Ga0500644_0000902
858 Ga0500651_0007243
859 Ga0500556_0068677
860 Ga0500572_001509
861 Ga0500658_0152624
862 Ga0500559_0002528
863 Ga0500568_0045522
864 Ga0500616_0000001
865 Ga0500616_0004374
866 Ga0500616_0163840
867 Ga0500636_0009740
868 Ga0501084_0074154
869 Ga0501084_0431139
870 Ga0501082_0000428
871 Ga0501082_0013311
872 Ga0501082_0045327
873 Ga0501082_0116509
874 Ga0501082_0371919
875 Ga0530510_0058269
876 2509079172
877 2509146412
878 2596377158
879 2643757776
880 2738746365
881 2739355595
882 2774869304
883 2776257851
884 2842697721
885 2843746453
886 2882457328
887 2884301603
888 2889308319
889 2902334644
890 2902405740
891 2919452151
892 2928125088
893 3003671181
894 8001845830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03476

MOSC_N

MOSC N-terminal beta barrel domain

52

165

0.91

PF03473

MOSC

MOSC domain

180

302

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gkc-assembly1.cif.gz_D atomic model of the core modifying region of human fatty acid synthase in complex with tvb-2640 - c2 refinement 0.962 76 100
5uwv-assembly2.cif.gz_A crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8449 75 99
5uwv-assembly1.cif.gz_B crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8298 76 99
5uwv-assembly3.cif.gz_D crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8223 75 99
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.8116 144 257
ID Description Score Start End Superfamily
af_K7MS34_6_147_1.20.1250.40 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;RNA Polymerase II, Rpb4 subunit 0.9328 78 102 1.20.1250.40
af_P25574_24_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9036 75 99 3.40.50.150
af_O45757_16_158_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8865 75 100 2.40.128.630
af_Q58EJ9_194_321_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8817 134 254 2.40.33.20
af_P75863_136_262_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8786 144 254 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A1W6ZLX5-F1-model_v4 MOSC domain-containing protein 0.9953 7 256 GO:0003824
GO:0030151
GO:0030170
AF-A0A0S6UMC9-F1-model_v4 MOSC domain-containing protein 0.9926 7 258 GO:0003824
GO:0030151
GO:0030170
AF-A0A545T7M7-F1-model_v4 MOSC domain-containing protein 0.9908 5 253 GO:0003824
GO:0030151
GO:0030170
AF-A0A496WB36-F1-model_v4 MOSC domain-containing protein 0.9897 7 253 GO:0003824
GO:0030151
GO:0030170
AF-A0A847JEQ9-F1-model_v4 MOSC domain-containing protein 0.9886 5 254 GO:0003824
GO:0030151
GO:0030170

Map