F445996

General Info

Members Datasets Scaffolds Average Seq Length
447 228 894 215

Family's Representative Sequence

Representative Sequence 3300042137|Ga0450902_013963|Ga0450902_013963_287_1012
Length 241
Sequence VSFHQVTAGAGGYILDINHHPKHYEDLMSQPAITLWSDADYYSPYVMSVYVALAEKGLPFTLKTVDLSRGENRQPHWRGYALTRRVPVLENDGFELSESSAITEYLEEHFAPPEWERIYPLDLQKRARARQIQAWLRSDLVPIREERSTDVLFGGVKKPALSETAQRAANQLYDIAASLLAHGQQNLFGEWCIADADLALMLNRLVLNGDDVPQQLVDYANFQWQRASVQRYVALSAKRAG

Samples

Sample ID Description Type Environment
1 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
12 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
13 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
14 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
27 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
28 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
29 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
30 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
33 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
40 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
44 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
45 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
46 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
47 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
48 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
49 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
50 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
51 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
52 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
53 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
54 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
55 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
56 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
57 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
58 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
59 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
60 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
61 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
62 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
63 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
64 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
67 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
68 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
69 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
70 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
71 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
72 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
73 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
74 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
75 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
76 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
77 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
78 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
82 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
85 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
86 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
87 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
88 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
89 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
90 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
91 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
92 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
101 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
112 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
113 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
123 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
124 2547132181 Kosakonia sacchari SP1 Isolate Stem
125 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
126 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
127 2561511199 Enterobacter sp. R4-368 Isolate Nodule
128 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
129 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
130 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
131 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
132 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
133 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
134 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
135 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
136 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
137 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
138 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
139 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
140 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
141 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
142 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
143 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
144 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
145 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
146 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
147 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
148 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
149 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
150 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
151 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
152 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
153 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
154 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
155 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
156 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
157 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
158 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
159 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
160 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
161 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
162 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
163 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
164 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
165 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
166 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
167 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
168 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
169 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
170 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
171 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
172 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
173 2636415599 Klebsiella variicola DX120E Isolate Unclassified
174 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
175 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
176 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
177 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
178 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
179 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
180 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
181 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
182 2751185917 Enterobacter sp. HK169 Isolate Unclassified
183 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
184 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
185 2775507074 Klebsiella sp. D5A Isolate Unclassified
186 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
187 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
188 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
189 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
190 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
191 2821118458 Enterobacter asburiae 609 Isolate Unclassified
192 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
193 2842711865 Duganella sp. R-73148 Isolate Unclassified
194 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
195 2847085930 Erwinia persicina B64 Isolate Bulb
196 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
197 2857558681 Duganella sp. R-74565 Isolate Unclassified
198 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
199 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
200 2904424332 Duganella sp. 1411 Isolate Rhizosphere
201 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
202 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
203 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
204 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
205 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
206 2937539931 Pantoea sp. LS15 Isolate Unclassified
207 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
208 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
209 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
210 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
211 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
212 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
213 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
214 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
215 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
216 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
217 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
218 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
219 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
220 8018221730 Enterobacter sp. CM29 Isolate Unclassified
221 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
222 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
223 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
224 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
225 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
226 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
227 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
228 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.51
Metatranscriptomes 0
Isolates 23.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.89
Bulb 0.22
Endosphere 2.24
Nodule 4.47
Rhizoplane 14.09
Rhizosphere 51.45
Stem 0.22
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450902_013963 3300042137 Bacteria 1296
2 SwRhRL2b_contig_1017782 2162886007 Bacteria 2465
3 SwRhRL2b_contig_2252951 2162886007 Bacteria 1901
4 SwRhRL2b_contig_473070 2162886007 Bacteria 1707
5 SwRhRL2b_contig_98231 2162886007 Bacteria 10186
6 rootH2_10007066 3300003320 Bacteria 12857
7 rootH1_10178714 3300003323 Bacteria 2313
8 Ga0058692_1001061 3300003856 Bacteria 10755
9 Ga0058692_1001737 3300003856 Bacteria 7760
10 Ga0058692_1004432 3300003856 Bacteria 4162
11 Ga0065704_10000626 3300005289 Bacteria 28367
12 Ga0065704_10001208 3300005289 Bacteria 10125
13 Ga0065704_10001715 3300005289 Bacteria 13685
14 Ga0065704_10003744 3300005289 Bacteria 7320
15 Ga0065704_10003798 3300005289 Bacteria 8029
16 Ga0070665_100000374 3300005548 Bacteria 66650
17 Ga0070665_100640017 3300005548 Bacteria 1076
18 Ga0068857_100000051 3300005577 Bacteria 64784
19 Ga0068851_10307454 3300005834 Bacteria 913
20 Ga0075364_10011286 3300006051 Bacteria 5425
21 Ga0075364_10065187 3300006051 Bacteria 2391
22 Ga0075366_10000865 3300006195 Bacteria 14607
23 Ga0075430_100001367 3300006846 Bacteria 19770
24 Ga0075429_100000185 3300006880 Bacteria 40806
25 Ga0075429_100111422 3300006880 Bacteria 2392
26 Ga0079104_1000120 3300006946 Bacteria 111969
27 Ga0079104_1000135 3300006946 Bacteria 103632
28 Ga0079104_1000376 3300006946 Bacteria 52544
29 Ga0079104_1000924 3300006946 Bacteria 23553
30 Ga0079104_1001604 3300006946 Bacteria 14742
31 Ga0079104_1002457 3300006946 Bacteria 9970
32 Ga0079104_1002896 3300006946 Bacteria 8559
33 Ga0079104_1002917 3300006946 Bacteria 8505
34 Ga0079104_1006754 3300006946 Bacteria 4269
35 Ga0105251_10000500 3300009011 Bacteria 37162
36 Ga0105251_10001461 3300009011 Bacteria 20298
37 Ga0105251_10003723 3300009011 Bacteria 10919
38 Ga0105251_10004551 3300009011 Bacteria 9388
39 Ga0105251_10009279 3300009011 Bacteria 5826
40 Ga0105251_10022739 3300009011 Bacteria 3249
41 Ga0105251_10032422 3300009011 Bacteria 2604
42 Ga0105251_10036922 3300009011 Bacteria 2400
43 Ga0105251_10038657 3300009011 Bacteria 2337
44 Ga0105244_10000224 3300009036 Bacteria 58869
45 Ga0105244_10000246 3300009036 Bacteria 55589
46 Ga0105244_10000342 3300009036 Bacteria 43837
47 Ga0105244_10000345 3300009036 Bacteria 43661
48 Ga0105244_10002257 3300009036 Bacteria 14667
49 Ga0105244_10003320 3300009036 Bacteria 11582
50 Ga0105244_10008965 3300009036 Bacteria 6191
51 Ga0105244_10015356 3300009036 Bacteria 4393
52 Ga0105244_10019239 3300009036 Bacteria 3819
53 Ga0105244_10020882 3300009036 Bacteria 3630
54 Ga0105250_10000018 3300009092 Bacteria 246692
55 Ga0105250_10000080 3300009092 Bacteria 83436
56 Ga0105250_10001624 3300009092 Bacteria 12013
57 Ga0105250_10008330 3300009092 Bacteria 4410
58 Ga0105250_10009721 3300009092 Bacteria 4039
59 Ga0111539_10001779 3300009094 Bacteria 28638
60 Ga0114129_10002425 3300009147 Bacteria 25865
61 Ga0105243_10026875 3300009148 Bacteria 4408
62 Ga0105243_10106724 3300009148 Bacteria 2335
63 Ga0157373_10210219 3300013100 Bacteria 1372
64 Ga0157371_10002183 3300013102 Bacteria 18996
65 Ga0157371_10022211 3300013102 Bacteria 4653
66 Ga0157371_10024571 3300013102 Bacteria 4397
67 Ga0157370_10002468 3300013104 Bacteria 22309
68 Ga0157370_10002604 3300013104 Bacteria 21687
69 Ga0157370_10332021 3300013104 Bacteria 1402
70 Ga0157369_10252560 3300013105 Bacteria 1840
71 Ga0157372_10024224 3300013307 Bacteria 6589
72 Ga0182006_1000024 3300015261 Bacteria 257431
73 Ga0183366_1001 3300015679 Bacteria 2743932
74 Ga0183370_1001 3300015680 Bacteria 2743932
75 Ga0183369_1001 3300015685 Bacteria 2743932
76 Ga0183368_1001 3300015687 Bacteria 2743932
77 Ga0213876_10000023 3300021384 Bacteria 255370
78 Ga0209646_1000042 3300025246 Bacteria 343923
79 Ga0207656_10054516 3300025321 Bacteria 1738
80 Ga0207696_1000013 3300025711 Bacteria 524881
81 Ga0207696_1000067 3300025711 Bacteria 228478
82 Ga0207696_1000100 3300025711 Bacteria 171029
83 Ga0207696_1000275 3300025711 Bacteria 61367
84 Ga0207696_1011648 3300025711 Bacteria 3154
85 Ga0207655_1000002 3300025728 Bacteria 1148694
86 Ga0207655_1000004 3300025728 Bacteria 1021221
87 Ga0207655_1000062 3300025728 Bacteria 258054
88 Ga0207655_1000115 3300025728 Bacteria 162114
89 Ga0207655_1002880 3300025728 Bacteria 13283
90 Ga0207655_1003541 3300025728 Bacteria 11568
91 Ga0207655_1006675 3300025728 Bacteria 7604
92 Ga0207655_1008269 3300025728 Bacteria 6624
93 Ga0207655_1009295 3300025728 Bacteria 6121
94 Ga0207655_1015482 3300025728 Bacteria 4232
95 Ga0207655_1022675 3300025728 Bacteria 3137
96 Ga0207713_1000023 3300025735 Bacteria 346097
97 Ga0207713_1000083 3300025735 Bacteria 160973
98 Ga0207713_1000241 3300025735 Bacteria 72891
99 Ga0207713_1006788 3300025735 Bacteria 6907
100 Ga0207713_1007198 3300025735 Bacteria 6629
101 Ga0207713_1013673 3300025735 Bacteria 4262
102 Ga0207713_1021304 3300025735 Bacteria 3110
103 Ga0207713_1031486 3300025735 Bacteria 2343
104 Ga0207713_1073867 3300025735 Bacteria 1250
105 Ga0207709_10051999 3300025935 Bacteria 2513
106 Ga0207709_10071527 3300025935 Bacteria 2203
107 Ga0207674_10000718 3300026116 Bacteria 43315
108 Ga0209281_1000004 3300027111 Bacteria 1253949
109 Ga0209281_1000014 3300027111 Bacteria 643021
110 Ga0209281_1000095 3300027111 Bacteria 238108
111 Ga0209281_1000219 3300027111 Bacteria 123456
112 Ga0209281_1000286 3300027111 Bacteria 94163
113 Ga0209281_1000404 3300027111 Bacteria 65885
114 Ga0209281_1000523 3300027111 Bacteria 49786
115 Ga0209281_1001128 3300027111 Bacteria 19077
116 Ga0209281_1001350 3300027111 Bacteria 15224
117 Ga0209281_1002868 3300027111 Bacteria 6285
118 Ga0209371_1000001 3300027312 Bacteria 2771503
119 Ga0209371_1000108 3300027312 Bacteria 141822
120 Ga0209371_1000623 3300027312 Bacteria 31527
121 Ga0209371_1001182 3300027312 Bacteria 19031
122 Ga0209371_1002404 3300027312 Bacteria 10524
123 Ga0209371_1004980 3300027312 Bacteria 5496
124 Ga0207428_10005938 3300027907 Bacteria 11304
125 Ga0268266_10000922 3300028379 Bacteria 37700
126 Ga0268256_1000001 3300030500 Bacteria 2771065
127 Ga0268256_1000076 3300030500 Bacteria 178295
128 Ga0268256_1001000 3300030500 Bacteria 19177
129 Ga0268256_1001133 3300030500 Bacteria 17275
130 Ga0268256_1002230 3300030500 Bacteria 10184
131 Ga0268256_1004793 3300030500 Bacteria 5496
132 Ga0316181_1285683 3300030744 Bacteria 1695
133 Ga0265314_10021178 3300031711 Bacteria 5006
134 Ga0436365_0965775 3300039437 Bacteria 470291
135 Ga0439438_001485 3300041405 Bacteria 10329
136 Ga0439447_008122 3300041407 Bacteria 3272
137 Ga0451839_0262217 3300041496 Bacteria 679
138 Ga0451841_0183691 3300041498 Bacteria 1123
139 Ga0451853_0450677 3300041512 Bacteria 1745
140 Ga0451853_3384693 3300041512 Bacteria 994
141 Ga0451853_3620304 3300041512 Bacteria 2767
142 Ga0439432_013474 3300042006 Bacteria 2781
143 Ga0439432_014070 3300042006 Bacteria 2711
144 Ga0439432_025009 3300042006 Bacteria 1960
145 Ga0439452_000002 3300042010 Bacteria 1377577
146 Ga0439452_000015 3300042010 Bacteria 342948
147 Ga0439452_000193 3300042010 Bacteria 44853
148 Ga0439452_000587 3300042010 Bacteria 18815
149 Ga0439452_001697 3300042010 Bacteria 8655
150 Ga0450905_032496 3300042142 Bacteria 809
151 Ga0439464_0002228 3300042439 Bacteria 4740
152 Ga0466981_0000013 3300044669 Bacteria 129274
153 Ga0495591_001110 3300046458 Bacteria 17810
154 Ga0495591_005209 3300046458 Bacteria 6087
155 Ga0495638_0023217 3300046460 Bacteria 4061
156 Ga0495641_0328299 3300046461 Bacteria 691
157 Ga0495650_0000047 3300046471 Bacteria 335136
158 Ga0495650_0000868 3300046471 Bacteria 35989
159 Ga0495650_0011332 3300046471 Bacteria 4895
160 Ga0495639_0006284 3300046475 Bacteria 5102
161 Ga0495584_0061590 3300046491 Bacteria 1886
162 Ga0495584_0062690 3300046491 Bacteria 1868
163 Ga0495607_0001661 3300046501 Bacteria 19243
164 Ga0495583_0000092 3300046506 Bacteria 158865
165 Ga0495606_0000716 3300046507 Bacteria 51314
166 Ga0495606_0000814 3300046507 Bacteria 47442
167 Ga0495606_0000830 3300046507 Bacteria 46705
168 Ga0495606_0002424 3300046507 Bacteria 21736
169 Ga0495610_0001624 3300046512 Bacteria 19773
170 Ga0495610_0003868 3300046512 Bacteria 11377
171 Ga0495610_0009788 3300046512 Bacteria 6019
172 Ga0495616_0017380 3300046513 Bacteria 3968
173 Ga0495620_0021461 3300046515 Bacteria 3135
174 Ga0495637_0001917 3300046520 Bacteria 11822
175 Ga0495643_0000237 3300046522 Bacteria 82853
176 Ga0495644_0115345 3300046523 Bacteria 1020
177 Ga0495648_0000019 3300046524 Bacteria 276407
178 Ga0495648_0009931 3300046524 Bacteria 7305
179 Ga0495648_0022178 3300046524 Bacteria 4378
180 Ga0495642_0002402 3300046528 Bacteria 7623
181 Ga0495654_0011239 3300046530 Bacteria 4855
182 Ga0495654_0041295 3300046530 Bacteria 2294
183 Ga0495654_0074047 3300046530 Bacteria 1609
184 Ga0495609_0007631 3300046538 Bacteria 5376
185 Ga0495597_0000075 3300046542 Bacteria 86570
186 Ga0495597_0000081 3300046542 Bacteria 84083
187 Ga0495597_0007488 3300046542 Bacteria 5537
188 Ga0495622_0000019 3300046557 Bacteria 169931
189 Ga0495622_0000037 3300046557 Bacteria 119690
190 Ga0495633_0000086 3300046558 Bacteria 124357
191 Ga0495633_0000297 3300046558 Bacteria 56662
192 Ga0495633_0003571 3300046558 Bacteria 10282
193 Ga0495633_0041583 3300046558 Bacteria 2185
194 Ga0495668_0001041 3300046616 Bacteria 29392
195 Ga0495625_0000208 3300046660 Bacteria 93861
196 Ga0495625_0009061 3300046660 Bacteria 8399
197 Ga0495625_0022128 3300046660 Bacteria 4879
198 Ga0495625_0366865 3300046660 Bacteria 906
199 Ga0495646_0006004 3300046680 Bacteria 7698
200 Ga0495671_0004775 3300046692 Bacteria 8010
201 Ga0495671_0019519 3300046692 Bacteria 3582
202 Ga0495671_0043352 3300046692 Bacteria 2258
203 Ga0495671_0306317 3300046692 Bacteria 764
204 Ga0495649_0000544 3300046694 Bacteria 31980
205 Ga0495649_0011506 3300046694 Bacteria 5185
206 Ga0495649_0028145 3300046694 Bacteria 3115
207 Ga0495649_0054642 3300046694 Bacteria 2158
208 Ga0495649_0155978 3300046694 Bacteria 1198
209 Ga0495589_0013727 3300046794 Bacteria 4178
210 Ga0495660_0000017 3300046810 Bacteria 320655
211 Ga0495660_0029209 3300046810 Bacteria 3112
212 Ga0495672_0000001 3300047320 Bacteria 1458820
213 Ga0495672_0000009 3300047320 Bacteria 557755
214 Ga0495672_0000226 3300047320 Bacteria 80307
215 Ga0495683_0018311 3300047323 Bacteria 3622
216 Ga0495687_005712 3300047443 Bacteria 7836
217 Ga0495687_008182 3300047443 Bacteria 6027
218 Ga0495677_0031637 3300047445 Bacteria 1926
219 Ga0495679_000032 3300047446 Bacteria 171636
220 Ga0495679_001266 3300047446 Bacteria 14867
221 Ga0495679_030543 3300047446 Bacteria 1747
222 Ga0495673_0000008 3300047469 Bacteria 752462
223 Ga0495673_0000019 3300047469 Bacteria 554389
224 Ga0495673_0000071 3300047469 Bacteria 217117
225 Ga0495686_0239135 3300047472 Bacteria 1025
226 Ga0496100_0125875 3300048903 Bacteria 1798
227 Ga0496101_0021797 3300048904 Bacteria 4402
228 Ga0496101_0032250 3300048904 Bacteria 3686
229 Ga0496103_0001949 3300048906 Bacteria 13341
230 Ga0496104_0000212 3300048907 Bacteria 51443
231 Ga0496104_0019497 3300048907 Bacteria 6207
232 Ga0496104_0249157 3300048907 Bacteria 1689
233 Ga0496105_0197338 3300048908 Bacteria 1644
234 Ga0496105_0243365 3300048908 Bacteria 1459
235 Ga0496112_0336959 3300048915 Bacteria 1452
236 Ga0496114_0222195 3300048917 Bacteria 1658
237 Ga0496116_0000420 3300048919 Bacteria 59988
238 Ga0496116_0000426 3300048919 Bacteria 59252
239 Ga0496116_0002675 3300048919 Bacteria 18433
240 Ga0496116_0012361 3300048919 Bacteria 6979
241 Ga0496116_0114426 3300048919 Bacteria 1576
242 Ga0496116_0153728 3300048919 Bacteria 1273
243 Ga0496117_0000504 3300048920 Bacteria 64550
244 Ga0496117_0003051 3300048920 Bacteria 20074
245 Ga0496117_0005295 3300048920 Bacteria 13658
246 Ga0496117_0008178 3300048920 Bacteria 9984
247 Ga0496117_0018621 3300048920 Bacteria 5741
248 Ga0496117_0075472 3300048920 Bacteria 2240
249 Ga0496117_0087260 3300048920 Bacteria 2023
250 Ga0496117_0132765 3300048920 Bacteria 1506
251 Ga0496118_0003350 3300048921 Bacteria 20288
252 Ga0496118_0003406 3300048921 Bacteria 20099
253 Ga0496118_0011035 3300048921 Bacteria 8871
254 Ga0496118_0019718 3300048921 Bacteria 6015
255 Ga0496118_0035336 3300048921 Bacteria 4059
256 Ga0496119_0002761 3300048922 Bacteria 18891
257 Ga0496119_0002838 3300048922 Bacteria 18518
258 Ga0496119_0005106 3300048922 Bacteria 12738
259 Ga0496119_0018205 3300048922 Bacteria 5244
260 Ga0496119_0046620 3300048922 Bacteria 2704
261 Ga0496119_0122627 3300048922 Bacteria 1426
262 Ga0496119_0289999 3300048922 Bacteria 810
263 Ga0496120_0000004 3300048923 Bacteria 534793
264 Ga0496120_0000081 3300048923 Bacteria 158294
265 Ga0496120_0002912 3300048923 Bacteria 16349
266 Ga0496120_0003697 3300048923 Bacteria 13640
267 Ga0496120_0010147 3300048923 Bacteria 6597
268 Ga0496120_0023046 3300048923 Bacteria 3903
269 Ga0496120_0031523 3300048923 Bacteria 3208
270 Ga0496120_0163457 3300048923 Bacteria 1107
271 Ga0496121_0003862 3300048924 Bacteria 20835
272 Ga0496121_0005395 3300048924 Bacteria 16422
273 Ga0496121_0007719 3300048924 Bacteria 12905
274 Ga0496121_0009627 3300048924 Bacteria 11067
275 Ga0496121_0017592 3300048924 Bacteria 7285
276 Ga0496121_0023854 3300048924 Bacteria 5871
277 Ga0496121_0034611 3300048924 Bacteria 4544
278 Ga0496121_0059274 3300048924 Bacteria 3157
279 Ga0496121_0445715 3300048924 Bacteria 835
280 Ga0496122_0000003 3300048925 Bacteria 645810
281 Ga0496122_0000803 3300048925 Bacteria 60232
282 Ga0496122_0001758 3300048925 Bacteria 33261
283 Ga0496122_0013923 3300048925 Bacteria 7821
284 Ga0496122_0018767 3300048925 Bacteria 6362
285 Ga0496122_0029477 3300048925 Bacteria 4627
286 Ga0496122_0045575 3300048925 Bacteria 3407
287 Ga0496122_0133857 3300048925 Bacteria 1567
288 Ga0496123_0000012 3300048926 Bacteria 458760
289 Ga0496123_0000140 3300048926 Bacteria 147707
290 Ga0496123_0001176 3300048926 Bacteria 38560
291 Ga0496123_0004309 3300048926 Bacteria 15101
292 Ga0496123_0007141 3300048926 Bacteria 10611
293 Ga0496123_0008748 3300048926 Bacteria 9241
294 Ga0496123_0027952 3300048926 Bacteria 4186
295 Ga0496123_0030531 3300048926 Bacteria 3943
296 Ga0496123_0034024 3300048926 Bacteria 3658
297 Ga0496123_0046876 3300048926 Bacteria 2926
298 Ga0496123_0065410 3300048926 Bacteria 2311
299 Ga0496123_0146056 3300048926 Bacteria 1284
300 Ga0496123_0152983 3300048926 Bacteria 1241
301 Ga0496124_0001085 3300048927 Bacteria 42903
302 Ga0496124_0008966 3300048927 Bacteria 10353
303 Ga0496124_0009980 3300048927 Bacteria 9698
304 Ga0496124_0029149 3300048927 Bacteria 4923
305 Ga0496124_0044720 3300048927 Bacteria 3798
306 Ga0496124_0074933 3300048927 Bacteria 2796
307 Ga0496124_0129320 3300048927 Bacteria 2008
308 Ga0496124_0132378 3300048927 Bacteria 1979
309 Ga0496124_0293520 3300048927 Bacteria 1178
310 Ga0496124_0482438 3300048927 Bacteria 836
311 Ga0496125_0000296 3300048928 Bacteria 98054
312 Ga0496125_0009095 3300048928 Bacteria 10276
313 Ga0496125_0010803 3300048928 Bacteria 9193
314 Ga0496125_0029056 3300048928 Bacteria 4977
315 Ga0496125_0050755 3300048928 Bacteria 3430
316 Ga0496125_0055768 3300048928 Bacteria 3215
317 Ga0496125_0107893 3300048928 Bacteria 2027
318 Ga0496126_0004913 3300048929 Bacteria 15604
319 Ga0496126_0040360 3300048929 Bacteria 4326
320 Ga0496126_0063948 3300048929 Bacteria 3296
321 Ga0496126_0176900 3300048929 Bacteria 1814
322 Ga0496126_0218736 3300048929 Bacteria 1601
323 Ga0496126_1043400 3300048929 Bacteria 611
324 Ga0495678_000307 3300049459 Bacteria 52855
325 Ga0495678_002059 3300049459 Bacteria 14366
326 Ga0495678_003130 3300049459 Bacteria 10465
327 Ga0495678_040985 3300049459 Bacteria 1856
328 Ga0495682_0000164 3300049460 Bacteria 55956
329 Ga0501269_000054 3300049766 Bacteria 35436
330 nmdc:mga03n38_82018_c1 3300050490 Bacteria 1517
331 nmdc:mga00v17_15546_c1 3300050491 Bacteria 4272
332 nmdc:mga00v17_56669_c1 3300050491 Bacteria 2396
333 nmdc:mga00v17_60994_c1 3300050491 Bacteria 2318
334 nmdc:mga0k408_2537_c1 3300050493 Bacteria 9704
335 nmdc:mga05p37_68437_c1 3300050507 Unclassified 4366
336 nmdc:mga09592_153922_c1 3300050508 Unclassified 1984
337 nmdc:mga09592_1739_c1 3300050508 Bacteria 17526
338 nmdc:mga0qj67_6083_c1 3300050509 Bacteria 8841
339 nmdc:mga06r32_79325_c1 3300050510 Unclassified 3194
340 nmdc:mga08y16_574_c1 3300050511 Bacteria 34234
341 Ga0500610_0033245 3300053079 Bacteria 2630
342 Ga0500621_000005 3300053126 Bacteria 320383
343 2547697329 2547132181 Bacteria 4945084
344 2548648477 2547132416 Bacteria 4633861
345 2555259874 2554235234 Bacteria 5762085
346 2562463616 2561511199 Bacteria 5155034
347 2599411245 2599185169 Bacteria 5441380
348 2599926533 2599185299 Bacteria 4854625
349 2601524240 2600255254 Bacteria 5281859
350 2601529394 2600255255 Bacteria 5282785
351 2601535525 2600255256 Bacteria 5597742
352 2601540082 2600255257 Bacteria 5597196
353 2601616228 2600255280 Bacteria 5292309
354 2601620950 2600255281 Bacteria 5288753
355 2601644297 2600255287 Bacteria 5210468
356 2601649347 2600255288 Bacteria 5282738
357 2601654274 2600255289 Bacteria 5281907
358 2601659696 2600255290 Bacteria 5282218
359 2601664119 2600255291 Bacteria 5217298
360 2601697079 2600255298 Bacteria 5215185
361 2601702125 2600255299 Bacteria 5218662
362 2601707018 2600255300 Bacteria 5287774
363 2601712030 2600255301 Bacteria 5280532
364 2601717535 2600255302 Bacteria 5288235
365 2601722195 2600255303 Bacteria 5219315
366 2601727463 2600255304 Bacteria 5283973
367 2601732472 2600255305 Bacteria 5282329
368 2601737013 2600255306 Bacteria 5281613
369 2601741295 2600255307 Bacteria 5439064
370 2601752451 2600255309 Bacteria 5431045
371 2601758705 2600255310 Bacteria 5600903
372 2601764819 2600255311 Bacteria 5598766
373 2602019292 2600255392 Bacteria 5437392
374 2603636861 2602042046 Bacteria 5483348
375 2603645385 2602042047 Bacteria 4697674
376 2603662282 2602042052 Bacteria 5215873
377 2603667178 2602042053 Bacteria 5214361
378 2603699359 2602042066 Bacteria 4423871
379 2603705388 2602042067 Bacteria 4863713
380 2603839887 2602042103 Bacteria 5284714
381 2603844964 2602042104 Bacteria 5281639
382 2603850032 2602042105 Bacteria 5282303
383 2603855105 2602042106 Bacteria 5282744
384 2603867922 2602042109 Bacteria 5152801
385 2603872685 2602042110 Bacteria 5283285
386 2603877989 2602042111 Bacteria 5212080
387 2606049858 2603880178 Bacteria 5283018
388 2606071518 2603880184 Bacteria 5217896
389 2606147549 2603880202 Bacteria 5284684
390 2606177747 2603880211 Bacteria 5284226
391 2609909641 2609459761 Bacteria 5513740
392 2637224062 2636415599 Bacteria 5718434
393 2650895773 2648501693 Bacteria 5069560
394 2671101101 2667528172 Bacteria 5170840
395 2671584526 2671180115 Bacteria 5353919
396 2676405470 2675903046 Bacteria 5451247
397 2681996203 2681812866 Bacteria 4552357
398 2682006461 2681812869 Bacteria 5014465
399 2686354186 2684622997 Bacteria 4624240
400 2712468865 2711768156 Bacteria 4471618
401 2753856935 2751185917 Bacteria 4551186
402 2765590040 2765235842 Bacteria 4799256
403 2775541288 2775506706 Bacteria 4873073
404 2777020965 2775507074 Bacteria 5532402
405 2792312002 2791355010 Bacteria 4864581
406 2793404722 2791355275 Bacteria 4429597
407 2809125216 2808606414 Bacteria 4917181
408 2813727871 2811995292 Bacteria 5303342
409 2814695414 2814123068 Bacteria 5687681
410 2821121059 2821118458 Bacteria 4714306
411 2823375693 2823373977 Bacteria 4779415
412 2842715735 2842711865 Bacteria 7155354
413 2844428384 2844425489 Bacteria 4854065
414 2847086601 2847085930 Bacteria 5070450
415 2847798953 2847797336 Bacteria 5176640
416 2857558864 2857558681 Bacteria 6617694
417 2884087857 2884086401 Bacteria 5005459
418 2891672359 2891670763 Bacteria 4967099
419 2904428260 2904424332 Bacteria 7633521
420 2904515376 2904513164 Bacteria 5476410
421 2908672451 2908669403 Bacteria 5740494
422 2919110990 2919108558 Bacteria 5897419
423 2923635908 2923634449 Bacteria 4753480
424 2927837594 2927833300 Bacteria 4923934
425 2937542427 2937539931 Bacteria 4639830
426 2939570055 2939568625 Bacteria 4542555
427 2939575375 2939573065 Bacteria 4926053
428 2939608667 2939607340 Bacteria 4719256
429 2939642926 2939642701 Bacteria 4475280
430 2945876829 2945874760 Bacteria 5527237
431 2969081096 2969079654 Bacteria 5439582
432 2971822472 2971820967 Bacteria 5823634
433 2974311072 2974310843 Bacteria 4947816
434 2984497550 2984494565 Bacteria 5000175
435 2984563554 2984559226 Bacteria 5683096
436 2984596288 2984595703 Bacteria 5682994
437 2990261499 2990261002 Bacteria 4919493
438 3000378341 3000376612 Bacteria 4705565
439 8018222487 8018221730 Bacteria 4616064
440 8018409222 8018405270 Bacteria 4978981
441 8054846649 8054844752 Bacteria 4450330
442 8054851990 8054849141 Bacteria 5232694
443 8055092180 8055087960 Bacteria 4784273
444 8055095506 8055092621 Bacteria 4873875
445 8055100216 8055097453 Bacteria 4865496
446 8055696871 8055693939 Bacteria 4772047
447 8057306753 8057304971 Bacteria 4649742
448 Ga0450902_013963
449 SwRhRL2b_contig_1017782
450 SwRhRL2b_contig_2252951
451 SwRhRL2b_contig_473070
452 SwRhRL2b_contig_98231
453 rootH2_10007066
454 rootH1_10178714
455 Ga0058692_1001061
456 Ga0058692_1001737
457 Ga0058692_1004432
458 Ga0065704_10000626
459 Ga0065704_10001208
460 Ga0065704_10001715
461 Ga0065704_10003744
462 Ga0065704_10003798
463 Ga0070665_100000374
464 Ga0070665_100640017
465 Ga0068857_100000051
466 Ga0068851_10307454
467 Ga0075364_10011286
468 Ga0075364_10065187
469 Ga0075366_10000865
470 Ga0075430_100001367
471 Ga0075429_100000185
472 Ga0075429_100111422
473 Ga0079104_1000120
474 Ga0079104_1000135
475 Ga0079104_1000376
476 Ga0079104_1000924
477 Ga0079104_1001604
478 Ga0079104_1002457
479 Ga0079104_1002896
480 Ga0079104_1002917
481 Ga0079104_1006754
482 Ga0105251_10000500
483 Ga0105251_10001461
484 Ga0105251_10003723
485 Ga0105251_10004551
486 Ga0105251_10009279
487 Ga0105251_10022739
488 Ga0105251_10032422
489 Ga0105251_10036922
490 Ga0105251_10038657
491 Ga0105244_10000224
492 Ga0105244_10000246
493 Ga0105244_10000342
494 Ga0105244_10000345
495 Ga0105244_10002257
496 Ga0105244_10003320
497 Ga0105244_10008965
498 Ga0105244_10015356
499 Ga0105244_10019239
500 Ga0105244_10020882
501 Ga0105250_10000018
502 Ga0105250_10000080
503 Ga0105250_10001624
504 Ga0105250_10008330
505 Ga0105250_10009721
506 Ga0111539_10001779
507 Ga0114129_10002425
508 Ga0105243_10026875
509 Ga0105243_10106724
510 Ga0157373_10210219
511 Ga0157371_10002183
512 Ga0157371_10022211
513 Ga0157371_10024571
514 Ga0157370_10002468
515 Ga0157370_10002604
516 Ga0157370_10332021
517 Ga0157369_10252560
518 Ga0157372_10024224
519 Ga0182006_1000024
520 Ga0183366_1001
521 Ga0183370_1001
522 Ga0183369_1001
523 Ga0183368_1001
524 Ga0213876_10000023
525 Ga0209646_1000042
526 Ga0207656_10054516
527 Ga0207696_1000013
528 Ga0207696_1000067
529 Ga0207696_1000100
530 Ga0207696_1000275
531 Ga0207696_1011648
532 Ga0207655_1000002
533 Ga0207655_1000004
534 Ga0207655_1000062
535 Ga0207655_1000115
536 Ga0207655_1002880
537 Ga0207655_1003541
538 Ga0207655_1006675
539 Ga0207655_1008269
540 Ga0207655_1009295
541 Ga0207655_1015482
542 Ga0207655_1022675
543 Ga0207713_1000023
544 Ga0207713_1000083
545 Ga0207713_1000241
546 Ga0207713_1006788
547 Ga0207713_1007198
548 Ga0207713_1013673
549 Ga0207713_1021304
550 Ga0207713_1031486
551 Ga0207713_1073867
552 Ga0207709_10051999
553 Ga0207709_10071527
554 Ga0207674_10000718
555 Ga0209281_1000004
556 Ga0209281_1000014
557 Ga0209281_1000095
558 Ga0209281_1000219
559 Ga0209281_1000286
560 Ga0209281_1000404
561 Ga0209281_1000523
562 Ga0209281_1001128
563 Ga0209281_1001350
564 Ga0209281_1002868
565 Ga0209371_1000001
566 Ga0209371_1000108
567 Ga0209371_1000623
568 Ga0209371_1001182
569 Ga0209371_1002404
570 Ga0209371_1004980
571 Ga0207428_10005938
572 Ga0268266_10000922
573 Ga0268256_1000001
574 Ga0268256_1000076
575 Ga0268256_1001000
576 Ga0268256_1001133
577 Ga0268256_1002230
578 Ga0268256_1004793
579 Ga0316181_1285683
580 Ga0265314_10021178
581 Ga0436365_0965775
582 Ga0439438_001485
583 Ga0439447_008122
584 Ga0451839_0262217
585 Ga0451841_0183691
586 Ga0451853_0450677
587 Ga0451853_3384693
588 Ga0451853_3620304
589 Ga0439432_013474
590 Ga0439432_014070
591 Ga0439432_025009
592 Ga0439452_000002
593 Ga0439452_000015
594 Ga0439452_000193
595 Ga0439452_000587
596 Ga0439452_001697
597 Ga0450905_032496
598 Ga0439464_0002228
599 Ga0466981_0000013
600 Ga0495591_001110
601 Ga0495591_005209
602 Ga0495638_0023217
603 Ga0495641_0328299
604 Ga0495650_0000047
605 Ga0495650_0000868
606 Ga0495650_0011332
607 Ga0495639_0006284
608 Ga0495584_0061590
609 Ga0495584_0062690
610 Ga0495607_0001661
611 Ga0495583_0000092
612 Ga0495606_0000716
613 Ga0495606_0000814
614 Ga0495606_0000830
615 Ga0495606_0002424
616 Ga0495610_0001624
617 Ga0495610_0003868
618 Ga0495610_0009788
619 Ga0495616_0017380
620 Ga0495620_0021461
621 Ga0495637_0001917
622 Ga0495643_0000237
623 Ga0495644_0115345
624 Ga0495648_0000019
625 Ga0495648_0009931
626 Ga0495648_0022178
627 Ga0495642_0002402
628 Ga0495654_0011239
629 Ga0495654_0041295
630 Ga0495654_0074047
631 Ga0495609_0007631
632 Ga0495597_0000075
633 Ga0495597_0000081
634 Ga0495597_0007488
635 Ga0495622_0000019
636 Ga0495622_0000037
637 Ga0495633_0000086
638 Ga0495633_0000297
639 Ga0495633_0003571
640 Ga0495633_0041583
641 Ga0495668_0001041
642 Ga0495625_0000208
643 Ga0495625_0009061
644 Ga0495625_0022128
645 Ga0495625_0366865
646 Ga0495646_0006004
647 Ga0495671_0004775
648 Ga0495671_0019519
649 Ga0495671_0043352
650 Ga0495671_0306317
651 Ga0495649_0000544
652 Ga0495649_0011506
653 Ga0495649_0028145
654 Ga0495649_0054642
655 Ga0495649_0155978
656 Ga0495589_0013727
657 Ga0495660_0000017
658 Ga0495660_0029209
659 Ga0495672_0000001
660 Ga0495672_0000009
661 Ga0495672_0000226
662 Ga0495683_0018311
663 Ga0495687_005712
664 Ga0495687_008182
665 Ga0495677_0031637
666 Ga0495679_000032
667 Ga0495679_001266
668 Ga0495679_030543
669 Ga0495673_0000008
670 Ga0495673_0000019
671 Ga0495673_0000071
672 Ga0495686_0239135
673 Ga0496100_0125875
674 Ga0496101_0021797
675 Ga0496101_0032250
676 Ga0496103_0001949
677 Ga0496104_0000212
678 Ga0496104_0019497
679 Ga0496104_0249157
680 Ga0496105_0197338
681 Ga0496105_0243365
682 Ga0496112_0336959
683 Ga0496114_0222195
684 Ga0496116_0000420
685 Ga0496116_0000426
686 Ga0496116_0002675
687 Ga0496116_0012361
688 Ga0496116_0114426
689 Ga0496116_0153728
690 Ga0496117_0000504
691 Ga0496117_0003051
692 Ga0496117_0005295
693 Ga0496117_0008178
694 Ga0496117_0018621
695 Ga0496117_0075472
696 Ga0496117_0087260
697 Ga0496117_0132765
698 Ga0496118_0003350
699 Ga0496118_0003406
700 Ga0496118_0011035
701 Ga0496118_0019718
702 Ga0496118_0035336
703 Ga0496119_0002761
704 Ga0496119_0002838
705 Ga0496119_0005106
706 Ga0496119_0018205
707 Ga0496119_0046620
708 Ga0496119_0122627
709 Ga0496119_0289999
710 Ga0496120_0000004
711 Ga0496120_0000081
712 Ga0496120_0002912
713 Ga0496120_0003697
714 Ga0496120_0010147
715 Ga0496120_0023046
716 Ga0496120_0031523
717 Ga0496120_0163457
718 Ga0496121_0003862
719 Ga0496121_0005395
720 Ga0496121_0007719
721 Ga0496121_0009627
722 Ga0496121_0017592
723 Ga0496121_0023854
724 Ga0496121_0034611
725 Ga0496121_0059274
726 Ga0496121_0445715
727 Ga0496122_0000003
728 Ga0496122_0000803
729 Ga0496122_0001758
730 Ga0496122_0013923
731 Ga0496122_0018767
732 Ga0496122_0029477
733 Ga0496122_0045575
734 Ga0496122_0133857
735 Ga0496123_0000012
736 Ga0496123_0000140
737 Ga0496123_0001176
738 Ga0496123_0004309
739 Ga0496123_0007141
740 Ga0496123_0008748
741 Ga0496123_0027952
742 Ga0496123_0030531
743 Ga0496123_0034024
744 Ga0496123_0046876
745 Ga0496123_0065410
746 Ga0496123_0146056
747 Ga0496123_0152983
748 Ga0496124_0001085
749 Ga0496124_0008966
750 Ga0496124_0009980
751 Ga0496124_0029149
752 Ga0496124_0044720
753 Ga0496124_0074933
754 Ga0496124_0129320
755 Ga0496124_0132378
756 Ga0496124_0293520
757 Ga0496124_0482438
758 Ga0496125_0000296
759 Ga0496125_0009095
760 Ga0496125_0010803
761 Ga0496125_0029056
762 Ga0496125_0050755
763 Ga0496125_0055768
764 Ga0496125_0107893
765 Ga0496126_0004913
766 Ga0496126_0040360
767 Ga0496126_0063948
768 Ga0496126_0176900
769 Ga0496126_0218736
770 Ga0496126_1043400
771 Ga0495678_000307
772 Ga0495678_002059
773 Ga0495678_003130
774 Ga0495678_040985
775 Ga0495682_0000164
776 Ga0501269_000054
777 nmdc:mga03n38_82018_c1
778 nmdc:mga00v17_15546_c1
779 nmdc:mga00v17_56669_c1
780 nmdc:mga00v17_60994_c1
781 nmdc:mga0k408_2537_c1
782 nmdc:mga05p37_68437_c1
783 nmdc:mga09592_153922_c1
784 nmdc:mga09592_1739_c1
785 nmdc:mga0qj67_6083_c1
786 nmdc:mga06r32_79325_c1
787 nmdc:mga08y16_574_c1
788 Ga0500610_0033245
789 Ga0500621_000005
790 2547697329
791 2548648477
792 2555259874
793 2562463616
794 2599411245
795 2599926533
796 2601524240
797 2601529394
798 2601535525
799 2601540082
800 2601616228
801 2601620950
802 2601644297
803 2601649347
804 2601654274
805 2601659696
806 2601664119
807 2601697079
808 2601702125
809 2601707018
810 2601712030
811 2601717535
812 2601722195
813 2601727463
814 2601732472
815 2601737013
816 2601741295
817 2601752451
818 2601758705
819 2601764819
820 2602019292
821 2603636861
822 2603645385
823 2603662282
824 2603667178
825 2603699359
826 2603705388
827 2603839887
828 2603844964
829 2603850032
830 2603855105
831 2603867922
832 2603872685
833 2603877989
834 2606049858
835 2606071518
836 2606147549
837 2606177747
838 2609909641
839 2637224062
840 2650895773
841 2671101101
842 2671584526
843 2676405470
844 2681996203
845 2682006461
846 2686354186
847 2712468865
848 2753856935
849 2765590040
850 2775541288
851 2777020965
852 2792312002
853 2793404722
854 2809125216
855 2813727871
856 2814695414
857 2821121059
858 2823375693
859 2842715735
860 2844428384
861 2847086601
862 2847798953
863 2857558864
864 2884087857
865 2891672359
866 2904428260
867 2904515376
868 2908672451
869 2919110990
870 2923635908
871 2927837594
872 2937542427
873 2939570055
874 2939575375
875 2939608667
876 2939642926
877 2945876829
878 2969081096
879 2971822472
880 2974311072
881 2984497550
882 2984563554
883 2984596288
884 2990261499
885 3000378341
886 8018222487
887 8018409222
888 8054846649
889 8054851990
890 8055092180
891 8055095506
892 8055100216
893 8055696871
894 8057306753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14834

GST_C_4

Glutathione S-transferase, C-terminal domain

122

238

0.99

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

42

109

0.96

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

31

108

0.92

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

39

114

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbb-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase a6tby7(target efi-507184) from klebsiella pneumoniae mgh 78578, gsh complex 0.9867 15 221
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.9836 16 222
4jbb-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase a6tby7(target efi-507184) from klebsiella pneumoniae mgh 78578, gsh complex 0.9774 15 221
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.9684 16 222
4mp4-assembly1.cif.gz_B crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.9668 17 224
ID Description Score Start End Superfamily
4jbbA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9945 102 210 1.20.1050.10
af_P77544_100_211_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9884 113 222 1.20.1050.10
4jbbA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9855 102 210 1.20.1050.10
4mp4A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9832 17 94 3.40.30.10
af_P77544_4_214_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9811 16 226 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q6GAW1-F1-model_v4 deleted 0.9938 112 218
AF-A0A6D0IPG7-F1-model_v4 Glutathione transferase (EC 2.5.1.18) 0.986 71 226 GO:0004364
AF-A0A2N4W1M6-F1-model_v4 deleted 0.9823 13 226
AF-E7T2K9-F1-model_v4 deleted 0.9812 81 226
AF-A0A6D0IPG7-F1-model_v4 Glutathione transferase (EC 2.5.1.18) 0.9797 71 226 GO:0004364

Map