metagRoot

F446027

General Info

Members	Datasets	Scaffolds	Average Seq Length
447	199	446	273

Family's Representative Sequence

Representative Sequence	3300047320\|Ga0495672_0023546\|Ga0495672_0023546_1667_2590
Length	307
Sequence	LARKITKLPAGTIALIFGRLINCLLLVSANTSAFMVFHEKTVLITGGSRGIGKAIAIRLAKEGANIAIMGKTTEPNPRLDGTIYTAAEEIAKAGPGKVLPLQGDVRFEDSIRHVVQTTVNTFGGIDILINNASAVNLSPTEQTEPKRYDLMQDINVRGSFFMSQACIPFLKKALNPHILNLSPPLSLDPGWFSKHLAYTISKYGMSMVILGLAEELKQHRIAANALWPKTTIATAAVKNLLGGDFLMQRSRIPEIVADAAFYILQKPSFETTGNFFIDEEVLKNEGITDFGKYAVNPDQKLMMDLFL

Samples

	Sample ID	Description	Type	Environment
1	2896109856	Chitinophaga sp. SYP-B3965	Isolate	Rhizosphere
2	2929154850	Filimonas sp. R-72421 Hybrid assembly	Isolate	Unclassified
3	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
4	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
5	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
6	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
7	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
8	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
9	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
10	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
11	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
12	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
13	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
14	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
15	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
16	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
17	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
18	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
19	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
20	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
21	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
22	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
23	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
24	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
25	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
26	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
27	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
28	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
29	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
30	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
31	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
32	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
37	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
38	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
39	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
40	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
41	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
42	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
43	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
44	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
45	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
46	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
47	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
48	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
49	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
50	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
51	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
52	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
53	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
54	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
55	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
56	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
57	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
58	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
59	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
60	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
61	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
62	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
63	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
65	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
67	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
68	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
69	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
70	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
71	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
72	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
73	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
74	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
75	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
76	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
77	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
78	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
79	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
80	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
81	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
82	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
83	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
84	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
85	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
86	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
87	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
88	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
89	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
90	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
91	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
92	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
140	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
141	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
142	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
143	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
144	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
145	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
146	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
147	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
148	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
149	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
150	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
151	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
152	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
153	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
154	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
155	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
156	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
157	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
158	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
159	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
160	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
161	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
162	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
163	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
164	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
165	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
166	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
167	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
168	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
169	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
170	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
171	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
172	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
173	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
174	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
175	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
176	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
177	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
178	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
179	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
180	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
181	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
182	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
183	3300049703	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control	Metagenome	Rhizosphere
184	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
185	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
186	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
187	3300050005	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought	Metagenome	Rhizosphere
188	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
189	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
190	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
191	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
192	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
193	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
194	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
195	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
196	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
197	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
198	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
199	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.55
Metatranscriptomes	0
Isolates	0.45

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.92
Nodule	0
Rhizoplane	0.22
Rhizosphere	89.93
Stem	0
Stem Tuber	0
Unclassified	4.92

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24751J29686_10000798	3300002459	Bacteria	7365
2	rootH1_10052170	3300003316	Bacteria	3070
3	rootH1_10052170	3300003323	Bacteria	1508
4	rootH2_10000442	3300003320	Bacteria	46233
5	rootH2_10000443	3300003320	Bacteria	8126
6	rootH2_10071639	3300003320	Bacteria	10047
7	rootL2_10228479	3300003322	Bacteria	2035
8	Ga0065712_10071092	3300005290	Bacteria	5492
9	Ga0065715_10022834	3300005293	Bacteria	2828
10	Ga0065707_10098123	3300005295	Bacteria	3111
11	Ga0070676_10050801	3300005328	Bacteria	2432
12	Ga0070683_100007666	3300005329	Bacteria	9134
13	Ga0070670_100116135	3300005331	Bacteria	2308
14	Ga0070670_100126355	3300005331	Bacteria	2207
15	Ga0070670_100325756	3300005331	Bacteria	1347
16	Ga0068869_100053097	3300005334	Bacteria	2945
17	Ga0068869_100219815	3300005334	Bacteria	1505
18	Ga0070666_10003725	3300005335	Bacteria	9238
19	Ga0070666_10063414	3300005335	Bacteria	2505
20	Ga0070666_10210283	3300005335	Bacteria	1370
21	Ga0070666_10252324	3300005335	Bacteria	1249
22	Ga0070680_100010618	3300005336	Bacteria	7105
23	Ga0070680_100020876	3300005336	Bacteria	5199
24	Ga0070680_100069421	3300005336	Bacteria	2893
25	Ga0068868_100019343	3300005338	Bacteria	5102
26	Ga0068868_100149708	3300005338	Bacteria	1921
27	Ga0068868_100335541	3300005338	Bacteria	1291
28	Ga0068868_100358357	3300005338	Bacteria	1251
29	Ga0070660_100291811	3300005339	Unclassified	1336
30	Ga0070660_100300389	3300005339	Bacteria	1316
31	Ga0070689_100001434	3300005340	Bacteria	15205
32	Ga0070689_100063894	3300005340	Bacteria	2864
33	Ga0070689_100074392	3300005340	Bacteria	2658
34	Ga0070691_10040169	3300005341	Bacteria	2211
35	Ga0070687_100011089	3300005343	Unclassified	3928
36	Ga0070668_100086732	3300005347	Unclassified	2462
37	Ga0070669_100003962	3300005353	Bacteria	10711
38	Ga0070675_100098907	3300005354	Bacteria	2455
39	Ga0070675_100169626	3300005354	Bacteria	1881
40	Ga0070671_100011529	3300005355	Bacteria	7108
41	Ga0070671_100015145	3300005355	Bacteria	6228
42	Ga0070674_100041013	3300005356	Bacteria	3134
43	Ga0070673_100001237	3300005364	Bacteria	14803
44	Ga0070673_100125330	3300005364	Unclassified	2148
45	Ga0070688_100001210	3300005365	Bacteria	12848
46	Ga0070688_100289721	3300005365	Unclassified	1179
47	Ga0070659_100007038	3300005366	Bacteria	8146
48	Ga0070667_100024093	3300005367	Bacteria	5054
49	Ga0070667_100026325	3300005367	Bacteria	4837
50	Ga0070667_100175590	3300005367	Unclassified	1893
51	Ga0070701_10085133	3300005438	Bacteria	1720
52	Ga0070700_100230681	3300005441	Bacteria	1317
53	Ga0070663_100106993	3300005455	Bacteria	2096
54	Ga0070663_100147995	3300005455	Bacteria	1798
55	Ga0070663_100559887	3300005455	Bacteria	956
56	Ga0070662_100019602	3300005457	Bacteria	4593
57	Ga0070681_10032131	3300005458	Bacteria	5268
58	Ga0070681_10034049	3300005458	Bacteria	5116
59	Ga0070681_10073764	3300005458	Bacteria	3375
60	Ga0068867_100012984	3300005459	Bacteria	5895
61	Ga0068867_100089963	3300005459	Bacteria	2328
62	Ga0070685_10009823	3300005466	Unclassified	4962
63	Ga0070685_10148908	3300005466	Bacteria	1481
64	Ga0070679_100057192	3300005530	Bacteria	3887
65	Ga0070679_100091255	3300005530	Bacteria	3034
66	Ga0068853_100006047	3300005539	Bacteria	9576
67	Ga0068853_100007037	3300005539	Bacteria	8992
68	Ga0068853_100118731	3300005539	Bacteria	2357
69	Ga0068853_100226214	3300005539	Bacteria	1710
70	Ga0068853_100320649	3300005539	Bacteria	1436
71	Ga0070672_100007450	3300005543	Bacteria	7427
72	Ga0070672_100380813	3300005543	Bacteria	1207
73	Ga0070686_100020341	3300005544	Unclassified	3926
74	Ga0070686_100213539	3300005544	Bacteria	1390
75	Ga0070665_100000014	3300005548	Bacteria	484881
76	Ga0070704_100371102	3300005549	Bacteria	1213
77	Ga0068855_100001457	3300005563	Bacteria	29525
78	Ga0068855_100005895	3300005563	Bacteria	14938
79	Ga0068855_100013536	3300005563	Bacteria	9838
80	Ga0068855_100047486	3300005563	Bacteria	5072
81	Ga0068855_100094590	3300005563	Bacteria	3445
82	Ga0068855_100184351	3300005563	Unclassified	2358
83	Ga0068855_100646945	3300005563	Unclassified	1136
84	Ga0070664_100373940	3300005564	Bacteria	1300
85	Ga0068857_100008066	3300005577	Bacteria	9085
86	Ga0068857_100055076	3300005577	Bacteria	3530
87	Ga0068857_100516029	3300005577	Bacteria	1123
88	Ga0068854_100075245	3300005578	Bacteria	2479
89	Ga0068854_100178306	3300005578	Bacteria	1658
90	Ga0068856_100193002	3300005614	Bacteria	2050
91	Ga0070702_100025330	3300005615	Unclassified	3177
92	Ga0068852_100001522	3300005616	Bacteria	15698
93	Ga0068852_100003549	3300005616	Bacteria	10913
94	Ga0068852_100096859	3300005616	Bacteria	2653
95	Ga0068852_100141926	3300005616	Bacteria	2224
96	Ga0068852_100317102	3300005616	Bacteria	1513
97	Ga0068859_100000024	3300005617	Bacteria	217931
98	Ga0068859_100021487	3300005617	Bacteria	6479
99	Ga0068859_100025034	3300005617	Bacteria	5991
100	Ga0068859_100397009	3300005617	Unclassified	1475
101	Ga0068864_100017261	3300005618	Bacteria	6018
102	Ga0068864_100023386	3300005618	Bacteria	5189
103	Ga0068864_100152167	3300005618	Unclassified	2096
104	Ga0068864_100290467	3300005618	Bacteria	1528
105	Ga0068861_100014914	3300005719	Bacteria	5462
106	Ga0068861_100163956	3300005719	Bacteria	1836
107	Ga0068861_100243279	3300005719	Bacteria	1531
108	Ga0068851_10007614	3300005834	Bacteria	4979
109	Ga0068851_10051544	3300005834	Unclassified	2091
110	Ga0068870_10013204	3300005840	Bacteria	3878
111	Ga0068870_10117294	3300005840	Bacteria	1528
112	Ga0068863_100005062	3300005841	Bacteria	13003
113	Ga0068863_100006102	3300005841	Bacteria	11819
114	Ga0068863_100011915	3300005841	Bacteria	8404
115	Ga0068863_100609002	3300005841	Unclassified	1081
116	Ga0068858_100019059	3300005842	Bacteria	6419
117	Ga0068858_100087135	3300005842	Unclassified	2904
118	Ga0068858_100123250	3300005842	Bacteria	2425
119	Ga0068858_100345151	3300005842	Bacteria	1425
120	Ga0068860_100000024	3300005843	Bacteria	271902
121	Ga0068860_100001067	3300005843	Bacteria	30243
122	Ga0068860_100013905	3300005843	Bacteria	7891
123	Ga0068860_100015362	3300005843	Bacteria	7480
124	Ga0068860_100018183	3300005843	Bacteria	6841
125	Ga0068860_100142609	3300005843	Bacteria	2304
126	Ga0068862_100002297	3300005844	Bacteria	17090
127	Ga0068862_100779204	3300005844	Bacteria	932
128	Ga0081540_1013617	3300005983	Bacteria	5274
129	Ga0075366_10004091	3300006195	Bacteria	7802
130	Ga0075366_10023240	3300006195	Unclassified	3611
131	Ga0097621_100033218	3300006237	Bacteria	4107
132	Ga0097621_100106742	3300006237	Bacteria	2362
133	Ga0097621_100168107	3300006237	Bacteria	1889
134	Ga0068871_100346092	3300006358	Bacteria	1314
135	Ga0097620_100000024	3300006931	Bacteria	217931
136	Ga0097620_100021487	3300006931	Bacteria	6479
137	Ga0097620_100025034	3300006931	Bacteria	5991
138	Ga0097620_100397044	3300006931	Unclassified	1475
139	Ga0105240_10001677	3300009093	Bacteria	37580
140	Ga0105240_10002692	3300009093	Bacteria	28281
141	Ga0105240_10004733	3300009093	Bacteria	20543
142	Ga0105240_10004816	3300009093	Bacteria	20340
143	Ga0105240_10006728	3300009093	Bacteria	16835
144	Ga0105240_10046130	3300009093	Bacteria	5523
145	Ga0105240_10292066	3300009093	Bacteria	1868
146	Ga0111539_10004607	3300009094	Bacteria	18008
147	Ga0105245_10422009	3300009098	Bacteria	1337
148	Ga0105247_10004768	3300009101	Bacteria	8635
149	Ga0105243_10303680	3300009148	Bacteria	1447
150	Ga0105241_10000085	3300009174	Bacteria	69963
151	Ga0105241_10005689	3300009174	Bacteria	9199
152	Ga0105241_10009716	3300009174	Bacteria	7070
153	Ga0105241_10336847	3300009174	Bacteria	1306
154	Ga0105242_10065617	3300009176	Bacteria	2995
155	Ga0105237_10000453	3300009545	Bacteria	58200
156	Ga0105237_10001806	3300009545	Bacteria	27618
157	Ga0105237_10004749	3300009545	Bacteria	15626
158	Ga0105237_10006755	3300009545	Bacteria	12666
159	Ga0105237_10035133	3300009545	Bacteria	5073
160	Ga0105237_10159185	3300009545	Unclassified	2256
161	Ga0105237_10184521	3300009545	Bacteria	2086
162	Ga0105237_10323132	3300009545	Bacteria	1547
163	Ga0105238_10001678	3300009551	Bacteria	22261
164	Ga0105238_10014216	3300009551	Bacteria	8049
165	Ga0105238_10130164	3300009551	Unclassified	2495
166	Ga0105249_10005595	3300009553	Bacteria	10867
167	Ga0105249_10006400	3300009553	Bacteria	10240
168	Ga0105249_10058736	3300009553	Bacteria	3526
169	Ga0105249_10377842	3300009553	Bacteria	1442
170	Ga0105239_10000019	3300010375	Bacteria	273836
171	Ga0105239_10000384	3300010375	Bacteria	64479
172	Ga0105239_10012678	3300010375	Bacteria	9379
173	Ga0105239_10019633	3300010375	Bacteria	7460
174	Ga0105239_10024426	3300010375	Bacteria	6660
175	Ga0105239_10024604	3300010375	Bacteria	6633
176	Ga0105239_10054831	3300010375	Bacteria	4373
177	Ga0105239_10224681	3300010375	Bacteria	2106
178	Ga0105239_10228905	3300010375	Bacteria	2086
179	Ga0105239_10312321	3300010375	Bacteria	1772
180	Ga0105246_10216066	3300011119	Bacteria	1500
181	Ga0157373_10015157	3300013100	Bacteria	5638
182	Ga0157373_10031976	3300013100	Bacteria	3789
183	Ga0157373_10277717	3300013100	Bacteria	1187
184	Ga0157371_10033931	3300013102	Bacteria	3664
185	Ga0157371_10044323	3300013102	Bacteria	3168
186	Ga0157371_10054298	3300013102	Bacteria	2845
187	Ga0157371_10237793	3300013102	Unclassified	1310
188	Ga0157370_10002878	3300013104	Bacteria	20507
189	Ga0157370_10296913	3300013104	Unclassified	1492
190	Ga0157369_10005621	3300013105	Bacteria	14565
191	Ga0157369_10018676	3300013105	Bacteria	7773
192	Ga0157369_10059105	3300013105	Bacteria	4135
193	Ga0157374_10000011	3300013296	Bacteria	466749
194	Ga0157374_10051166	3300013296	Bacteria	3843
195	Ga0157378_10001706	3300013297	Bacteria	19763
196	Ga0157378_10003365	3300013297	Bacteria	14220
197	Ga0157378_10004429	3300013297	Bacteria	12360
198	Ga0163162_10000189	3300013306	Bacteria	56954
199	Ga0163162_10000446	3300013306	Bacteria	38191
200	Ga0163162_10000687	3300013306	Bacteria	31377
201	Ga0163162_10010159	3300013306	Bacteria	9145
202	Ga0163162_10204358	3300013306	Bacteria	2104
203	Ga0163162_10691543	3300013306	Bacteria	1142
204	Ga0157372_10001462	3300013307	Bacteria	25620
205	Ga0157372_10002803	3300013307	Bacteria	18830
206	Ga0157372_10038810	3300013307	Bacteria	5255
207	Ga0157372_10039724	3300013307	Bacteria	5194
208	Ga0157372_10149964	3300013307	Bacteria	2690
209	Ga0157372_10265381	3300013307	Bacteria	1994
210	Ga0157372_10421235	3300013307	Bacteria	1556
211	Ga0157372_10560022	3300013307	Bacteria	1332
212	Ga0157375_10011538	3300013308	Bacteria	7803
213	Ga0157375_10060189	3300013308	Unclassified	3765
214	Ga0157375_10063893	3300013308	Bacteria	3664
215	Ga0163163_10000401	3300014325	Bacteria	40925
216	Ga0157380_10000477	3300014326	Bacteria	24458
217	Ga0157377_10017861	3300014745	Bacteria	3678
218	Ga0157377_10037666	3300014745	Bacteria	2665
219	Ga0157379_10115939	3300014968	Bacteria	2409
220	Ga0157379_10126384	3300014968	Unclassified	2300
221	Ga0157376_10000417	3300014969	Bacteria	27639
222	Ga0157376_10033085	3300014969	Bacteria	4158
223	Ga0157376_10282678	3300014969	Bacteria	1563
224	Ga0157376_10313195	3300014969	Bacteria	1490
225	Ga0157376_10327266	3300014969	Bacteria	1459
226	Ga0157376_10801647	3300014969	Bacteria	954
227	Ga0163161_10118616	3300017792	Unclassified	1986
228	Ga0213876_10000885	3300021384	Bacteria	20042
229	Ga0207656_10018968	3300025321	Bacteria	2715
230	Ga0207656_10024389	3300025321	Unclassified	2446
231	Ga0207682_10005173	3300025893	Bacteria	5342
232	Ga0207710_10008545	3300025900	Bacteria	4317
233	Ga0207688_10127369	3300025901	Bacteria	1490
234	Ga0207680_10000455	3300025903	Bacteria	19322
235	Ga0207680_10038669	3300025903	Bacteria	2763
236	Ga0207647_10015517	3300025904	Bacteria	5219
237	Ga0207647_10020157	3300025904	Bacteria	4475
238	Ga0207647_10084784	3300025904	Bacteria	1896
239	Ga0207643_10004864	3300025908	Bacteria	7197
240	Ga0207643_10006564	3300025908	Bacteria	6236
241	Ga0207705_10013466	3300025909	Bacteria	5901
242	Ga0207654_10000944	3300025911	Bacteria	15963
243	Ga0207654_10004526	3300025911	Bacteria	7023
244	Ga0207654_10006030	3300025911	Bacteria	6093
245	Ga0207654_10135542	3300025911	Unclassified	1563
246	Ga0207707_10020139	3300025912	Bacteria	5822
247	Ga0207707_10025163	3300025912	Bacteria	5206
248	Ga0207707_10190268	3300025912	Bacteria	1790
249	Ga0207695_10000087	3300025913	Bacteria	276412
250	Ga0207695_10000582	3300025913	Bacteria	74405
251	Ga0207695_10003932	3300025913	Bacteria	20551
252	Ga0207695_10004513	3300025913	Bacteria	18946
253	Ga0207695_10064386	3300025913	Bacteria	3775
254	Ga0207695_10155820	3300025913	Bacteria	2219
255	Ga0207671_10000311	3300025914	Bacteria	71753
256	Ga0207671_10001101	3300025914	Bacteria	32578
257	Ga0207671_10001299	3300025914	Bacteria	29321
258	Ga0207671_10011325	3300025914	Bacteria	7266
259	Ga0207671_10064903	3300025914	Bacteria	2714
260	Ga0207671_10265490	3300025914	Bacteria	1351
261	Ga0207660_10006619	3300025917	Bacteria	7519
262	Ga0207660_10073211	3300025917	Bacteria	2497
263	Ga0207660_10241353	3300025917	Bacteria	1423
264	Ga0207662_10009487	3300025918	Bacteria	5358
265	Ga0207662_10202036	3300025918	Bacteria	1287
266	Ga0207657_10071682	3300025919	Bacteria	2933
267	Ga0207657_10089889	3300025919	Bacteria	2563
268	Ga0207649_10275858	3300025920	Bacteria	1220
269	Ga0207652_10003607	3300025921	Bacteria	12749
270	Ga0207652_10062263	3300025921	Bacteria	3224
271	Ga0207652_10423738	3300025921	Bacteria	1200
272	Ga0207681_10035306	3300025923	Bacteria	3293
273	Ga0207681_10052101	3300025923	Bacteria	2774
274	Ga0207694_10010646	3300025924	Bacteria	6940
275	Ga0207694_10024833	3300025924	Bacteria	4552
276	Ga0207659_10350300	3300025926	Bacteria	1225
277	Ga0207644_10125947	3300025931	Bacteria	1955
278	Ga0207644_10250294	3300025931	Bacteria	1414
279	Ga0207690_10033849	3300025932	Bacteria	3288
280	Ga0207706_10102518	3300025933	Bacteria	2518
281	Ga0207686_10005594	3300025934	Bacteria	6737
282	Ga0207686_10063436	3300025934	Unclassified	2350
283	Ga0207670_10014802	3300025936	Bacteria	4643
284	Ga0207670_10070045	3300025936	Bacteria	2421
285	Ga0207670_10461135	3300025936	Bacteria	1026
286	Ga0207704_10062121	3300025938	Bacteria	2321
287	Ga0207691_10008540	3300025940	Bacteria	9836
288	Ga0207691_10144370	3300025940	Bacteria	2096
289	Ga0207691_10393298	3300025940	Bacteria	1183
290	Ga0207689_10001522	3300025942	Bacteria	22065
291	Ga0207689_10106449	3300025942	Bacteria	2304
292	Ga0207689_10294787	3300025942	Bacteria	1344
293	Ga0207689_10348907	3300025942	Bacteria	1230
294	Ga0207667_10000749	3300025949	Bacteria	42187
295	Ga0207667_10000969	3300025949	Bacteria	36612
296	Ga0207667_10001603	3300025949	Bacteria	28431
297	Ga0207667_10014841	3300025949	Bacteria	8860
298	Ga0207667_10034659	3300025949	Bacteria	5419
299	Ga0207667_10062251	3300025949	Bacteria	3902
300	Ga0207667_10263359	3300025949	Unclassified	1763
301	Ga0207667_10840928	3300025949	Bacteria	912
302	Ga0207651_10035459	3300025960	Bacteria	3244
303	Ga0207651_10155527	3300025960	Bacteria	1786
304	Ga0207651_10185746	3300025960	Unclassified	1654
305	Ga0207651_10238852	3300025960	Bacteria	1479
306	Ga0207712_10047973	3300025961	Bacteria	2968
307	Ga0207712_10055940	3300025961	Bacteria	2778
308	Ga0207712_10126666	3300025961	Bacteria	1940
309	Ga0207640_10165902	3300025981	Bacteria	1640
310	Ga0207640_10240282	3300025981	Bacteria	1399
311	Ga0207640_10265068	3300025981	Bacteria	1341
312	Ga0207658_10007540	3300025986	Bacteria	7412
313	Ga0207658_10036982	3300025986	Unclassified	3503
314	Ga0207658_10733848	3300025986	Bacteria	894
315	Ga0207703_10005373	3300026035	Bacteria	10318
316	Ga0207703_10046272	3300026035	Bacteria	3504
317	Ga0207639_10010323	3300026041	Bacteria	6466
318	Ga0207639_10018280	3300026041	Bacteria	4980
319	Ga0207639_10079448	3300026041	Bacteria	2592
320	Ga0207678_10014827	3300026067	Bacteria	6857
321	Ga0207678_10217942	3300026067	Bacteria	1633
322	Ga0207708_10229935	3300026075	Bacteria	1489
323	Ga0207702_10063827	3300026078	Bacteria	3150
324	Ga0207702_10174535	3300026078	Unclassified	1974
325	Ga0207641_10000058	3300026088	Bacteria	166385
326	Ga0207641_10028795	3300026088	Bacteria	4592
327	Ga0207641_10054070	3300026088	Bacteria	3405
328	Ga0207641_10284461	3300026088	Bacteria	1556
329	Ga0207648_10076525	3300026089	Bacteria	2917
330	Ga0207648_10165092	3300026089	Bacteria	1956
331	Ga0207648_10190750	3300026089	Bacteria	1816
332	Ga0207676_10006124	3300026095	Bacteria	8493
333	Ga0207676_10052073	3300026095	Bacteria	3198
334	Ga0207676_10118021	3300026095	Bacteria	2232
335	Ga0207676_10184805	3300026095	Unclassified	1828
336	Ga0207674_10007295	3300026116	Bacteria	12888
337	Ga0207674_10013105	3300026116	Bacteria	9228
338	Ga0207674_10193770	3300026116	Unclassified	1982
339	Ga0207675_100000790	3300026118	Bacteria	31482
340	Ga0207675_100079061	3300026118	Bacteria	3082
341	Ga0207675_100092041	3300026118	Bacteria	2852
342	Ga0207698_10031010	3300026142	Bacteria	3854
343	Ga0207698_10069254	3300026142	Bacteria	2789
344	Ga0207698_10212018	3300026142	Bacteria	1743
345	Ga0207698_10386985	3300026142	Bacteria	1332
346	Ga0268266_10000048	3300028379	Bacteria	310336
347	Ga0268265_10030392	3300028380	Bacteria	3889
348	Ga0268264_10000079	3300028381	Bacteria	249516
349	Ga0268264_10002782	3300028381	Bacteria	15265
350	Ga0268264_10004563	3300028381	Bacteria	11794
351	Ga0268264_10038797	3300028381	Bacteria	3933
352	Ga0268264_10172132	3300028381	Bacteria	1959
353	Ga0268264_10215869	3300028381	Bacteria	1763
354	Ga0307517_10144686	3300028786	Bacteria	1654
355	Ga0307517_10166734	3300028786	Unclassified	1461
356	Ga0307515_10000059	3300028794	Bacteria	257520
357	Ga0307511_10000076	3300030521	Bacteria	82520
358	Ga0265327_10005660	3300031251	Bacteria	10341
359	Ga0265327_10012128	3300031251	Bacteria	5847
360	Ga0307513_10347956	3300031456	Unclassified	1231
361	Ga0307509_10006651	3300031507	Bacteria	15434
362	Ga0307509_10061687	3300031507	Bacteria	3957
363	Ga0307509_10323308	3300031507	Bacteria	1278
364	Ga0307508_10004659	3300031616	Bacteria	13305
365	Ga0307508_10090187	3300031616	Bacteria	2652
366	Ga0307507_10061390	3300033179	Bacteria	3500
367	Ga0307510_10000586	3300033180	Bacteria	36743
368	Ga0395899_0004939	3300037312	Bacteria	10376
369	Ga0395900_0142276	3300037418	Bacteria	2455
370	Ga0395900_0146909	3300037418	Bacteria	2411
371	Ga0395898_0079219	3300037466	Bacteria	3169
372	Ga0395898_0432556	3300037466	Unclassified	1254
373	Ga0395905_0191022	3300037471	Bacteria	1921
374	Ga0436365_1933142	3300039437	Bacteria	64226
375	Ga0451791_1569557	3300041451	Bacteria	1796
376	Ga0451841_0961621	3300041498	Bacteria	842
377	Ga0451851_0324049	3300041507	Unclassified	1631
378	Ga0451577_0150524	3300042876	Bacteria	2094
379	Ga0451577_0157772	3300042876	Unclassified	2042
380	Ga0451577_0298165	3300042876	Bacteria	1461
381	Ga0466969_0000110	3300044656	Bacteria	43267
382	Ga0466972_0000146	3300044658	Bacteria	57580
383	Ga0466972_0001452	3300044658	Bacteria	11515
384	Ga0466966_0000015	3300044684	Bacteria	127402
385	Ga0466966_0080368	3300044684	Bacteria	2031
386	Ga0466961_0134955	3300044693	Bacteria	1546
387	Ga0466964_0052005	3300044706	Bacteria	1683
388	Ga0453684_0001824	3300044712	Bacteria	55944
389	Ga0453684_0018374	3300044712	Bacteria	10733
390	Ga0453684_0032730	3300044712	Bacteria	7265
391	Ga0453684_0763165	3300044712	Bacteria	1046
392	Ga0466971_0015185	3300044719	Bacteria	3389
393	Ga0466968_0056209	3300044735	Bacteria	1690
394	Ga0466970_0016647	3300044765	Bacteria	3794
395	Ga0466970_0043551	3300044765	Bacteria	2388
396	Ga0466960_0017120	3300044901	Bacteria	3155
397	Ga0466960_0069295	3300044901	Bacteria	1752
398	Ga0466960_0178036	3300044901	Bacteria	1151
399	Ga0466959_0000030	3300045049	Bacteria	111343
400	Ga0466959_0001742	3300045049	Bacteria	13544
401	Ga0451576_0357557	3300045051	Bacteria	1529
402	Ga0466958_0062750	3300045836	Bacteria	2266
403	Ga0495638_0122001	3300046460	Bacteria	1539
404	Ga0495580_0185299	3300046472	Bacteria	1437
405	Ga0495606_0010510	3300046507	Bacteria	7668
406	Ga0495598_0056240	3300046537	Bacteria	1201
407	Ga0495611_0000215	3300046648	Bacteria	40810
408	Ga0495625_0055834	3300046660	Bacteria	2815
409	Ga0495625_0235859	3300046660	Bacteria	1193
410	Ga0495672_0023546	3300047320	Bacteria	3985
411	Ga0495687_001296	3300047443	Bacteria	23472
412	Ga0495686_0000005	3300047472	Bacteria	827143
413	Ga0495686_0025641	3300047472	Bacteria	3864
414	Ga0501033_0117421	3300049570	Bacteria	1933
415	Ga0501033_0148586	3300049570	Bacteria	1692
416	Ga0501034_0018929	3300049571	Bacteria	7054
417	Ga0501034_0026908	3300049571	Bacteria	5852
418	Ga0501034_0109749	3300049571	Bacteria	2750
419	Ga0501036_0260497	3300049572	Bacteria	1453
420	Ga0501041_0042185	3300049577	Bacteria	2772
421	Ga0501219_000435	3300049703	Bacteria	6803
422	Ga0501081_0449870	3300049743	Bacteria	957
423	Ga0501241_014180	3300049758	Bacteria	1448
424	Ga0501035_0167890	3300049822	Unclassified	1897
425	Ga0501284_00002	3300050005	Bacteria	220402
426	nmdc:mga0k408_122438_c1	3300050493	Bacteria	1541
427	nmdc:mga0k408_20804_c1	3300050493	Bacteria	3681
428	nmdc:mga0k408_3380_c1	3300050493	Bacteria	8454
429	nmdc:mga0k408_57491_c1	3300050493	Bacteria	2258
430	nmdc:mga08y16_76380_c1	3300050511	Bacteria	3492
431	Ga0500646_0001670	3300053090	Bacteria	5862
432	Ga0500646_0002768	3300053090	Bacteria	4514
433	Ga0500583_0000153	3300053092	Bacteria	28587
434	Ga0500583_0000508	3300053092	Bacteria	11956
435	Ga0500583_0002585	3300053092	Bacteria	5478
436	Ga0500562_000013	3300053108	Bacteria	150003
437	Ga0500652_005898	3300053131	Bacteria	3899
438	Ga0500568_0040923	3300053139	Bacteria	1864
439	Ga0500589_005483	3300053147	Bacteria	4952
440	Ga0500604_0028740	3300053151	Bacteria	1617
441	Ga0500616_0049703	3300053153	Bacteria	2218
442	Ga0500622_0000242	3300053156	Bacteria	56575
443	Ga0500622_0001758	3300053156	Bacteria	16652
444	Ga0500622_0055078	3300053156	Bacteria	2038
445	Ga0500645_006716	3300053730	Bacteria	4079
446	Ga0500645_059504	3300053730	Bacteria	1106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025904	Ga0207647_10020157	Ga0207647_100201572	249
2	3300041498	Ga0451841_0961621	Ga0451841_0961621_17_772	250
3	3300044712	Ga0453684_0763165	Ga0453684_0763165_26_853	253
4	3300044712	Ga0453684_0018374	Ga0453684_0018374_432_1484	258
5	3300005841	Ga0068863_100011915	Ga0068863_10001191510	262
6	3300026088	Ga0207641_10028795	Ga0207641_100287955	262
7	3300013306	Ga0163162_10010159	Ga0163162_100101595	264
8	3300014968	Ga0157379_10115939	Ga0157379_101159392	264
9	3300005334	Ga0068869_100219815	Ga0068869_1002198154	265
10	3300005338	Ga0068868_100149708	Ga0068868_1001497082	265
11	3300005340	Ga0070689_100063894	Ga0070689_1000638941	265
12	3300005343	Ga0070687_100011089	Ga0070687_1000110894	265
13	3300005354	Ga0070675_100098907	Ga0070675_1000989074	265
14	3300005355	Ga0070671_100011529	Ga0070671_1000115294	265
15	3300005356	Ga0070674_100041013	Ga0070674_1000410134	265
16	3300005364	Ga0070673_100125330	Ga0070673_1001253303	265
17	3300005367	Ga0070667_100175590	Ga0070667_1001755901	265
18	3300005441	Ga0070700_100230681	Ga0070700_1002306812	265
19	3300005459	Ga0068867_100012984	Ga0068867_1000129844	265
20	3300005544	Ga0070686_100020341	Ga0070686_1000203413	265
21	3300005615	Ga0070702_100025330	Ga0070702_1000253303	265
22	3300005616	Ga0068852_100096859	Ga0068852_1000968594	265
23	3300005719	Ga0068861_100163956	Ga0068861_1001639562	265
24	3300005840	Ga0068870_10117294	Ga0068870_101172942	265
25	3300005842	Ga0068858_100087135	Ga0068858_1000871354	265
26	3300013297	Ga0157378_10001706	Ga0157378_100017069	265
27	3300013308	Ga0157375_10060189	Ga0157375_100601894	265
28	3300014745	Ga0157377_10017861	Ga0157377_100178612	265
29	3300025901	Ga0207688_10127369	Ga0207688_101273691	265
30	3300025918	Ga0207662_10009487	Ga0207662_100094874	265
31	3300025920	Ga0207649_10275858	Ga0207649_102758581	265
32	3300025926	Ga0207659_10350300	Ga0207659_103503002	265
33	3300025936	Ga0207670_10461135	Ga0207670_104611351	265
34	3300025942	Ga0207689_10348907	Ga0207689_103489071	265
35	3300025986	Ga0207658_10733848	Ga0207658_107338481	265
36	3300026035	Ga0207703_10046272	Ga0207703_100462724	265
37	3300026089	Ga0207648_10076525	Ga0207648_100765254	265
38	3300026118	Ga0207675_100092041	Ga0207675_1000920411	265
39	3300026142	Ga0207698_10212018	Ga0207698_102120182	265
40	3300005618	Ga0068864_100290467	Ga0068864_1002904672	268
41	3300005841	Ga0068863_100609002	Ga0068863_1006090021	268
42	3300006237	Ga0097621_100106742	Ga0097621_1001067422	268
43	3300025931	Ga0207644_10250294	Ga0207644_102502942	268
44	3300026088	Ga0207641_10054070	Ga0207641_100540703	268
45	3300026088	Ga0207641_10284461	Ga0207641_102844612	268
46	3300026095	Ga0207676_10118021	Ga0207676_101180212	268
47	iso_pu_bacteria	2896109856	2896111454	268
48	iso_pu_bacteria	2929154850	2929159582	268
49	3300005844	Ga0068862_100779204	Ga0068862_1007792041	271
50	3300013307	Ga0157372_10038810	Ga0157372_100388102	271
51	3300013307	Ga0157372_10265381	Ga0157372_102653811	271
52	3300042876	Ga0451577_0157772	Ga0451577_0157772_1096_1914	271
53	3300044712	Ga0453684_0032730	Ga0453684_0032730_2026_2844	271
54	3300049570	Ga0501033_0148586	Ga0501033_0148586_867_1682	271
55	3300003316	rootH1_10052170	rootH1_100521703	272
56	3300003320	rootH2_10000442	rootH2_1000044240	272
57	3300003320	rootH2_10000443	rootH2_100004437	272
58	3300003320	rootH2_10071639	rootH2_100716394	272
59	3300003322	rootL2_10228479	rootL2_102284792	272
60	3300005329	Ga0070683_100007666	Ga0070683_1000076663	272
61	3300005331	Ga0070670_100325756	Ga0070670_1003257562	272
62	3300005335	Ga0070666_10003725	Ga0070666_100037257	272
63	3300005335	Ga0070666_10063414	Ga0070666_100634143	272
64	3300005335	Ga0070666_10210283	Ga0070666_102102831	272
65	3300005335	Ga0070666_10252324	Ga0070666_102523241	272
66	3300005336	Ga0070680_100010618	Ga0070680_1000106182	272
67	3300005336	Ga0070680_100069421	Ga0070680_1000694212	272
68	3300005338	Ga0068868_100019343	Ga0068868_1000193432	272
69	3300005338	Ga0068868_100358357	Ga0068868_1003583571	272
70	3300005339	Ga0070660_100291811	Ga0070660_1002918112	272
71	3300005339	Ga0070660_100300389	Ga0070660_1003003892	272
72	3300005341	Ga0070691_10040169	Ga0070691_100401691	272
73	3300005347	Ga0070668_100086732	Ga0070668_1000867322	272
74	3300005355	Ga0070671_100015145	Ga0070671_1000151454	272
75	3300005366	Ga0070659_100007038	Ga0070659_1000070388	272
76	3300005367	Ga0070667_100024093	Ga0070667_1000240932	272
77	3300005367	Ga0070667_100026325	Ga0070667_1000263253	272
78	3300005455	Ga0070663_100147995	Ga0070663_1001479952	272
79	3300005457	Ga0070662_100019602	Ga0070662_1000196023	272
80	3300005458	Ga0070681_10034049	Ga0070681_100340496	272
81	3300005458	Ga0070681_10073764	Ga0070681_100737644	272
82	3300005459	Ga0068867_100089963	Ga0068867_1000899632	272
83	3300005466	Ga0070685_10009823	Ga0070685_100098232	272
84	3300005530	Ga0070679_100057192	Ga0070679_1000571923	272
85	3300005539	Ga0068853_100006047	Ga0068853_1000060471	272
86	3300005539	Ga0068853_100007037	Ga0068853_1000070379	272
87	3300005539	Ga0068853_100118731	Ga0068853_1001187311	272
88	3300005539	Ga0068853_100226214	Ga0068853_1002262142	272
89	3300005539	Ga0068853_100320649	Ga0068853_1003206491	272
90	3300005543	Ga0070672_100380813	Ga0070672_1003808131	272
91	3300005548	Ga0070665_100000014	Ga0070665_100000014159	272
92	3300005563	Ga0068855_100001457	Ga0068855_10000145710	272
93	3300005563	Ga0068855_100005895	Ga0068855_10000589510	272
94	3300005563	Ga0068855_100013536	Ga0068855_1000135365	272
95	3300005563	Ga0068855_100094590	Ga0068855_1000945902	272
96	3300005563	Ga0068855_100184351	Ga0068855_1001843512	272
97	3300005563	Ga0068855_100646945	Ga0068855_1006469451	272
98	3300005577	Ga0068857_100008066	Ga0068857_1000080665	272
99	3300005577	Ga0068857_100516029	Ga0068857_1005160292	272
100	3300005578	Ga0068854_100075245	Ga0068854_1000752452	272
101	3300005616	Ga0068852_100001522	Ga0068852_10000152211	272
102	3300005616	Ga0068852_100003549	Ga0068852_1000035492	272
103	3300005616	Ga0068852_100141926	Ga0068852_1001419262	272
104	3300005616	Ga0068852_100317102	Ga0068852_1003171021	272
105	3300005617	Ga0068859_100000024	Ga0068859_10000002462	272
106	3300005617	Ga0068859_100021487	Ga0068859_1000214873	272
107	3300005617	Ga0068859_100397009	Ga0068859_1003970091	272
108	3300005618	Ga0068864_100023386	Ga0068864_1000233863	272
109	3300005618	Ga0068864_100152167	Ga0068864_1001521672	272
110	3300005834	Ga0068851_10007614	Ga0068851_100076142	272
111	3300005834	Ga0068851_10051544	Ga0068851_100515442	272
112	3300005841	Ga0068863_100005062	Ga0068863_1000050623	272
113	3300005841	Ga0068863_100006102	Ga0068863_1000061023	272
114	3300005842	Ga0068858_100019059	Ga0068858_1000190594	272
115	3300005842	Ga0068858_100123250	Ga0068858_1001232502	272
116	3300005842	Ga0068858_100345151	Ga0068858_1003451512	272
117	3300005843	Ga0068860_100000024	Ga0068860_100000024201	272
118	3300005843	Ga0068860_100001067	Ga0068860_10000106711	272
119	3300005843	Ga0068860_100013905	Ga0068860_1000139055	272
120	3300005843	Ga0068860_100015362	Ga0068860_1000153624	272
121	3300005843	Ga0068860_100018183	Ga0068860_1000181835	272
122	3300005843	Ga0068860_100142609	Ga0068860_1001426092	272
123	3300005983	Ga0081540_1013617	Ga0081540_10136175	272
124	3300006237	Ga0097621_100033218	Ga0097621_1000332184	272
125	3300006237	Ga0097621_100168107	Ga0097621_1001681071	272
126	3300006358	Ga0068871_100346092	Ga0068871_1003460921	272
127	3300006931	Ga0097620_100000024	Ga0097620_10000002462	272
128	3300006931	Ga0097620_100021487	Ga0097620_1000214873	272
129	3300006931	Ga0097620_100397044	Ga0097620_1003970441	272
130	3300009093	Ga0105240_10001677	Ga0105240_100016772	272
131	3300009093	Ga0105240_10002692	Ga0105240_1000269222	272
132	3300009093	Ga0105240_10004733	Ga0105240_100047331	272
133	3300009093	Ga0105240_10004816	Ga0105240_100048161	272
134	3300009093	Ga0105240_10006728	Ga0105240_1000672821	272
135	3300009093	Ga0105240_10046130	Ga0105240_100461305	272
136	3300009093	Ga0105240_10292066	Ga0105240_102920661	272
137	3300009098	Ga0105245_10422009	Ga0105245_104220092	272
138	3300009101	Ga0105247_10004768	Ga0105247_100047688	272
139	3300009148	Ga0105243_10303680	Ga0105243_103036801	272
140	3300009174	Ga0105241_10000085	Ga0105241_1000008560	272
141	3300009174	Ga0105241_10005689	Ga0105241_100056892	272
142	3300009174	Ga0105241_10009716	Ga0105241_100097162	272
143	3300009176	Ga0105242_10065617	Ga0105242_100656174	272
144	3300009545	Ga0105237_10000453	Ga0105237_1000045317	272
145	3300009545	Ga0105237_10001806	Ga0105237_1000180626	272
146	3300009545	Ga0105237_10004749	Ga0105237_100047495	272
147	3300009545	Ga0105237_10006755	Ga0105237_100067553	272
148	3300009545	Ga0105237_10035133	Ga0105237_100351332	272
149	3300009545	Ga0105237_10159185	Ga0105237_101591851	272
150	3300009545	Ga0105237_10184521	Ga0105237_101845212	272
151	3300009545	Ga0105237_10323132	Ga0105237_103231321	272
152	3300009551	Ga0105238_10001678	Ga0105238_100016782	272
153	3300009551	Ga0105238_10014216	Ga0105238_100142165	272
154	3300009551	Ga0105238_10130164	Ga0105238_101301643	272
155	3300009553	Ga0105249_10058736	Ga0105249_100587363	272
156	3300009553	Ga0105249_10377842	Ga0105249_103778422	272
157	3300010375	Ga0105239_10000019	Ga0105239_1000001925	272
158	3300010375	Ga0105239_10000384	Ga0105239_1000038426	272
159	3300010375	Ga0105239_10012678	Ga0105239_100126782	272
160	3300010375	Ga0105239_10019633	Ga0105239_100196337	272
161	3300010375	Ga0105239_10024426	Ga0105239_100244262	272
162	3300010375	Ga0105239_10024604	Ga0105239_100246042	272
163	3300010375	Ga0105239_10054831	Ga0105239_100548312	272
164	3300010375	Ga0105239_10224681	Ga0105239_102246813	272
165	3300010375	Ga0105239_10228905	Ga0105239_102289052	272
166	3300010375	Ga0105239_10312321	Ga0105239_103123212	272
167	3300011119	Ga0105246_10216066	Ga0105246_102160663	272
168	3300013100	Ga0157373_10015157	Ga0157373_100151576	272
169	3300013100	Ga0157373_10031976	Ga0157373_100319764	272
170	3300013100	Ga0157373_10277717	Ga0157373_102777171	272
171	3300013102	Ga0157371_10044323	Ga0157371_100443233	272
172	3300013102	Ga0157371_10054298	Ga0157371_100542984	272
173	3300013102	Ga0157371_10237793	Ga0157371_102377932	272
174	3300013104	Ga0157370_10002878	Ga0157370_1000287818	272
175	3300013104	Ga0157370_10296913	Ga0157370_102969131	272
176	3300013105	Ga0157369_10005621	Ga0157369_100056219	272
177	3300013105	Ga0157369_10018676	Ga0157369_100186764	272
178	3300013296	Ga0157374_10000011	Ga0157374_10000011382	272
179	3300013296	Ga0157374_10051166	Ga0157374_100511662	272
180	3300013297	Ga0157378_10003365	Ga0157378_100033653	272
181	3300013297	Ga0157378_10004429	Ga0157378_100044291	272
182	3300013306	Ga0163162_10000189	Ga0163162_1000018950	272
183	3300013306	Ga0163162_10000446	Ga0163162_100004469	272
184	3300013306	Ga0163162_10000687	Ga0163162_1000068730	272
185	3300013307	Ga0157372_10001462	Ga0157372_100014624	272
186	3300013307	Ga0157372_10002803	Ga0157372_1000280314	272
187	3300013307	Ga0157372_10149964	Ga0157372_101499642	272
188	3300013307	Ga0157372_10560022	Ga0157372_105600221	272
189	3300013308	Ga0157375_10063893	Ga0157375_100638932	272
190	3300014325	Ga0163163_10000401	Ga0163163_100004014	272
191	3300014968	Ga0157379_10126384	Ga0157379_101263842	272
192	3300014969	Ga0157376_10000417	Ga0157376_100004174	272
193	3300014969	Ga0157376_10033085	Ga0157376_100330852	272
194	3300014969	Ga0157376_10313195	Ga0157376_103131951	272
195	3300014969	Ga0157376_10327266	Ga0157376_103272661	272
196	3300014969	Ga0157376_10801647	Ga0157376_108016471	272
197	3300017792	Ga0163161_10118616	Ga0163161_101186163	272
198	3300021384	Ga0213876_10000885	Ga0213876_100008856	272
199	3300025321	Ga0207656_10018968	Ga0207656_100189682	272
200	3300025321	Ga0207656_10024389	Ga0207656_100243892	272
201	3300025900	Ga0207710_10008545	Ga0207710_100085454	272
202	3300025903	Ga0207680_10000455	Ga0207680_100004556	272
203	3300025903	Ga0207680_10038669	Ga0207680_100386693	272
204	3300025904	Ga0207647_10015517	Ga0207647_100155173	272
205	3300025904	Ga0207647_10084784	Ga0207647_100847841	272
206	3300025911	Ga0207654_10000944	Ga0207654_100009443	272
207	3300025911	Ga0207654_10004526	Ga0207654_100045267	272
208	3300025911	Ga0207654_10006030	Ga0207654_100060304	272
209	3300025911	Ga0207654_10135542	Ga0207654_101355422	272
210	3300025912	Ga0207707_10020139	Ga0207707_100201391	272
211	3300025912	Ga0207707_10190268	Ga0207707_101902682	272
212	3300025913	Ga0207695_10000087	Ga0207695_10000087103	272
213	3300025913	Ga0207695_10000582	Ga0207695_1000058221	272
214	3300025913	Ga0207695_10003932	Ga0207695_1000393220	272
215	3300025913	Ga0207695_10004513	Ga0207695_1000451312	272
216	3300025913	Ga0207695_10064386	Ga0207695_100643861	272
217	3300025913	Ga0207695_10155820	Ga0207695_101558201	272
218	3300025914	Ga0207671_10000311	Ga0207671_1000031160	272
219	3300025914	Ga0207671_10001101	Ga0207671_100011017	272
220	3300025914	Ga0207671_10001299	Ga0207671_1000129924	272
221	3300025914	Ga0207671_10011325	Ga0207671_100113253	272
222	3300025914	Ga0207671_10064903	Ga0207671_100649031	272
223	3300025914	Ga0207671_10265490	Ga0207671_102654901	272
224	3300025917	Ga0207660_10073211	Ga0207660_100732112	272
225	3300025917	Ga0207660_10241353	Ga0207660_102413532	272
226	3300025919	Ga0207657_10071682	Ga0207657_100716822	272
227	3300025921	Ga0207652_10062263	Ga0207652_100622633	272
228	3300025921	Ga0207652_10423738	Ga0207652_104237381	272
229	3300025924	Ga0207694_10010646	Ga0207694_100106466	272
230	3300025924	Ga0207694_10024833	Ga0207694_100248333	272
231	3300025931	Ga0207644_10125947	Ga0207644_101259472	272
232	3300025932	Ga0207690_10033849	Ga0207690_100338493	272
233	3300025934	Ga0207686_10063436	Ga0207686_100634361	272
234	3300025940	Ga0207691_10008540	Ga0207691_100085405	272
235	3300025940	Ga0207691_10144370	Ga0207691_101443703	272
236	3300025940	Ga0207691_10393298	Ga0207691_103932981	272
237	3300025942	Ga0207689_10001522	Ga0207689_100015224	272
238	3300025942	Ga0207689_10294787	Ga0207689_102947871	272
239	3300025949	Ga0207667_10000749	Ga0207667_1000074926	272
240	3300025949	Ga0207667_10000969	Ga0207667_1000096929	272
241	3300025949	Ga0207667_10001603	Ga0207667_1000160320	272
242	3300025949	Ga0207667_10034659	Ga0207667_100346592	272
243	3300025949	Ga0207667_10062251	Ga0207667_100622512	272
244	3300025949	Ga0207667_10263359	Ga0207667_102633591	272
245	3300025949	Ga0207667_10840928	Ga0207667_108409281	272
246	3300025960	Ga0207651_10155527	Ga0207651_101555271	272
247	3300025960	Ga0207651_10185746	Ga0207651_101857462	272
248	3300025961	Ga0207712_10055940	Ga0207712_100559403	272
249	3300025981	Ga0207640_10240282	Ga0207640_102402821	272
250	3300025981	Ga0207640_10265068	Ga0207640_102650681	272
251	3300025986	Ga0207658_10007540	Ga0207658_100075402	272
252	3300025986	Ga0207658_10036982	Ga0207658_100369822	272
253	3300026035	Ga0207703_10005373	Ga0207703_100053737	272
254	3300026041	Ga0207639_10010323	Ga0207639_100103233	272
255	3300026041	Ga0207639_10018280	Ga0207639_100182806	272
256	3300026041	Ga0207639_10079448	Ga0207639_100794482	272
257	3300026078	Ga0207702_10063827	Ga0207702_100638272	272
258	3300026078	Ga0207702_10174535	Ga0207702_101745353	272
259	3300026088	Ga0207641_10000058	Ga0207641_10000058131	272
260	3300026089	Ga0207648_10190750	Ga0207648_101907502	272
261	3300026095	Ga0207676_10052073	Ga0207676_100520733	272
262	3300026095	Ga0207676_10184805	Ga0207676_101848052	272
263	3300026116	Ga0207674_10013105	Ga0207674_100131056	272
264	3300026116	Ga0207674_10193770	Ga0207674_101937702	272
265	3300026142	Ga0207698_10031010	Ga0207698_100310102	272
266	3300026142	Ga0207698_10069254	Ga0207698_100692542	272
267	3300026142	Ga0207698_10386985	Ga0207698_103869852	272
268	3300028379	Ga0268266_10000048	Ga0268266_10000048237	272
269	3300028381	Ga0268264_10000079	Ga0268264_10000079220	272
270	3300028381	Ga0268264_10002782	Ga0268264_100027825	272
271	3300028381	Ga0268264_10004563	Ga0268264_1000456312	272
272	3300028381	Ga0268264_10038797	Ga0268264_100387972	272
273	3300028381	Ga0268264_10215869	Ga0268264_102158692	272
274	3300028786	Ga0307517_10144686	Ga0307517_101446861	272
275	3300028786	Ga0307517_10166734	Ga0307517_101667342	272
276	3300028794	Ga0307515_10000059	Ga0307515_10000059100	272
277	3300030521	Ga0307511_10000076	Ga0307511_1000007661	272
278	3300031251	Ga0265327_10005660	Ga0265327_100056605	272
279	3300031251	Ga0265327_10012128	Ga0265327_100121285	272
280	3300031456	Ga0307513_10347956	Ga0307513_103479562	272
281	3300031507	Ga0307509_10006651	Ga0307509_100066511	272
282	3300031507	Ga0307509_10061687	Ga0307509_100616874	272
283	3300031507	Ga0307509_10323308	Ga0307509_103233082	272
284	3300031616	Ga0307508_10004659	Ga0307508_100046598	272
285	3300031616	Ga0307508_10090187	Ga0307508_100901874	272
286	3300033179	Ga0307507_10061390	Ga0307507_100613902	272
287	3300033180	Ga0307510_10000586	Ga0307510_1000058634	272
288	3300037418	Ga0395900_0146909	Ga0395900_0146909_1202_2020	272
289	3300037466	Ga0395898_0432556	Ga0395898_0432556_145_1056	272
290	3300039437	Ga0436365_1933142	Ga0436365_1933142_5707_6525	272
291	3300041451	Ga0451791_1569557	Ga0451791_1569557_434_1255	272
292	3300041507	Ga0451851_0324049	Ga0451851_0324049_440_1261	272
293	3300042876	Ga0451577_0150524	Ga0451577_0150524_114_1010	272
294	3300042876	Ga0451577_0298165	Ga0451577_0298165_493_1311	272
295	3300044656	Ga0466969_0000110	Ga0466969_0000110_6832_7653	272
296	3300044658	Ga0466972_0000146	Ga0466972_0000146_47431_48249	272
297	3300044658	Ga0466972_0001452	Ga0466972_0001452_231_1055	272
298	3300044684	Ga0466966_0000015	Ga0466966_0000015_37752_38573	272
299	3300044684	Ga0466966_0080368	Ga0466966_0080368_613_1437	272
300	3300044693	Ga0466961_0134955	Ga0466961_0134955_468_1292	272
301	3300044706	Ga0466964_0052005	Ga0466964_0052005_160_984	272
302	3300044712	Ga0453684_0001824	Ga0453684_0001824_25699_26577	272
303	3300044719	Ga0466971_0015185	Ga0466971_0015185_1292_2116	272
304	3300044735	Ga0466968_0056209	Ga0466968_0056209_846_1670	272
305	3300044765	Ga0466970_0016647	Ga0466970_0016647_2610_3434	272
306	3300044765	Ga0466970_0043551	Ga0466970_0043551_343_1161	272
307	3300044901	Ga0466960_0017120	Ga0466960_0017120_1721_2542	272
308	3300044901	Ga0466960_0069295	Ga0466960_0069295_111_935	272
309	3300044901	Ga0466960_0178036	Ga0466960_0178036_184_1002	272
310	3300045049	Ga0466959_0000030	Ga0466959_0000030_100126_100947	272
311	3300045049	Ga0466959_0001742	Ga0466959_0001742_9760_10584	272
312	3300045836	Ga0466958_0062750	Ga0466958_0062750_1039_1863	272
313	3300046460	Ga0495638_0122001	Ga0495638_0122001_158_979	272
314	3300046472	Ga0495580_0185299	Ga0495580_0185299_606_1427	272
315	3300046507	Ga0495606_0010510	Ga0495606_0010510_2308_3132	272
316	3300046648	Ga0495611_0000215	Ga0495611_0000215_11214_12038	272
317	3300046660	Ga0495625_0055834	Ga0495625_0055834_553_1377	272
318	3300046660	Ga0495625_0235859	Ga0495625_0235859_58_882	272
319	3300047320	Ga0495672_0023546	Ga0495672_0023546_1667_2590	272
320	3300047443	Ga0495687_001296	Ga0495687_001296_5932_6756	272
321	3300047472	Ga0495686_0000005	Ga0495686_0000005_566077_566901	272
322	3300049570	Ga0501033_0117421	Ga0501033_0117421_294_1112	272
323	3300049571	Ga0501034_0018929	Ga0501034_0018929_2342_3160	272
324	3300049571	Ga0501034_0026908	Ga0501034_0026908_1504_2328	272
325	3300049571	Ga0501034_0109749	Ga0501034_0109749_191_1009	272
326	3300049572	Ga0501036_0260497	Ga0501036_0260497_315_1136	272
327	3300049577	Ga0501041_0042185	Ga0501041_0042185_800_1621	272
328	3300049703	Ga0501219_000435	Ga0501219_000435_4697_5518	272
329	3300049743	Ga0501081_0449870	Ga0501081_0449870_116_937	272
330	3300049758	Ga0501241_014180	Ga0501241_014180_98_919	272
331	3300049822	Ga0501035_0167890	Ga0501035_0167890_636_1454	272
332	3300050005	Ga0501284_00002	Ga0501284_00002_55360_56181	272
333	3300050493	nmdc:mga0k408_122438_c1	nmdc:mga0k408_122438_c1_86_907	272
334	3300050493	nmdc:mga0k408_20804_c1	nmdc:mga0k408_20804_c1_1763_2584	272
335	3300050493	nmdc:mga0k408_57491_c1	nmdc:mga0k408_57491_c1_67_888	272
336	3300053090	Ga0500646_0001670	Ga0500646_0001670_2798_3619	272
337	3300053090	Ga0500646_0002768	Ga0500646_0002768_132_953	272
338	3300053092	Ga0500583_0000153	Ga0500583_0000153_489_1310	272
339	3300053092	Ga0500583_0000508	Ga0500583_0000508_11125_11946	272
340	3300053092	Ga0500583_0002585	Ga0500583_0002585_3665_4489	272
341	3300053108	Ga0500562_000013	Ga0500562_000013_37671_38489	272
342	3300053131	Ga0500652_005898	Ga0500652_005898_1198_2019	272
343	3300053139	Ga0500568_0040923	Ga0500568_0040923_923_1747	272
344	3300053147	Ga0500589_005483	Ga0500589_005483_1504_2325	272
345	3300053151	Ga0500604_0028740	Ga0500604_0028740_622_1443	272
346	3300053153	Ga0500616_0049703	Ga0500616_0049703_848_1666	272
347	3300053156	Ga0500622_0000242	Ga0500622_0000242_2410_3228	272
348	3300053156	Ga0500622_0001758	Ga0500622_0001758_2278_3102	272
349	3300053156	Ga0500622_0055078	Ga0500622_0055078_662_1483	272
350	3300053730	Ga0500645_006716	Ga0500645_006716_1822_2643	272
351	3300053730	Ga0500645_059504	Ga0500645_059504_58_879	272
352	3300002459	JGI24751J29686_10000798	JGI24751J29686_100007987	273
353	3300005290	Ga0065712_10071092	Ga0065712_100710922	273
354	3300005293	Ga0065715_10022834	Ga0065715_100228342	273
355	3300005295	Ga0065707_10098123	Ga0065707_100981233	273
356	3300005328	Ga0070676_10050801	Ga0070676_100508014	273
357	3300005331	Ga0070670_100116135	Ga0070670_1001161351	273
358	3300005331	Ga0070670_100126355	Ga0070670_1001263552	273
359	3300005334	Ga0068869_100053097	Ga0068869_1000530973	273
360	3300005336	Ga0070680_100020876	Ga0070680_1000208766	273
361	3300005338	Ga0068868_100335541	Ga0068868_1003355411	273
362	3300005340	Ga0070689_100001434	Ga0070689_10000143413	273
363	3300005340	Ga0070689_100074392	Ga0070689_1000743921	273
364	3300005353	Ga0070669_100003962	Ga0070669_1000039624	273
365	3300005354	Ga0070675_100169626	Ga0070675_1001696262	273
366	3300005364	Ga0070673_100001237	Ga0070673_1000012379	273
367	3300005365	Ga0070688_100001210	Ga0070688_1000012106	273
368	3300005365	Ga0070688_100289721	Ga0070688_1002897211	273
369	3300005438	Ga0070701_10085133	Ga0070701_100851332	273
370	3300005455	Ga0070663_100106993	Ga0070663_1001069931	273
371	3300005455	Ga0070663_100559887	Ga0070663_1005598871	273
372	3300005458	Ga0070681_10032131	Ga0070681_100321316	273
373	3300005466	Ga0070685_10148908	Ga0070685_101489081	273
374	3300005530	Ga0070679_100091255	Ga0070679_1000912553	273
375	3300005543	Ga0070672_100007450	Ga0070672_1000074504	273
376	3300005544	Ga0070686_100213539	Ga0070686_1002135391	273
377	3300005549	Ga0070704_100371102	Ga0070704_1003711021	273
378	3300005563	Ga0068855_100047486	Ga0068855_1000474862	273
379	3300005564	Ga0070664_100373940	Ga0070664_1003739401	273
380	3300005577	Ga0068857_100055076	Ga0068857_1000550765	273
381	3300005578	Ga0068854_100178306	Ga0068854_1001783062	273
382	3300005614	Ga0068856_100193002	Ga0068856_1001930022	273
383	3300005617	Ga0068859_100025034	Ga0068859_1000250347	273
384	3300005618	Ga0068864_100017261	Ga0068864_1000172615	273
385	3300005719	Ga0068861_100014914	Ga0068861_1000149143	273
386	3300005719	Ga0068861_100243279	Ga0068861_1002432792	273
387	3300005840	Ga0068870_10013204	Ga0068870_100132043	273
388	3300005844	Ga0068862_100002297	Ga0068862_10000229712	273
389	3300006195	Ga0075366_10004091	Ga0075366_100040914	273
390	3300006195	Ga0075366_10023240	Ga0075366_100232404	273
391	3300006931	Ga0097620_100025034	Ga0097620_1000250347	273
392	3300009094	Ga0111539_10004607	Ga0111539_100046075	273
393	3300009174	Ga0105241_10336847	Ga0105241_103368471	273
394	3300009553	Ga0105249_10005595	Ga0105249_100055954	273
395	3300009553	Ga0105249_10006400	Ga0105249_100064004	273
396	3300013102	Ga0157371_10033931	Ga0157371_100339312	273
397	3300013105	Ga0157369_10059105	Ga0157369_100591052	273
398	3300013306	Ga0163162_10204358	Ga0163162_102043584	273
399	3300013306	Ga0163162_10691543	Ga0163162_106915431	273
400	3300013307	Ga0157372_10039724	Ga0157372_100397242	273
401	3300013307	Ga0157372_10421235	Ga0157372_104212352	273
402	3300013308	Ga0157375_10011538	Ga0157375_100115386	273
403	3300014326	Ga0157380_10000477	Ga0157380_100004775	273
404	3300014745	Ga0157377_10037666	Ga0157377_100376663	273
405	3300014969	Ga0157376_10282678	Ga0157376_102826782	273
406	3300025893	Ga0207682_10005173	Ga0207682_100051733	273
407	3300025908	Ga0207643_10004864	Ga0207643_100048642	273
408	3300025908	Ga0207643_10006564	Ga0207643_100065643	273
409	3300025909	Ga0207705_10013466	Ga0207705_100134667	273
410	3300025912	Ga0207707_10025163	Ga0207707_100251636	273
411	3300025917	Ga0207660_10006619	Ga0207660_100066196	273
412	3300025918	Ga0207662_10202036	Ga0207662_102020362	273
413	3300025919	Ga0207657_10089889	Ga0207657_100898892	273
414	3300025921	Ga0207652_10003607	Ga0207652_100036076	273
415	3300025923	Ga0207681_10035306	Ga0207681_100353062	273
416	3300025923	Ga0207681_10052101	Ga0207681_100521013	273
417	3300025933	Ga0207706_10102518	Ga0207706_101025183	273
418	3300025934	Ga0207686_10005594	Ga0207686_100055944	273
419	3300025936	Ga0207670_10014802	Ga0207670_100148022	273
420	3300025936	Ga0207670_10070045	Ga0207670_100700451	273
421	3300025938	Ga0207704_10062121	Ga0207704_100621212	273
422	3300025942	Ga0207689_10106449	Ga0207689_101064491	273
423	3300025949	Ga0207667_10014841	Ga0207667_1001484110	273
424	3300025960	Ga0207651_10035459	Ga0207651_100354592	273
425	3300025960	Ga0207651_10238852	Ga0207651_102388522	273
426	3300025961	Ga0207712_10047973	Ga0207712_100479732	273
427	3300025961	Ga0207712_10126666	Ga0207712_101266662	273
428	3300025981	Ga0207640_10165902	Ga0207640_101659022	273
429	3300026067	Ga0207678_10014827	Ga0207678_100148273	273
430	3300026067	Ga0207678_10217942	Ga0207678_102179421	273
431	3300026075	Ga0207708_10229935	Ga0207708_102299351	273
432	3300026089	Ga0207648_10165092	Ga0207648_101650922	273
433	3300026095	Ga0207676_10006124	Ga0207676_100061242	273
434	3300026116	Ga0207674_10007295	Ga0207674_100072958	273
435	3300026118	Ga0207675_100000790	Ga0207675_1000007906	273
436	3300026118	Ga0207675_100079061	Ga0207675_1000790612	273
437	3300028380	Ga0268265_10030392	Ga0268265_100303925	273
438	3300028381	Ga0268264_10172132	Ga0268264_101721321	273
439	3300037312	Ga0395899_0004939	Ga0395899_0004939_6459_7283	273
440	3300037418	Ga0395900_0142276	Ga0395900_0142276_1112_1936	273
441	3300037466	Ga0395898_0079219	Ga0395898_0079219_659_1483	273
442	3300037471	Ga0395905_0191022	Ga0395905_0191022_397_1221	273
443	3300045051	Ga0451576_0357557	Ga0451576_0357557_315_1259	273
444	3300046537	Ga0495598_0056240	Ga0495598_0056240_267_1088	273
445	3300047472	Ga0495686_0025641	Ga0495686_0025641_989_1810	273
446	3300050493	nmdc:mga0k408_3380_c1	nmdc:mga0k408_3380_c1_4587_5408	273
447	3300050511	nmdc:mga08y16_76380_c1	nmdc:mga08y16_76380_c1_1908_2729	273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

40

242

0.91 PF08659

KR

KR domain

40

174

0.87 PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

278

0.82 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3kvo-assembly3.cif.gz_B	crystal structure of the catalytic domain of human hydroxysteroid dehydrogenase like 2 (hsdl2)	0.9873	2	273
3kvo-assembly3.cif.gz_A	crystal structure of the catalytic domain of human hydroxysteroid dehydrogenase like 2 (hsdl2)	0.9872	3	273
3e03-assembly1.cif.gz_C-2	crystal structure of a putative dehydrogenase from xanthomonas campestris	0.9776	1	273
3e03-assembly3.cif.gz_A-4	crystal structure of a putative dehydrogenase from xanthomonas campestris	0.9749	4	273
3e03-assembly1.cif.gz_C-2	crystal structure of a putative dehydrogenase from xanthomonas campestris	0.9705	1	273

ID	Description	Score	Start	End	Superfamily
af_Q6P5L8_1_275_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9904	3	273	3.40.50.720
af_Q6P5L8_1_275_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9689	3	273	3.40.50.720
3rkrA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9121	1	242	3.40.50.720
2ehdA00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9108	5	242	3.40.50.720
3tfoB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9056	6	243	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A3C1LGQ4-F1-model_v4	Short chain dehydrogenase	1	3	184
AF-A0A6J4S7N6-F1-model_v4	Short-chain dehydrogenase/reductase SDR	0.9996	109	271	GO:0016491
AF-A0A820P344-F1-model_v4	Short chain dehydrogenase	0.9988	69	195	GO:0005739
AF-A0A4Q5SEE0-F1-model_v4	NAD(P)-dependent oxidoreductase	0.9984	3	244
AF-A0A0M3I2S9-F1-model_v4	Hydroxysteroid dehydrogenase-like protein 2	0.9972	3	126	GO:0005739

Feature Viewer

pLDDT	pTM	Quality
95.34	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F446027

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00106

adh_short

short chain dehydrogenase

40

242

0.91

PF08659

KR

KR domain

40

174

0.87

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

278

0.82

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map