F446028

General Info

Members Datasets Scaffolds Average Seq Length
447 298 390 129

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0096570|Ga0495686_0096570_620_1036
Length 138
Sequence MQSASNKESQMARRVALVSLLVADYDAAIGFYVGKLGFTLVEDTDMGHGKRWVVVSPGSDGTNFLLARAVGDQAEAIGQQGGGRVWLFLHTDDFAGDHARMSAAGVTFLEEPRHEAYGTVAVFEDLSGNRWDLLQPKS

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
8 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
13 2643221714 Streptomyces sp. Root264 Isolate Unclassified
14 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
15 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
16 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
17 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2808606448 Streptomyces sp. 193411 Isolate Unclassified
21 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
22 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
23 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
24 2818991435 Caulobacter henricii 536 Isolate Unclassified
25 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
26 2851153111 Caulobacter radicis 736 Isolate Unclassified
27 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
28 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
29 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
30 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
31 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
32 2867428634 Streptomyces sp. RP5T Isolate Unclassified
33 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
34 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
35 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
36 2919404418 Luteibacter sp. 3190 Isolate Unclassified
37 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
38 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
39 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
40 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
41 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
42 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
43 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
44 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
45 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
46 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
47 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
48 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
49 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
50 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
51 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
52 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
53 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
54 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
55 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
56 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
57 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
58 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
109 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
133 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
137 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
138 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
139 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
146 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
147 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
148 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
149 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
150 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
151 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
152 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
153 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
235 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
253 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
262 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
263 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
264 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
265 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
266 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
267 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
268 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
269 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
270 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
271 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
272 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
273 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
274 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
275 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
276 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
277 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
278 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
279 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
280 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
281 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
282 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
286 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
287 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
288 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
289 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
292 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
293 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
296 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
297 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
298 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.91
Metatranscriptomes 1.34
Isolates 12.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.15
Nodule 0.45
Rhizoplane 2.01
Rhizosphere 60.4
Stem 0
Stem Tuber 0
Unclassified 14.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10011593 3300001989 Bacteria 3253
2 JGI25159J45721_1030727 3300002987 Bacteria 869
3 JGI25153J46596_10082375 3300003215 Bacteria 798
4 rootH1_10076356 3300003316 Bacteria 1001
5 rootH1_10150610 3300003316 Bacteria 1496
6 rootL2_10147160 3300003322 Bacteria 1124
7 rootL2_10240137 3300003322 Bacteria 1138
8 Ga0006562J51391_1003397 3300003578 Bacteria 6526
9 Ga0006562J51391_1122148 3300003578 Bacteria 1435
10 Ga0055526_1014846 3300003771 Bacteria 3170
11 Ga0055526_1070206 3300003771 Bacteria 713
12 Ga0055524_1014975 3300003775 Bacteria 2849
13 Ga0055536_1000338 3300003781 Bacteria 34594
14 Ga0055536_1000341 3300003781 Bacteria 34543
15 Ga0055536_1028632 3300003781 Bacteria 1514
16 Ga0055530_10003584 3300003791 Bacteria 8722
17 Ga0055530_10005979 3300003791 Bacteria 5594
18 Ga0055531_10000523 3300003794 Bacteria 34495
19 Ga0055531_10000589 3300003794 Bacteria 31724
20 Ga0055531_10012887 3300003794 Bacteria 3894
21 Ga0055531_10020641 3300003794 Bacteria 2596
22 Ga0065704_10164605 3300005289 Bacteria 1331
23 Ga0070668_100000354 3300005347 Bacteria 30316
24 Ga0070667_100041463 3300005367 Bacteria 3862
25 Ga0070706_100814503 3300005467 Bacteria 864
26 Ga0068855_100218455 3300005563 Bacteria 2139
27 Ga0068859_100133439 3300005617 Bacteria 2555
28 Ga0068858_100340634 3300005842 Bacteria 1435
29 Ga0068860_100000158 3300005843 Bacteria 110478
30 Ga0068862_100011006 3300005844 Bacteria 7473
31 Ga0075368_10001577 3300006042 Bacteria 7316
32 Ga0075367_10000756 3300006178 Bacteria 12614
33 Ga0075369_10001840 3300006186 Bacteria 7399
34 Ga0075366_10131600 3300006195 Bacteria 1510
35 Ga0097620_100133426 3300006931 Bacteria 2555
36 Ga0105251_10029518 3300009011 Bacteria 2762
37 Ga0105250_10121210 3300009092 Bacteria 1075
38 Ga0105246_10254727 3300011119 Bacteria 1395
39 Ga0105246_10488298 3300011119 Bacteria 1043
40 Ga0163163_12956434 3300014325 Bacteria 530
41 Ga0182007_10002837 3300015262 Bacteria 8431
42 Ga0183367_1003 3300015688 Bacteria 814276
43 Ga0163161_10616919 3300017792 Bacteria 896
44 Ga0209130_1020065 3300025284 Bacteria 1536
45 Ga0209675_1020554 3300025291 Bacteria 1785
46 Ga0209676_1000099 3300025292 Bacteria 230048
47 Ga0209676_1000180 3300025292 Bacteria 148369
48 Ga0209676_1009537 3300025292 Bacteria 4175
49 Ga0209564_1011871 3300025295 Bacteria 3858
50 Ga0209564_1014075 3300025295 Bacteria 3351
51 Ga0209564_1038004 3300025295 Bacteria 1347
52 Ga0209050_1000319 3300025298 Bacteria 96837
53 Ga0209050_1000716 3300025298 Bacteria 48711
54 Ga0209050_1007155 3300025298 Bacteria 6355
55 Ga0209050_1037690 3300025298 Bacteria 1390
56 Ga0209256_1001877 3300025299 Bacteria 19375
57 Ga0209256_1004465 3300025299 Bacteria 8756
58 Ga0209256_1004997 3300025299 Bacteria 7936
59 Ga0209256_1006741 3300025299 Bacteria 5946
60 Ga0209256_1071125 3300025299 Bacteria 782
61 Ga0207426_1012186 3300025302 Bacteria 3241
62 Ga0209051_1005290 3300025303 Bacteria 7608
63 Ga0209051_1009553 3300025303 Bacteria 4985
64 Ga0209257_1000614 3300025304 Bacteria 58019
65 Ga0209257_1001577 3300025304 Bacteria 26294
66 Ga0209257_1001627 3300025304 Bacteria 25721
67 Ga0209257_1003771 3300025304 Bacteria 12509
68 Ga0209257_1016283 3300025304 Bacteria 3018
69 Ga0207713_1039049 3300025735 Bacteria 2007
70 Ga0207647_10028881 3300025904 Bacteria 3596
71 Ga0207695_10756224 3300025913 Bacteria 852
72 Ga0207694_11186005 3300025924 Bacteria 646
73 Ga0207709_10915756 3300025935 Bacteria 713
74 Ga0207668_10122357 3300025972 Bacteria 1972
75 Ga0207658_10032594 3300025986 Bacteria 3710
76 Ga0207702_10846875 3300026078 Bacteria 905
77 Ga0268265_10013888 3300028380 Bacteria 5481
78 Ga0268265_10075591 3300028380 Bacteria 2639
79 Ga0268264_10000029 3300028381 Bacteria 419246
80 Ga0307517_10010035 3300028786 Bacteria 13318
81 Ga0307515_10000106 3300028794 Bacteria 197218
82 Ga0307515_10066602 3300028794 Bacteria 4986
83 Ga0307515_10099088 3300028794 Bacteria 3542
84 Ga0307515_10864573 3300028794 Bacteria 532
85 Ga0307511_10000047 3300030521 Bacteria 98863
86 Ga0307512_10008193 3300030522 Bacteria 10219
87 Ga0265316_10150455 3300031344 Bacteria 1744
88 Ga0307513_10023854 3300031456 Bacteria 7136
89 Ga0307513_10045521 3300031456 Bacteria 4795
90 Ga0307513_10385927 3300031456 Bacteria 1139
91 Ga0307509_10013866 3300031507 Bacteria 9508
92 Ga0307509_10049136 3300031507 Bacteria 4525
93 Ga0307508_10031447 3300031616 Bacteria 4797
94 Ga0307508_10090434 3300031616 Bacteria 2647
95 Ga0307508_10495153 3300031616 Bacteria 817
96 Ga0307514_10009865 3300031649 Bacteria 8001
97 Ga0265342_10307765 3300031712 Bacteria 833
98 Ga0307516_10000711 3300031730 Bacteria 45216
99 Ga0307516_10077906 3300031730 Bacteria 3162
100 Ga0307413_10018106 3300031824 Bacteria 3687
101 Ga0307518_10021394 3300031838 Bacteria 4651
102 Ga0307518_10086921 3300031838 Bacteria 2253
103 Ga0307518_10096471 3300031838 Bacteria 2121
104 Ga0307518_10229030 3300031838 Bacteria 1205
105 Ga0307518_10239372 3300031838 Bacteria 1166
106 Ga0307410_10071899 3300031852 Bacteria 2400
107 Ga0307407_10464396 3300031903 Bacteria 921
108 Ga0307409_101650761 3300031995 Bacteria 669
109 Ga0307414_10832332 3300032004 Bacteria 843
110 Ga0307411_10013406 3300032005 Bacteria 4522
111 Ga0307507_10132376 3300033179 Bacteria 1945
112 Ga0307507_10167612 3300033179 Bacteria 1605
113 Ga0307510_10007245 3300033180 Bacteria 13211
114 Ga0307510_10145190 3300033180 Bacteria 2007
115 Ga0373938_0151927 3300034957 Bacteria 617
116 Ga0395899_0000197 3300037312 Bacteria 88596
117 Ga0395900_0000006 3300037418 Bacteria 495364
118 Ga0395900_0259467 3300037418 Bacteria 1736
119 Ga0395900_0371675 3300037418 Bacteria 1399
120 Ga0395898_0003326 3300037466 Bacteria 18055
121 Ga0395898_0006955 3300037466 Bacteria 12022
122 Ga0395898_0105866 3300037466 Bacteria 2697
123 Ga0395905_0927288 3300037471 Bacteria 774
124 Ga0395905_1202215 3300037471 Bacteria 661
125 Ga0395905_1562207 3300037471 Bacteria 564
126 Ga0395901_0000001 3300038443 Bacteria 800383
127 Ga0395901_0464434 3300038443 Bacteria 1293
128 Ga0400483_281591 3300039062 Bacteria 1762
129 Ga0439436_0006905 3300041404 Bacteria 3488
130 Ga0439439_0000318 3300041406 Bacteria 7768
131 Ga0439439_0135326 3300041406 Bacteria 693
132 Ga0439465_0046137 3300041413 Bacteria 1418
133 Ga0451791_0932591 3300041451 Bacteria 1288
134 Ga0451798_0291059 3300041458 Bacteria 635
135 Ga0451804_0266230 3300041463 Bacteria 577
136 Ga0451837_0737301 3300041494 Bacteria 3004
137 Ga0439433_0058830 3300041999 Bacteria 914
138 Ga0439442_135618 3300042002 Bacteria 543
139 Ga0439448_0020712 3300042005 Bacteria 2037
140 Ga0439432_028884 3300042006 Bacteria 1805
141 Ga0439449_0002621 3300042007 Bacteria 7007
142 Ga0439449_0009152 3300042007 Bacteria 3755
143 Ga0439449_0013898 3300042007 Bacteria 3027
144 Ga0439449_0059227 3300042007 Bacteria 1414
145 Ga0439450_109348 3300042008 Bacteria 706
146 Ga0439457_000615 3300042014 Bacteria 10515
147 Ga0439457_007274 3300042014 Bacteria 2666
148 Ga0450894_000046 3300042131 Bacteria 18159
149 Ga0450895_030545 3300042132 Bacteria 525
150 Ga0450896_052451 3300042133 Bacteria 652
151 Ga0450898_003545 3300042134 Bacteria 2251
152 Ga0450899_001587 3300042135 Bacteria 2515
153 Ga0450903_000207 3300042138 Bacteria 13042
154 Ga0450906_002372 3300042145 Bacteria 4119
155 Ga0439458_0023621 3300042157 Bacteria 1434
156 Ga0439458_0065591 3300042157 Bacteria 911
157 Ga0450908_019732 3300042184 Bacteria 1186
158 Ga0451577_0008303 3300042876 Bacteria 10105
159 Ga0466969_0016573 3300044656 Bacteria 3854
160 Ga0466972_0006377 3300044658 Bacteria 5926
161 Ga0466972_0076214 3300044658 Bacteria 1597
162 Ga0466972_0260850 3300044658 Bacteria 810
163 Ga0466965_0027062 3300044683 Bacteria 2781
164 Ga0466966_0001620 3300044684 Bacteria 14498
165 Ga0466961_0322146 3300044693 Bacteria 942
166 Ga0466961_0452638 3300044693 Bacteria 777
167 Ga0466963_0000279 3300044694 Bacteria 22827
168 Ga0466963_0004465 3300044694 Bacteria 8139
169 Ga0466964_0003280 3300044706 Bacteria 5887
170 Ga0466971_0012611 3300044719 Bacteria 3707
171 Ga0466970_0001245 3300044765 Bacteria 12348
172 Ga0466970_0002248 3300044765 Bacteria 9322
173 Ga0466957_0000404 3300044842 Bacteria 21092
174 Ga0466957_0725584 3300044842 Bacteria 702
175 Ga0466959_0000297 3300045049 Bacteria 29628
176 Ga0466958_0000301 3300045836 Bacteria 19375
177 Ga0466958_0606538 3300045836 Bacteria 712
178 Ga0466967_0034626 3300045976 Bacteria 4289
179 Ga0466967_0041677 3300045976 Bacteria 3961
180 Ga0466967_0335912 3300045976 Bacteria 1460
181 Ga0466967_1558213 3300045976 Bacteria 658
182 Ga0466967_1945349 3300045976 Bacteria 585
183 Ga0495592_0141436 3300046454 Bacteria 1673
184 Ga0495603_0004114 3300046455 Bacteria 8664
185 Ga0495590_0000894 3300046457 Bacteria 13347
186 Ga0495590_0195798 3300046457 Bacteria 742
187 Ga0495629_0002482 3300046459 Bacteria 14145
188 Ga0495629_0003839 3300046459 Bacteria 11336
189 Ga0495629_0020046 3300046459 Bacteria 4774
190 Ga0495638_0001122 3300046460 Bacteria 25994
191 Ga0495638_0001193 3300046460 Bacteria 24877
192 Ga0495638_0005052 3300046460 Bacteria 9895
193 Ga0495638_0085893 3300046460 Bacteria 1902
194 Ga0495638_0116157 3300046460 Bacteria 1585
195 Ga0495651_0005915 3300046462 Bacteria 9332
196 Ga0495650_0000020 3300046471 Bacteria 533839
197 Ga0495582_0047463 3300046473 Bacteria 2366
198 Ga0495582_0750867 3300046473 Bacteria 564
199 Ga0495662_0003831 3300046476 Bacteria 7581
200 Ga0495664_0000236 3300046477 Bacteria 26604
201 Ga0495585_0204093 3300046492 Bacteria 1005
202 Ga0495585_0325341 3300046492 Bacteria 751
203 Ga0495583_0000001 3300046506 Bacteria 811973
204 Ga0495606_0051116 3300046507 Bacteria 2699
205 Ga0495606_0489305 3300046507 Bacteria 623
206 Ga0495610_0000218 3300046512 Bacteria 61777
207 Ga0495620_0000235 3300046515 Bacteria 41389
208 Ga0495630_0453857 3300046517 Bacteria 982
209 Ga0495631_0001201 3300046518 Bacteria 16001
210 Ga0495631_0065168 3300046518 Bacteria 1577
211 Ga0495637_0006111 3300046520 Bacteria 6060
212 Ga0495643_0134230 3300046522 Bacteria 1240
213 Ga0495643_0224134 3300046522 Bacteria 890
214 Ga0495643_0263001 3300046522 Bacteria 800
215 Ga0495648_0000399 3300046524 Bacteria 47763
216 Ga0495648_0072414 3300046524 Bacteria 1994
217 Ga0495648_0117811 3300046524 Bacteria 1433
218 Ga0495654_0000139 3300046530 Bacteria 75903
219 Ga0495587_0037649 3300046536 Bacteria 2903
220 Ga0495597_0164049 3300046542 Bacteria 905
221 Ga0495667_0041540 3300046559 Bacteria 3050
222 Ga0495668_0000186 3300046616 Bacteria 92604
223 Ga0495668_0004296 3300046616 Bacteria 10212
224 Ga0495668_0051736 3300046616 Bacteria 2274
225 Ga0495668_0104269 3300046616 Bacteria 1551
226 Ga0495634_0003864 3300046642 Bacteria 11894
227 Ga0495625_0002840 3300046660 Bacteria 18199
228 Ga0495625_0004908 3300046660 Bacteria 12453
229 Ga0495625_0014666 3300046660 Bacteria 6242
230 Ga0495625_0017874 3300046660 Bacteria 5543
231 Ga0495625_0052573 3300046660 Bacteria 2916
232 Ga0495625_0121872 3300046660 Bacteria 1773
233 Ga0495625_0165800 3300046660 Bacteria 1477
234 Ga0495635_0000810 3300046663 Bacteria 20485
235 Ga0495659_0074061 3300046664 Bacteria 1281
236 Ga0495588_0071459 3300046674 Bacteria 1804
237 Ga0495657_0002703 3300046675 Bacteria 14802
238 Ga0495657_0005545 3300046675 Bacteria 9967
239 Ga0495646_0005201 3300046680 Bacteria 8207
240 Ga0495658_0329277 3300046683 Bacteria 969
241 Ga0495613_0000319 3300046689 Bacteria 43656
242 Ga0495613_0001373 3300046689 Bacteria 18549
243 Ga0495613_0002293 3300046689 Bacteria 14491
244 Ga0495613_0109334 3300046689 Bacteria 1993
245 Ga0495671_0010037 3300046692 Bacteria 5266
246 Ga0495671_0024213 3300046692 Bacteria 3164
247 Ga0495671_0163848 3300046692 Bacteria 1081
248 Ga0495649_0060966 3300046694 Bacteria 2029
249 Ga0495600_0009396 3300046809 Bacteria 6040
250 Ga0495600_0669583 3300046809 Bacteria 626
251 Ga0495581_0341193 3300047315 Bacteria 874
252 Ga0495604_0006154 3300047317 Bacteria 9521
253 Ga0495636_0028114 3300047318 Bacteria 2291
254 Ga0495672_0001176 3300047320 Bacteria 26541
255 Ga0495676_0001866 3300047321 Bacteria 18493
256 Ga0495676_0010735 3300047321 Bacteria 8290
257 Ga0495683_0011776 3300047323 Bacteria 4599
258 Ga0495687_008166 3300047443 Bacteria 6036
259 Ga0495687_041189 3300047443 Bacteria 2028
260 Ga0495675_0762699 3300047444 Bacteria 538
261 Ga0495685_021298 3300047447 Bacteria 2231
262 Ga0495685_024469 3300047447 Bacteria 2078
263 Ga0495673_0001209 3300047469 Bacteria 21505
264 Ga0495681_0060647 3300047470 Bacteria 1745
265 Ga0495681_0095551 3300047470 Bacteria 1306
266 Ga0495684_0258479 3300047471 Bacteria 1264
267 Ga0495686_0002771 3300047472 Bacteria 15995
268 Ga0495686_0053304 3300047472 Bacteria 2535
269 Ga0495686_0096570 3300047472 Bacteria 1788
270 Ga0495686_0112622 3300047472 Bacteria 1630
271 Ga0495686_0464601 3300047472 Bacteria 670
272 Ga0495593_0001745 3300047673 Bacteria 12875
273 Ga0495602_0337877 3300048088 Bacteria 1090
274 Ga0495614_0017835 3300048089 Bacteria 3079
275 Ga0495614_0021194 3300048089 Bacteria 2808
276 Ga0495614_0054329 3300048089 Bacteria 1717
277 Ga0496106_0023443 3300048909 Bacteria 4585
278 Ga0496106_0294032 3300048909 Bacteria 1302
279 Ga0496107_0000686 3300048910 Bacteria 19221
280 Ga0496107_0490133 3300048910 Bacteria 912
281 Ga0496109_0038340 3300048912 Bacteria 4332
282 Ga0496115_0005747 3300048918 Bacteria 9032
283 Ga0496121_0008376 3300048924 Bacteria 12190
284 Ga0496121_0379111 3300048924 Bacteria 933
285 Ga0496121_0398415 3300048924 Bacteria 902
286 Ga0496123_0247237 3300048926 Bacteria 882
287 Ga0496124_0011921 3300048927 Bacteria 8651
288 Ga0496125_0006196 3300048928 Bacteria 13029
289 Ga0496126_0025395 3300048929 Bacteria 5700
290 Ga0496126_0364602 3300048929 Bacteria 1179
291 Ga0496126_1217481 3300048929 Bacteria 553
292 Ga0501309_043874 3300049129 Bacteria 689
293 Ga0501305_072179 3300049161 Bacteria 609
294 Ga0495678_001349 3300049459 Bacteria 19645
295 Ga0501313_020618 3300049529 Bacteria 813
296 Ga0501323_044169 3300049539 Bacteria 661
297 Ga0501031_0141448 3300049568 Bacteria 1573
298 Ga0501032_0037378 3300049569 Bacteria 3311
299 Ga0501032_0189115 3300049569 Bacteria 1346
300 Ga0501033_0001100 3300049570 Bacteria 24510
301 Ga0501033_0039109 3300049570 Bacteria 3543
302 Ga0501033_0230475 3300049570 Bacteria 1316
303 Ga0501034_0002133 3300049571 Bacteria 24572
304 Ga0501034_0013923 3300049571 Bacteria 8280
305 Ga0501034_0017466 3300049571 Bacteria 7358
306 Ga0501034_0360087 3300049571 Bacteria 1382
307 Ga0501036_0000299 3300049572 Bacteria 34329
308 Ga0501036_0006831 3300049572 Bacteria 9270
309 Ga0501037_0118183 3300049573 Bacteria 1907
310 Ga0501038_0001431 3300049574 Bacteria 21881
311 Ga0501038_0028754 3300049574 Bacteria 4936
312 Ga0501038_0454792 3300049574 Bacteria 984
313 Ga0501039_0033141 3300049575 Bacteria 3985
314 Ga0501042_0315020 3300049578 Bacteria 1130
315 Ga0501043_0014843 3300049579 Bacteria 6099
316 Ga0501043_0074976 3300049579 Bacteria 2657
317 Ga0501046_0051123 3300049580 Bacteria 3262
318 Ga0501047_0072468 3300049581 Bacteria 3316
319 Ga0501047_0365811 3300049581 Bacteria 1277
320 Ga0501047_0435248 3300049581 Bacteria 1142
321 Ga0501048_0860904 3300049582 Bacteria 651
322 Ga0501070_0000250 3300049586 Bacteria 50587
323 Ga0501070_0362933 3300049586 Bacteria 1175
324 Ga0501070_0851648 3300049586 Bacteria 713
325 Ga0501074_0003360 3300049590 Bacteria 11339
326 Ga0501238_002667 3300049671 Bacteria 2149
327 Ga0501257_001441 3300049686 Bacteria 4934
328 Ga0501083_0287574 3300049744 Bacteria 1069
329 Ga0501035_0001274 3300049822 Bacteria 26045
330 Ga0501044_0108394 3300049823 Bacteria 2787
331 Ga0501044_0135883 3300049823 Bacteria 2450
332 Ga0501044_0404314 3300049823 Bacteria 1277
333 Ga0501044_1219536 3300049823 Bacteria 620
334 nmdc:mga0k408_56273_c1 3300050493 Bacteria 2282
335 nmdc:mga06z11_1372_c1 3300050494 Bacteria 9014
336 nmdc:mga04h51_1187_c1 3300050495 Bacteria 6006
337 nmdc:mga0sz30_29417_c1 3300050516 Bacteria 2265
338 Ga0500578_0000080 3300053086 Bacteria 106387
339 Ga0500643_000178 3300053087 Bacteria 62275
340 Ga0500643_009286 3300053087 Bacteria 3766
341 Ga0500644_0007526 3300053088 Bacteria 2838
342 Ga0500647_0134150 3300053091 Bacteria 1166
343 Ga0500583_0092214 3300053092 Bacteria 1475
344 Ga0500566_0440140 3300053094 Bacteria 573
345 Ga0500640_140275 3300053095 Bacteria 939
346 Ga0500641_0001551 3300053096 Bacteria 8189
347 Ga0500650_0195217 3300053098 Bacteria 923
348 Ga0500553_130203 3300053101 Bacteria 1016
349 Ga0500554_001284 3300053102 Bacteria 4867
350 Ga0500555_063598 3300053103 Bacteria 987
351 Ga0500556_0000830 3300053104 Bacteria 17803
352 Ga0500556_0002818 3300053104 Bacteria 5319
353 Ga0500556_0057818 3300053104 Bacteria 1420
354 Ga0500558_138388 3300053106 Bacteria 920
355 Ga0500560_000209 3300053107 Bacteria 7007
356 Ga0500562_001746 3300053108 Bacteria 5419
357 Ga0500562_008399 3300053108 Bacteria 2608
358 Ga0500572_112095 3300053111 Bacteria 878
359 Ga0500593_076018 3300053117 Bacteria 1448
360 Ga0500594_0000143 3300053118 Bacteria 19524
361 Ga0500608_000969 3300053122 Bacteria 10297
362 Ga0500614_015098 3300053123 Bacteria 1719
363 Ga0500614_035765 3300053123 Bacteria 1239
364 Ga0500628_083743 3300053129 Bacteria 821
365 Ga0500658_0001104 3300053134 Bacteria 11041
366 Ga0500559_0000024 3300053136 Bacteria 126300
367 Ga0500559_0002205 3300053136 Bacteria 10289
368 Ga0500573_0013811 3300053140 Bacteria 4559
369 Ga0500573_0244275 3300053140 Bacteria 929
370 Ga0500600_0232526 3300053149 Bacteria 841
371 Ga0500600_0391196 3300053149 Bacteria 555
372 Ga0500604_0020437 3300053151 Bacteria 1864
373 Ga0500616_0009748 3300053153 Bacteria 5803
374 Ga0500616_0060718 3300053153 Bacteria 1959
375 Ga0500616_0240529 3300053153 Bacteria 778
376 Ga0500619_233077 3300053154 Bacteria 610
377 Ga0500622_0004633 3300053156 Bacteria 8529
378 Ga0500622_0005394 3300053156 Bacteria 7693
379 Ga0500622_0008710 3300053156 Bacteria 5659
380 Ga0500622_0025414 3300053156 Bacteria 3128
381 Ga0500622_0049279 3300053156 Bacteria 2172
382 Ga0500622_0076886 3300053156 Bacteria 1677
383 Ga0500622_0096264 3300053156 Bacteria 1463
384 Ga0500624_007070 3300053157 Bacteria 1534
385 Ga0500627_0028479 3300053158 Bacteria 2321
386 Ga0500633_0139036 3300053160 Bacteria 909
387 Ga0500645_000129 3300053730 Bacteria 59366
388 Ga0500645_001427 3300053730 Bacteria 12143
389 Ga0500645_002494 3300053730 Bacteria 8161
390 Ga0466962_0285779 3300061719 Bacteria 814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053154 Ga0500619_233077 Ga0500619_233077_188_583 103
2 3300047320 Ga0495672_0001176 Ga0495672_0001176_16306_16701 108
3 3300005347 Ga0070668_100000354 Ga0070668_10000035413 110
4 3300005367 Ga0070667_100041463 Ga0070667_1000414633 110
5 3300005617 Ga0068859_100133439 Ga0068859_1001334392 110
6 3300005843 Ga0068860_100000158 Ga0068860_10000015826 110
7 3300005844 Ga0068862_100011006 Ga0068862_1000110063 110
8 3300006931 Ga0097620_100133426 Ga0097620_1001334262 110
9 3300025972 Ga0207668_10122357 Ga0207668_101223572 110
10 3300025986 Ga0207658_10032594 Ga0207658_100325943 110
11 3300028380 Ga0268265_10013888 Ga0268265_100138882 110
12 3300028380 Ga0268265_10075591 Ga0268265_100755912 110
13 3300028381 Ga0268264_10000029 Ga0268264_10000029224 110
14 3300047472 Ga0495686_0112622 Ga0495686_0112622_720_1115 114
15 3300034957 Ga0373938_0151927 Ga0373938_0151927_99_500 115
16 3300044693 Ga0466961_0452638 Ga0466961_0452638_360_731 119
17 3300049568 Ga0501031_0141448 Ga0501031_0141448_625_1011 120
18 3300049569 Ga0501032_0189115 Ga0501032_0189115_369_755 120
19 3300049570 Ga0501033_0230475 Ga0501033_0230475_884_1276 120
20 3300049572 Ga0501036_0006831 Ga0501036_0006831_1624_2016 120
21 3300049574 Ga0501038_0001431 Ga0501038_0001431_17747_18133 120
22 3300049581 Ga0501047_0072468 Ga0501047_0072468_1837_2223 120
23 3300049823 Ga0501044_0108394 Ga0501044_0108394_2033_2419 120
24 3300042131 Ga0450894_000046 Ga0450894_000046_17719_18096 123
25 3300046460 Ga0495638_0001193 Ga0495638_0001193_14439_14834 123
26 3300046512 Ga0495610_0000218 Ga0495610_0000218_33903_34298 123
27 3300046518 Ga0495631_0065168 Ga0495631_0065168_1081_1476 123
28 3300046520 Ga0495637_0006111 Ga0495637_0006111_694_1089 123
29 3300046522 Ga0495643_0134230 Ga0495643_0134230_690_1085 123
30 3300046660 Ga0495625_0121872 Ga0495625_0121872_702_1097 123
31 3300046692 Ga0495671_0163848 Ga0495671_0163848_658_1053 123
32 3300053104 Ga0500556_0000830 Ga0500556_0000830_6139_6534 123
33 3300053134 Ga0500658_0001104 Ga0500658_0001104_8214_8609 123
34 iso_pu_bacteria 2919404418 2919407813 123
35 3300039062 Ga0400483_281591 Ga0400483_281591_514_924 124
36 3300042876 Ga0451577_0008303 Ga0451577_0008303_988_1368 124
37 iso_pu_bacteria 2582581279 2585145867 124
38 iso_pu_bacteria 2585428106 2587915903 124
39 iso_pu_bacteria 2643221640 2644224236 124
40 iso_pu_bacteria 2643221642 2644234828 124
41 iso_pu_bacteria 2857504554 2857509349 124
42 iso_pu_bacteria 2884960567 2884962989 124
43 iso_pu_bacteria 2928531327 2928532487 124
44 3300031344 Ga0265316_10150455 Ga0265316_101504552 125
45 3300031712 Ga0265342_10307765 Ga0265342_103077652 125
46 3300049571 Ga0501034_0360087 Ga0501034_0360087_152_535 125
47 3300049823 Ga0501044_1219536 Ga0501044_1219536_62_445 125
48 iso_pu_bacteria 2582581280 2585150569 125
49 iso_pu_bacteria 2582581293 2585197759 125
50 iso_pu_bacteria 2582581312 2585296958 125
51 iso_pu_bacteria 2791355048 2792459508 125
52 iso_pu_bacteria 2808606982 2811843783 125
53 iso_pu_bacteria 2818991435 2819539803 125
54 iso_pu_bacteria 2818991454 2819648918 125
55 iso_pu_bacteria 2851153111 2851158162 125
56 iso_pu_bacteria 2912715099 2912723704 125
57 3300037312 Ga0395899_0000197 Ga0395899_0000197_71660_72043 126
58 3300037418 Ga0395900_0000006 Ga0395900_0000006_130646_131029 126
59 3300037466 Ga0395898_0105866 Ga0395898_0105866_525_908 126
60 3300037471 Ga0395905_1202215 Ga0395905_1202215_94_477 126
61 3300038443 Ga0395901_0000001 Ga0395901_0000001_173895_174278 126
62 3300046616 Ga0495668_0051736 Ga0495668_0051736_1316_1696 126
63 3300053087 Ga0500643_000178 Ga0500643_000178_3580_3960 126
64 3300053096 Ga0500641_0001551 Ga0500641_0001551_2417_2797 126
65 3300053104 Ga0500556_0057818 Ga0500556_0057818_928_1308 126
66 3300053117 Ga0500593_076018 Ga0500593_076018_600_980 126
67 3300053151 Ga0500604_0020437 Ga0500604_0020437_533_913 126
68 3300053153 Ga0500616_0009748 Ga0500616_0009748_1806_2186 126
69 3300053156 Ga0500622_0076886 Ga0500622_0076886_732_1112 126
70 3300053156 Ga0500622_0096264 Ga0500622_0096264_769_1149 126
71 3300053730 Ga0500645_000129 Ga0500645_000129_52351_52731 126
72 iso_pu_bacteria 2547132111 2547408878 126
73 iso_pu_bacteria 2582581313 2585305994 126
74 iso_pu_bacteria 2582581314 2585316399 126
75 iso_pu_bacteria 2643221647 2644265141 126
76 iso_pu_bacteria 2643221678 2644441819 126
77 iso_pu_bacteria 2643221714 2644630794 126
78 iso_pu_bacteria 2784132148 2784586021 126
79 iso_pu_bacteria 2784746768 2785366241 126
80 iso_pu_bacteria 2786546132 2786667212 126
81 iso_pu_bacteria 2808606359 2808846838 126
82 iso_pu_bacteria 2808606375 2808917477 126
83 iso_pu_bacteria 2808606448 2809229522 126
84 iso_pu_bacteria 2811994879 2812361549 126
85 iso_pu_bacteria 2811994917 2812477205 126
86 iso_pu_bacteria 2852635781 2852641731 126
87 iso_pu_bacteria 2862178590 2862182399 126
88 iso_pu_bacteria 2862281513 2862282380 126
89 iso_pu_bacteria 2862382967 2862387284 126
90 iso_pu_bacteria 2867428634 2867437250 126
91 iso_pu_bacteria 2877676314 2877684272 126
92 iso_pu_bacteria 2946064051 2946064614 126
93 iso_pu_bacteria 2946072368 2946073023 126
94 iso_pu_bacteria 2947224130 2947224554 126
95 iso_pu_bacteria 2954673503 2954682300 126
96 iso_pu_bacteria 2954682443 2954690624 126
97 iso_pu_bacteria 2954691527 2954700449 126
98 iso_pu_bacteria 2954701450 2954701779 126
99 iso_pu_bacteria 2954711539 2954719125 126
100 iso_pu_bacteria 2954721474 2954729095 126
101 iso_pu_bacteria 2954731030 2954732716 126
102 iso_pu_bacteria 2954740390 2954747995 126
103 iso_pu_bacteria 2954749733 2954751594 126
104 iso_pu_bacteria 2954759201 2954767120 126
105 iso_pu_bacteria 2990059506 2990066047 126
106 iso_pu_bacteria 3006393351 3006396704 126
107 iso_pu_bacteria 3006493962 3006498604 126
108 iso_pu_bacteria 8008558824 8008560231 126
109 iso_pu_bacteria 8023623736 8023624571 126
110 iso_pu_bacteria 8056829672 8056831007 126
111 3300003322 rootL2_10147160 rootL2_101471602 127
112 3300003322 rootL2_10240137 rootL2_102401372 127
113 3300003578 Ga0006562J51391_1003397 Ga0006562J51391_10033972 127
114 3300003781 Ga0055536_1000338 Ga0055536_100033825 127
115 3300003781 Ga0055536_1000341 Ga0055536_100034126 127
116 3300003791 Ga0055530_10005979 Ga0055530_100059792 127
117 3300003794 Ga0055531_10000523 Ga0055531_1000052318 127
118 3300003794 Ga0055531_10000589 Ga0055531_1000058929 127
119 3300005289 Ga0065704_10164605 Ga0065704_101646052 127
120 3300006186 Ga0075369_10001840 Ga0075369_100018405 127
121 3300006195 Ga0075366_10131600 Ga0075366_101316002 127
122 3300025292 Ga0209676_1000099 Ga0209676_100009984 127
123 3300025292 Ga0209676_1000180 Ga0209676_100018098 127
124 3300025295 Ga0209564_1038004 Ga0209564_10380042 127
125 3300025298 Ga0209050_1000319 Ga0209050_100031924 127
126 3300025298 Ga0209050_1000716 Ga0209050_100071613 127
127 3300025299 Ga0209256_1006741 Ga0209256_10067416 127
128 3300025303 Ga0209051_1009553 Ga0209051_10095535 127
129 3300025304 Ga0209257_1000614 Ga0209257_100061440 127
130 3300025304 Ga0209257_1003771 Ga0209257_10037719 127
131 3300028794 Ga0307515_10066602 Ga0307515_100666026 127
132 3300041451 Ga0451791_0932591 Ga0451791_0932591_810_1259 127
133 3300046457 Ga0495590_0000894 Ga0495590_0000894_4526_4912 127
134 3300046457 Ga0495590_0195798 Ga0495590_0195798_292_678 127
135 3300046507 Ga0495606_0051116 Ga0495606_0051116_1757_2143 127
136 3300046515 Ga0495620_0000235 Ga0495620_0000235_27931_28362 127
137 3300046518 Ga0495631_0001201 Ga0495631_0001201_12945_13355 127
138 3300046522 Ga0495643_0263001 Ga0495643_0263001_26_412 127
139 3300046524 Ga0495648_0000399 Ga0495648_0000399_2573_2992 127
140 3300046542 Ga0495597_0164049 Ga0495597_0164049_88_474 127
141 3300046616 Ga0495668_0000186 Ga0495668_0000186_36275_36661 127
142 3300046616 Ga0495668_0004296 Ga0495668_0004296_7713_8099 127
143 3300046616 Ga0495668_0104269 Ga0495668_0104269_784_1170 127
144 3300046692 Ga0495671_0024213 Ga0495671_0024213_1919_2329 127
145 3300047472 Ga0495686_0002771 Ga0495686_0002771_4804_5214 127
146 3300047472 Ga0495686_0096570 Ga0495686_0096570_620_1036 127
147 3300048909 Ga0496106_0294032 Ga0496106_0294032_681_1067 127
148 3300048924 Ga0496121_0398415 Ga0496121_0398415_73_489 127
149 3300048927 Ga0496124_0011921 Ga0496124_0011921_5989_6375 127
150 3300048928 Ga0496125_0006196 Ga0496125_0006196_4758_5144 127
151 3300048929 Ga0496126_0025395 Ga0496126_0025395_2334_2720 127
152 3300048929 Ga0496126_0364602 Ga0496126_0364602_518_934 127
153 3300049459 Ga0495678_001349 Ga0495678_001349_14724_15134 127
154 3300050493 nmdc:mga0k408_56273_c1 nmdc:mga0k408_56273_c1_1580_1966 127
155 3300050516 nmdc:mga0sz30_29417_c1 nmdc:mga0sz30_29417_c1_163_549 127
156 3300053086 Ga0500578_0000080 Ga0500578_0000080_99993_100403 127
157 3300053087 Ga0500643_009286 Ga0500643_009286_902_1285 127
158 3300053088 Ga0500644_0007526 Ga0500644_0007526_1687_2097 127
159 3300053098 Ga0500650_0195217 Ga0500650_0195217_422_808 127
160 3300053104 Ga0500556_0002818 Ga0500556_0002818_3306_3689 127
161 3300053106 Ga0500558_138388 Ga0500558_138388_290_673 127
162 3300053107 Ga0500560_000209 Ga0500560_000209_5404_5787 127
163 3300053108 Ga0500562_001746 Ga0500562_001746_3983_4366 127
164 3300053108 Ga0500562_008399 Ga0500562_008399_558_944 127
165 3300053118 Ga0500594_0000143 Ga0500594_0000143_9788_10198 127
166 3300053122 Ga0500608_000969 Ga0500608_000969_7656_8072 127
167 3300053136 Ga0500559_0002205 Ga0500559_0002205_2183_2599 127
168 3300053140 Ga0500573_0013811 Ga0500573_0013811_2801_3184 127
169 3300053153 Ga0500616_0240529 Ga0500616_0240529_332_715 127
170 3300053156 Ga0500622_0005394 Ga0500622_0005394_2509_2895 127
171 3300053156 Ga0500622_0008710 Ga0500622_0008710_2869_3255 127
172 3300053156 Ga0500622_0025414 Ga0500622_0025414_2088_2504 127
173 3300053730 Ga0500645_002494 Ga0500645_002494_4065_4448 127
174 3300003215 JGI25153J46596_10082375 JGI25153J46596_100823751 128
175 3300003316 rootH1_10150610 rootH1_101506102 128
176 3300003771 Ga0055526_1070206 Ga0055526_10702062 128
177 3300005842 Ga0068858_100340634 Ga0068858_1003406341 128
178 3300017792 Ga0163161_10616919 Ga0163161_106169192 128
179 3300025298 Ga0209050_1037690 Ga0209050_10376902 128
180 3300025299 Ga0209256_1001877 Ga0209256_100187714 128
181 3300025299 Ga0209256_1004997 Ga0209256_10049977 128
182 3300025299 Ga0209256_1071125 Ga0209256_10711251 128
183 3300025913 Ga0207695_10756224 Ga0207695_107562242 128
184 3300028794 Ga0307515_10864573 Ga0307515_108645731 128
185 3300031456 Ga0307513_10385927 Ga0307513_103859272 128
186 3300031824 Ga0307413_10018106 Ga0307413_100181062 128
187 3300031852 Ga0307410_10071899 Ga0307410_100718992 128
188 3300031903 Ga0307407_10464396 Ga0307407_104643961 128
189 3300031995 Ga0307409_101650761 Ga0307409_1016507612 128
190 3300032004 Ga0307414_10832332 Ga0307414_108323322 128
191 3300032005 Ga0307411_10013406 Ga0307411_100134063 128
192 3300033180 Ga0307510_10145190 Ga0307510_101451903 128
193 3300037418 Ga0395900_0259467 Ga0395900_0259467_224_619 128
194 3300041413 Ga0439465_0046137 Ga0439465_0046137_656_1051 128
195 3300046460 Ga0495638_0001122 Ga0495638_0001122_21268_21663 128
196 3300046460 Ga0495638_0005052 Ga0495638_0005052_7513_7908 128
197 3300046460 Ga0495638_0116157 Ga0495638_0116157_595_984 128
198 3300046471 Ga0495650_0000020 Ga0495650_0000020_376667_377062 128
199 3300046492 Ga0495585_0325341 Ga0495585_0325341_51_446 128
200 3300046506 Ga0495583_0000001 Ga0495583_0000001_134923_135312 128
201 3300046507 Ga0495606_0489305 Ga0495606_0489305_120_515 128
202 3300046524 Ga0495648_0072414 Ga0495648_0072414_581_976 128
203 3300046524 Ga0495648_0117811 Ga0495648_0117811_810_1205 128
204 3300046530 Ga0495654_0000139 Ga0495654_0000139_47900_48295 128
205 3300046660 Ga0495625_0002840 Ga0495625_0002840_12041_12436 128
206 3300046660 Ga0495625_0014666 Ga0495625_0014666_439_834 128
207 3300046660 Ga0495625_0052573 Ga0495625_0052573_760_1155 128
208 3300046664 Ga0495659_0074061 Ga0495659_0074061_641_1036 128
209 3300047323 Ga0495683_0011776 Ga0495683_0011776_3097_3492 128
210 3300047469 Ga0495673_0001209 Ga0495673_0001209_11144_11539 128
211 3300047470 Ga0495681_0060647 Ga0495681_0060647_949_1344 128
212 3300047472 Ga0495686_0464601 Ga0495686_0464601_91_486 128
213 3300048909 Ga0496106_0023443 Ga0496106_0023443_3793_4188 128
214 3300048910 Ga0496107_0000686 Ga0496107_0000686_1649_2044 128
215 3300048918 Ga0496115_0005747 Ga0496115_0005747_8510_8905 128
216 3300048924 Ga0496121_0008376 Ga0496121_0008376_10417_10812 128
217 3300048924 Ga0496121_0379111 Ga0496121_0379111_81_494 128
218 3300048926 Ga0496123_0247237 Ga0496123_0247237_250_645 128
219 3300049671 Ga0501238_002667 Ga0501238_002667_861_1256 128
220 3300049686 Ga0501257_001441 Ga0501257_001441_4498_4893 128
221 3300053094 Ga0500566_0440140 Ga0500566_0440140_41_436 128
222 3300053102 Ga0500554_001284 Ga0500554_001284_177_572 128
223 3300053103 Ga0500555_063598 Ga0500555_063598_200_595 128
224 3300053123 Ga0500614_015098 Ga0500614_015098_243_638 128
225 3300053136 Ga0500559_0000024 Ga0500559_0000024_74370_74759 128
226 3300053153 Ga0500616_0060718 Ga0500616_0060718_1345_1740 128
227 3300053156 Ga0500622_0004633 Ga0500622_0004633_6129_6626 128
228 3300053156 Ga0500622_0049279 Ga0500622_0049279_132_527 128
229 3300053158 Ga0500627_0028479 Ga0500627_0028479_1467_1862 128
230 3300053730 Ga0500645_001427 Ga0500645_001427_6613_7008 128
231 3300005467 Ga0070706_100814503 Ga0070706_1008145031 129
232 3300025924 Ga0207694_11186005 Ga0207694_111860051 129
233 3300045836 Ga0466958_0606538 Ga0466958_0606538_174_563 129
234 3300045976 Ga0466967_0041677 Ga0466967_0041677_565_954 129
235 3300046455 Ga0495603_0004114 Ga0495603_0004114_4776_5165 129
236 3300046459 Ga0495629_0003839 Ga0495629_0003839_7671_8060 129
237 3300046492 Ga0495585_0204093 Ga0495585_0204093_90_479 129
238 3300046689 Ga0495613_0001373 Ga0495613_0001373_18137_18526 129
239 3300047321 Ga0495676_0001866 Ga0495676_0001866_15283_15672 129
240 3300048089 Ga0495614_0017835 Ga0495614_0017835_56_445 129
241 3300049581 Ga0501047_0435248 Ga0501047_0435248_194_583 129
242 3300049823 Ga0501044_0135883 Ga0501044_0135883_399_788 129
243 iso_pu_bacteria 2954002825 2954008175 129
244 3300001989 JGI24739J22299_10011593 JGI24739J22299_100115934 130
245 3300002987 JGI25159J45721_1030727 JGI25159J45721_10307271 130
246 3300003316 rootH1_10076356 rootH1_100763561 130
247 3300003578 Ga0006562J51391_1122148 Ga0006562J51391_11221482 130
248 3300003771 Ga0055526_1014846 Ga0055526_10148462 130
249 3300003775 Ga0055524_1014975 Ga0055524_10149753 130
250 3300003781 Ga0055536_1028632 Ga0055536_10286322 130
251 3300003791 Ga0055530_10003584 Ga0055530_1000358410 130
252 3300003794 Ga0055531_10012887 Ga0055531_100128874 130
253 3300003794 Ga0055531_10020641 Ga0055531_100206413 130
254 3300005563 Ga0068855_100218455 Ga0068855_1002184552 130
255 3300006042 Ga0075368_10001577 Ga0075368_100015775 130
256 3300006178 Ga0075367_10000756 Ga0075367_100007569 130
257 3300009011 Ga0105251_10029518 Ga0105251_100295182 130
258 3300009092 Ga0105250_10121210 Ga0105250_101212101 130
259 3300011119 Ga0105246_10254727 Ga0105246_102547272 130
260 3300011119 Ga0105246_10488298 Ga0105246_104882982 130
261 3300014325 Ga0163163_12956434 Ga0163163_129564341 130
262 3300015262 Ga0182007_10002837 Ga0182007_1000283710 130
263 3300015688 Ga0183367_1003 Ga0183367_1003657 130
264 3300025284 Ga0209130_1020065 Ga0209130_10200652 130
265 3300025291 Ga0209675_1020554 Ga0209675_10205542 130
266 3300025292 Ga0209676_1009537 Ga0209676_10095373 130
267 3300025295 Ga0209564_1011871 Ga0209564_10118713 130
268 3300025295 Ga0209564_1014075 Ga0209564_10140752 130
269 3300025298 Ga0209050_1007155 Ga0209050_10071556 130
270 3300025299 Ga0209256_1004465 Ga0209256_10044654 130
271 3300025302 Ga0207426_1012186 Ga0207426_10121862 130
272 3300025303 Ga0209051_1005290 Ga0209051_10052906 130
273 3300025304 Ga0209257_1001577 Ga0209257_100157713 130
274 3300025304 Ga0209257_1001627 Ga0209257_100162713 130
275 3300025304 Ga0209257_1016283 Ga0209257_10162832 130
276 3300025735 Ga0207713_1039049 Ga0207713_10390492 130
277 3300025904 Ga0207647_10028881 Ga0207647_100288812 130
278 3300025935 Ga0207709_10915756 Ga0207709_109157562 130
279 3300026078 Ga0207702_10846875 Ga0207702_108468752 130
280 3300028786 Ga0307517_10010035 Ga0307517_1001003513 130
281 3300028794 Ga0307515_10000106 Ga0307515_10000106108 130
282 3300028794 Ga0307515_10099088 Ga0307515_100990883 130
283 3300030521 Ga0307511_10000047 Ga0307511_1000004727 130
284 3300030522 Ga0307512_10008193 Ga0307512_1000819311 130
285 3300031456 Ga0307513_10023854 Ga0307513_100238547 130
286 3300031456 Ga0307513_10045521 Ga0307513_100455212 130
287 3300031507 Ga0307509_10013866 Ga0307509_100138662 130
288 3300031507 Ga0307509_10049136 Ga0307509_100491364 130
289 3300031616 Ga0307508_10031447 Ga0307508_100314476 130
290 3300031616 Ga0307508_10090434 Ga0307508_100904341 130
291 3300031616 Ga0307508_10495153 Ga0307508_104951532 130
292 3300031649 Ga0307514_10009865 Ga0307514_100098656 130
293 3300031730 Ga0307516_10000711 Ga0307516_1000071119 130
294 3300031730 Ga0307516_10077906 Ga0307516_100779064 130
295 3300031838 Ga0307518_10021394 Ga0307518_100213944 130
296 3300031838 Ga0307518_10086921 Ga0307518_100869212 130
297 3300031838 Ga0307518_10096471 Ga0307518_100964712 130
298 3300031838 Ga0307518_10229030 Ga0307518_102290302 130
299 3300031838 Ga0307518_10239372 Ga0307518_102393722 130
300 3300033179 Ga0307507_10132376 Ga0307507_101323762 130
301 3300033179 Ga0307507_10167612 Ga0307507_101676121 130
302 3300033180 Ga0307510_10007245 Ga0307510_1000724513 130
303 3300037418 Ga0395900_0371675 Ga0395900_0371675_599_994 130
304 3300037466 Ga0395898_0003326 Ga0395898_0003326_15741_16136 130
305 3300037466 Ga0395898_0006955 Ga0395898_0006955_1787_2179 130
306 3300037471 Ga0395905_0927288 Ga0395905_0927288_32_424 130
307 3300037471 Ga0395905_1562207 Ga0395905_1562207_56_451 130
308 3300038443 Ga0395901_0464434 Ga0395901_0464434_409_804 130
309 3300041404 Ga0439436_0006905 Ga0439436_0006905_3010_3432 130
310 3300041406 Ga0439439_0000318 Ga0439439_0000318_2728_3120 130
311 3300041406 Ga0439439_0135326 Ga0439439_0135326_87_509 130
312 3300041458 Ga0451798_0291059 Ga0451798_0291059_105_500 130
313 3300041463 Ga0451804_0266230 Ga0451804_0266230_127_561 130
314 3300041494 Ga0451837_0737301 Ga0451837_0737301_2272_2682 130
315 3300041999 Ga0439433_0058830 Ga0439433_0058830_200_592 130
316 3300042002 Ga0439442_135618 Ga0439442_135618_48_440 130
317 3300042005 Ga0439448_0020712 Ga0439448_0020712_1002_1394 130
318 3300042006 Ga0439432_028884 Ga0439432_028884_491_883 130
319 3300042007 Ga0439449_0002621 Ga0439449_0002621_2266_2661 130
320 3300042007 Ga0439449_0009152 Ga0439449_0009152_2485_2877 130
321 3300042007 Ga0439449_0013898 Ga0439449_0013898_1435_1827 130
322 3300042007 Ga0439449_0059227 Ga0439449_0059227_950_1345 130
323 3300042008 Ga0439450_109348 Ga0439450_109348_273_665 130
324 3300042014 Ga0439457_000615 Ga0439457_000615_58_495 130
325 3300042014 Ga0439457_007274 Ga0439457_007274_1126_1518 130
326 3300042132 Ga0450895_030545 Ga0450895_030545_63_461 130
327 3300042133 Ga0450896_052451 Ga0450896_052451_182_580 130
328 3300042134 Ga0450898_003545 Ga0450898_003545_1174_1572 130
329 3300042135 Ga0450899_001587 Ga0450899_001587_248_643 130
330 3300042138 Ga0450903_000207 Ga0450903_000207_1436_1828 130
331 3300042145 Ga0450906_002372 Ga0450906_002372_1404_1802 130
332 3300042157 Ga0439458_0023621 Ga0439458_0023621_308_700 130
333 3300042157 Ga0439458_0065591 Ga0439458_0065591_322_714 130
334 3300042184 Ga0450908_019732 Ga0450908_019732_474_872 130
335 3300044656 Ga0466969_0016573 Ga0466969_0016573_1419_1814 130
336 3300044658 Ga0466972_0006377 Ga0466972_0006377_4443_4838 130
337 3300044658 Ga0466972_0076214 Ga0466972_0076214_592_984 130
338 3300044658 Ga0466972_0260850 Ga0466972_0260850_382_774 130
339 3300044683 Ga0466965_0027062 Ga0466965_0027062_2176_2571 130
340 3300044684 Ga0466966_0001620 Ga0466966_0001620_11802_12197 130
341 3300044693 Ga0466961_0322146 Ga0466961_0322146_466_861 130
342 3300044694 Ga0466963_0000279 Ga0466963_0000279_8950_9345 130
343 3300044694 Ga0466963_0004465 Ga0466963_0004465_5794_6195 130
344 3300044706 Ga0466964_0003280 Ga0466964_0003280_1966_2361 130
345 3300044719 Ga0466971_0012611 Ga0466971_0012611_2302_2697 130
346 3300044765 Ga0466970_0001245 Ga0466970_0001245_1969_2367 130
347 3300044765 Ga0466970_0002248 Ga0466970_0002248_8846_9241 130
348 3300044842 Ga0466957_0000404 Ga0466957_0000404_209_604 130
349 3300044842 Ga0466957_0725584 Ga0466957_0725584_285_680 130
350 3300045049 Ga0466959_0000297 Ga0466959_0000297_4852_5247 130
351 3300045836 Ga0466958_0000301 Ga0466958_0000301_18515_18910 130
352 3300045976 Ga0466967_0034626 Ga0466967_0034626_210_605 130
353 3300045976 Ga0466967_0335912 Ga0466967_0335912_964_1365 130
354 3300045976 Ga0466967_1558213 Ga0466967_1558213_23_415 130
355 3300045976 Ga0466967_1945349 Ga0466967_1945349_19_417 130
356 3300046454 Ga0495592_0141436 Ga0495592_0141436_746_1141 130
357 3300046459 Ga0495629_0002482 Ga0495629_0002482_11358_11753 130
358 3300046459 Ga0495629_0020046 Ga0495629_0020046_3912_4307 130
359 3300046460 Ga0495638_0085893 Ga0495638_0085893_1480_1875 130
360 3300046462 Ga0495651_0005915 Ga0495651_0005915_2026_2421 130
361 3300046473 Ga0495582_0047463 Ga0495582_0047463_1937_2329 130
362 3300046473 Ga0495582_0750867 Ga0495582_0750867_46_441 130
363 3300046476 Ga0495662_0003831 Ga0495662_0003831_1199_1591 130
364 3300046477 Ga0495664_0000236 Ga0495664_0000236_8334_8729 130
365 3300046517 Ga0495630_0453857 Ga0495630_0453857_558_953 130
366 3300046522 Ga0495643_0224134 Ga0495643_0224134_88_483 130
367 3300046536 Ga0495587_0037649 Ga0495587_0037649_2016_2411 130
368 3300046559 Ga0495667_0041540 Ga0495667_0041540_76_468 130
369 3300046642 Ga0495634_0003864 Ga0495634_0003864_9846_10241 130
370 3300046660 Ga0495625_0004908 Ga0495625_0004908_5639_6034 130
371 3300046660 Ga0495625_0017874 Ga0495625_0017874_2555_2956 130
372 3300046660 Ga0495625_0165800 Ga0495625_0165800_1059_1451 130
373 3300046663 Ga0495635_0000810 Ga0495635_0000810_19045_19440 130
374 3300046674 Ga0495588_0071459 Ga0495588_0071459_478_873 130
375 3300046675 Ga0495657_0002703 Ga0495657_0002703_11571_11963 130
376 3300046675 Ga0495657_0005545 Ga0495657_0005545_1107_1502 130
377 3300046680 Ga0495646_0005201 Ga0495646_0005201_4856_5251 130
378 3300046683 Ga0495658_0329277 Ga0495658_0329277_467_862 130
379 3300046689 Ga0495613_0000319 Ga0495613_0000319_21612_22007 130
380 3300046689 Ga0495613_0002293 Ga0495613_0002293_6950_7342 130
381 3300046689 Ga0495613_0109334 Ga0495613_0109334_363_755 130
382 3300046692 Ga0495671_0010037 Ga0495671_0010037_4759_5154 130
383 3300046694 Ga0495649_0060966 Ga0495649_0060966_30_422 130
384 3300046809 Ga0495600_0009396 Ga0495600_0009396_979_1374 130
385 3300046809 Ga0495600_0669583 Ga0495600_0669583_35_427 130
386 3300047315 Ga0495581_0341193 Ga0495581_0341193_369_764 130
387 3300047317 Ga0495604_0006154 Ga0495604_0006154_8292_8687 130
388 3300047318 Ga0495636_0028114 Ga0495636_0028114_1362_1760 130
389 3300047321 Ga0495676_0010735 Ga0495676_0010735_6008_6403 130
390 3300047443 Ga0495687_008166 Ga0495687_008166_905_1300 130
391 3300047443 Ga0495687_041189 Ga0495687_041189_1466_1858 130
392 3300047444 Ga0495675_0762699 Ga0495675_0762699_70_465 130
393 3300047447 Ga0495685_021298 Ga0495685_021298_90_482 130
394 3300047447 Ga0495685_024469 Ga0495685_024469_955_1353 130
395 3300047470 Ga0495681_0095551 Ga0495681_0095551_125_520 130
396 3300047471 Ga0495684_0258479 Ga0495684_0258479_55_450 130
397 3300047472 Ga0495686_0053304 Ga0495686_0053304_2023_2415 130
398 3300047673 Ga0495593_0001745 Ga0495593_0001745_8661_9056 130
399 3300048088 Ga0495602_0337877 Ga0495602_0337877_286_681 130
400 3300048089 Ga0495614_0021194 Ga0495614_0021194_467_862 130
401 3300048089 Ga0495614_0054329 Ga0495614_0054329_1266_1661 130
402 3300048910 Ga0496107_0490133 Ga0496107_0490133_130_522 130
403 3300048912 Ga0496109_0038340 Ga0496109_0038340_3001_3393 130
404 3300048929 Ga0496126_1217481 Ga0496126_1217481_59_451 130
405 3300049129 Ga0501309_043874 Ga0501309_043874_13_405 130
406 3300049161 Ga0501305_072179 Ga0501305_072179_13_405 130
407 3300049529 Ga0501313_020618 Ga0501313_020618_272_664 130
408 3300049539 Ga0501323_044169 Ga0501323_044169_12_404 130
409 3300049569 Ga0501032_0037378 Ga0501032_0037378_1913_2317 130
410 3300049570 Ga0501033_0001100 Ga0501033_0001100_9923_10315 130
411 3300049570 Ga0501033_0039109 Ga0501033_0039109_1778_2182 130
412 3300049571 Ga0501034_0002133 Ga0501034_0002133_8339_8731 130
413 3300049571 Ga0501034_0013923 Ga0501034_0013923_6454_6858 130
414 3300049571 Ga0501034_0017466 Ga0501034_0017466_439_831 130
415 3300049572 Ga0501036_0000299 Ga0501036_0000299_7770_8162 130
416 3300049573 Ga0501037_0118183 Ga0501037_0118183_110_514 130
417 3300049574 Ga0501038_0028754 Ga0501038_0028754_2660_3052 130
418 3300049574 Ga0501038_0454792 Ga0501038_0454792_137_529 130
419 3300049575 Ga0501039_0033141 Ga0501039_0033141_216_608 130
420 3300049578 Ga0501042_0315020 Ga0501042_0315020_634_1038 130
421 3300049579 Ga0501043_0014843 Ga0501043_0014843_89_481 130
422 3300049579 Ga0501043_0074976 Ga0501043_0074976_831_1235 130
423 3300049580 Ga0501046_0051123 Ga0501046_0051123_2072_2476 130
424 3300049581 Ga0501047_0365811 Ga0501047_0365811_419_823 130
425 3300049582 Ga0501048_0860904 Ga0501048_0860904_129_542 130
426 3300049586 Ga0501070_0000250 Ga0501070_0000250_22499_22891 130
427 3300049586 Ga0501070_0362933 Ga0501070_0362933_650_1042 130
428 3300049586 Ga0501070_0851648 Ga0501070_0851648_193_585 130
429 3300049590 Ga0501074_0003360 Ga0501074_0003360_8280_8672 130
430 3300049744 Ga0501083_0287574 Ga0501083_0287574_649_1053 130
431 3300049822 Ga0501035_0001274 Ga0501035_0001274_8333_8725 130
432 3300049823 Ga0501044_0404314 Ga0501044_0404314_291_695 130
433 3300050494 nmdc:mga06z11_1372_c1 nmdc:mga06z11_1372_c1_7029_7421 130
434 3300050495 nmdc:mga04h51_1187_c1 nmdc:mga04h51_1187_c1_5090_5482 130
435 3300053091 Ga0500647_0134150 Ga0500647_0134150_401_796 130
436 3300053092 Ga0500583_0092214 Ga0500583_0092214_567_962 130
437 3300053095 Ga0500640_140275 Ga0500640_140275_489_884 130
438 3300053101 Ga0500553_130203 Ga0500553_130203_433_828 130
439 3300053111 Ga0500572_112095 Ga0500572_112095_431_826 130
440 3300053123 Ga0500614_035765 Ga0500614_035765_130_525 130
441 3300053129 Ga0500628_083743 Ga0500628_083743_72_464 130
442 3300053140 Ga0500573_0244275 Ga0500573_0244275_410_805 130
443 3300053149 Ga0500600_0232526 Ga0500600_0232526_23_415 130
444 3300053149 Ga0500600_0391196 Ga0500600_0391196_142_537 130
445 3300053157 Ga0500624_007070 Ga0500624_007070_472_867 130
446 3300053160 Ga0500633_0139036 Ga0500633_0139036_103_498 130
447 3300061719 Ga0466962_0285779 Ga0466962_0285779_338_733 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

133

0.95

PF18029

Glyoxalase_6

Glyoxalase-like domain

17

134

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8597 1 130
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8536 1 126
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8536 1 130
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.851 2 127
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8474 1 129
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8985 79 129 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8889 80 125 3.30.720.110
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8546 1 57 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8432 79 130 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8316 76 130 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A7W1AHX0-F1-model_v4 VOC family protein 0.9965 66 129
AF-A0A3D9QZ27-F1-model_v4 deleted 0.9958 1 130
AF-A0A4Y4KGV7-F1-model_v4 VOC domain-containing protein 0.9953 1 129
AF-A0A528JPJ1-F1-model_v4 VOC domain-containing protein 0.9939 74 130
AF-A0A840VT45-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9899 1 130 GO:0016829
GO:0051213

Feature Viewer

pLDDT pTM Quality
95.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map