F446052

General Info

Members Datasets Scaffolds Average Seq Length
447 267 425 192

Family's Representative Sequence

Representative Sequence 3300053086|Ga0500578_0159206|Ga0500578_0159206_503_1177
Length 224
Sequence LPNLTLDSKDCFDHFWPFLHVAYPTTHYSTIAGMKFLLIGLGNIGEDYAYTRHNIGFDVVDAFAQKHGGLFGVGRLAHVCELKWKGKKLTIIKPTTYMNLSGKAVKYWIEKESVALEQLLVIVDDIALPLSKIRLRSSGSSAGHNGLRSIEETLLTDKYPRLRFGVGNNFPKGAQADFVLSRWTPEESPLVKRKVEKCVEVVENFITIGIERTMNEANKLEFTL

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2738541302 Pedobacter sp. CF074 Isolate Unclassified
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2739367651 Pedobacter sp. OK291 Isolate Unclassified
6 2739367656 Pedobacter sp. CF523 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
9 2818991437 Pedobacter terrae 518 Isolate Unclassified
10 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
11 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
12 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
13 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
14 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
15 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
16 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
17 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
18 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
19 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
20 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
21 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
22 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
148 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
149 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
150 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
151 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
178 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
185 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
246 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
247 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
251 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
252 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
255 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
256 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
258 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
259 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
260 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
261 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
264 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
265 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0.22
Isolates 4.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.83
Nodule 0
Rhizoplane 2.01
Rhizosphere 84.12
Stem 0
Stem Tuber 0
Unclassified 6.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000006 3300002773 Bacteria 158516
2 JGI25150J39212_1000005 3300002774 Bacteria 311800
3 JGI25151J46595_10000004 3300003187 Bacteria 494006
4 JGI25153J46596_10000004 3300003215 Bacteria 494006
5 rootL2_10082792 3300003322 Unclassified 3858
6 rootH1_10303714 3300003323 Bacteria 2012
7 Ga0055536_1000016 3300003781 Bacteria 222134
8 Ga0055530_10005786 3300003791 Bacteria 5740
9 Ga0065714_10002573 3300005288 Bacteria 14218
10 Ga0065714_10002973 3300005288 Bacteria 13923
11 Ga0065714_10012335 3300005288 Bacteria 1821
12 Ga0065714_10070557 3300005288 Bacteria 3832
13 Ga0065714_10078139 3300005288 Bacteria 2610
14 Ga0065714_10134859 3300005288 Bacteria 1218
15 Ga0065704_10070246 3300005289 Bacteria 48710
16 Ga0065704_10087243 3300005289 Bacteria 3043
17 Ga0065704_10246133 3300005289 Bacteria 1002
18 Ga0070676_10004845 3300005328 Bacteria 7122
19 Ga0070683_100021602 3300005329 Bacteria 5745
20 Ga0070683_100349723 3300005329 Bacteria 1408
21 Ga0070683_100656784 3300005329 Unclassified 1004
22 Ga0070670_100360435 3300005331 Bacteria 1278
23 Ga0070666_10003308 3300005335 Bacteria 9771
24 Ga0068868_100013965 3300005338 Bacteria 5908
25 Ga0070660_100209481 3300005339 Bacteria 1582
26 Ga0070675_100128933 3300005354 Unclassified 2154
27 Ga0070674_100151986 3300005356 Bacteria 1748
28 Ga0070673_100377221 3300005364 Unclassified 1264
29 Ga0070659_100421563 3300005366 Bacteria 1129
30 Ga0070667_100000957 3300005367 Bacteria 26589
31 Ga0070667_100220620 3300005367 Bacteria 1688
32 Ga0070667_100635095 3300005367 Bacteria 985
33 Ga0070667_100761816 3300005367 Bacteria 898
34 Ga0070709_10136077 3300005434 Bacteria 1683
35 Ga0070709_10236797 3300005434 Unclassified 1309
36 Ga0070698_100129915 3300005471 Bacteria 2475
37 Ga0070684_100168610 3300005535 Bacteria 1988
38 Ga0068853_100076028 3300005539 Bacteria 2931
39 Ga0070672_100000365 3300005543 Bacteria 26063
40 Ga0070665_100000013 3300005548 Bacteria 484927
41 Ga0070665_100001739 3300005548 Bacteria 24906
42 Ga0070665_100242951 3300005548 Bacteria 1801
43 Ga0068855_100039247 3300005563 Bacteria 5621
44 Ga0068855_100097359 3300005563 Unclassified 3389
45 Ga0068855_100129056 3300005563 Bacteria 2888
46 Ga0070664_101307906 3300005564 Unclassified 685
47 Ga0068857_100076672 3300005577 Bacteria 2982
48 Ga0068856_100117366 3300005614 Bacteria 2662
49 Ga0068856_100123662 3300005614 Bacteria 2590
50 Ga0068852_100000197 3300005616 Bacteria 41267
51 Ga0068852_100674548 3300005616 Bacteria 1042
52 Ga0068864_100000176 3300005618 Bacteria 59064
53 Ga0068864_100107907 3300005618 Bacteria 2477
54 Ga0068861_100041841 3300005719 Bacteria 3433
55 Ga0068851_10000284 3300005834 Bacteria 23388
56 Ga0068863_100001185 3300005841 Bacteria 26042
57 Ga0068863_100170020 3300005841 Unclassified 2090
58 Ga0068863_100438642 3300005841 Unclassified 1280
59 Ga0068863_100737536 3300005841 Bacteria 980
60 Ga0068858_100201144 3300005842 Bacteria 1884
61 Ga0068860_100000060 3300005843 Bacteria 195631
62 Ga0068860_100004691 3300005843 Bacteria 13946
63 Ga0068860_100412559 3300005843 Bacteria 1338
64 Ga0070717_10304216 3300006028 Bacteria 1418
65 Ga0070717_10312939 3300006028 Unclassified 1398
66 Ga0075366_10293392 3300006195 Bacteria 994
67 Ga0097621_100282052 3300006237 Bacteria 1462
68 Ga0097621_100556836 3300006237 Bacteria 1044
69 Ga0068871_100069347 3300006358 Unclassified 2895
70 Ga0068871_100491816 3300006358 Bacteria 1105
71 Ga0105244_10006081 3300009036 Bacteria 7892
72 Ga0105240_10000570 3300009093 Bacteria 68288
73 Ga0105240_10003646 3300009093 Bacteria 23852
74 Ga0105240_10135655 3300009093 Bacteria 2948
75 Ga0105240_10186114 3300009093 Bacteria 2446
76 Ga0105240_10244571 3300009093 Unclassified 2078
77 Ga0105240_10274589 3300009093 Bacteria 1939
78 Ga0105240_10439339 3300009093 Bacteria 1462
79 Ga0111539_10551517 3300009094 Bacteria 1342
80 Ga0114129_11344376 3300009147 Bacteria 884
81 Ga0105243_10584906 3300009148 Bacteria 1072
82 Ga0105241_10004753 3300009174 Bacteria 10008
83 Ga0105241_10074540 3300009174 Bacteria 2643
84 Ga0105241_10259505 3300009174 Bacteria 1476
85 Ga0105241_10278730 3300009174 Unclassified 1427
86 Ga0105241_10863934 3300009174 Unclassified 838
87 Ga0105242_10059155 3300009176 Bacteria 3143
88 Ga0105242_10605725 3300009176 Unclassified 1059
89 Ga0105237_10008171 3300009545 Bacteria 11369
90 Ga0105237_10008278 3300009545 Bacteria 11293
91 Ga0105237_10010165 3300009545 Bacteria 10027
92 Ga0105237_10045930 3300009545 Bacteria 4394
93 Ga0105237_10219405 3300009545 Bacteria 1902
94 Ga0105238_10002790 3300009551 Bacteria 17438
95 Ga0105238_10075124 3300009551 Bacteria 3371
96 Ga0105238_10218932 3300009551 Bacteria 1880
97 Ga0105238_11065592 3300009551 Unclassified 830
98 Ga0105249_10031809 3300009553 Bacteria 4773
99 Ga0105249_10236781 3300009553 Unclassified 1803
100 Ga0105239_10093588 3300010375 Bacteria 3318
101 Ga0105239_10454171 3300010375 Bacteria 1454
102 Ga0105246_10046004 3300011119 Bacteria 2975
103 Ga0105246_10426411 3300011119 Bacteria 1108
104 Ga0157373_10001474 3300013100 Bacteria 17936
105 Ga0157373_10002252 3300013100 Bacteria 14613
106 Ga0157373_10027194 3300013100 Bacteria 4126
107 Ga0157373_10172945 3300013100 Bacteria 1520
108 Ga0157373_10278306 3300013100 Bacteria 1185
109 Ga0157371_10003596 3300013102 Bacteria 13968
110 Ga0157371_10003601 3300013102 Bacteria 13954
111 Ga0157371_10010108 3300013102 Bacteria 7374
112 Ga0157370_10000084 3300013104 Bacteria 104159
113 Ga0157370_10002073 3300013104 Bacteria 24536
114 Ga0157370_10005660 3300013104 Bacteria 13968
115 Ga0157370_10007536 3300013104 Bacteria 11823
116 Ga0157370_10188858 3300013104 Bacteria 1913
117 Ga0157370_10327999 3300013104 Bacteria 1411
118 Ga0157370_10334375 3300013104 Bacteria 1396
119 Ga0157370_10526309 3300013104 Bacteria 1085
120 Ga0157370_10702972 3300013104 Bacteria 923
121 Ga0157369_10000169 3300013105 Bacteria 91977
122 Ga0157369_10068203 3300013105 Bacteria 3821
123 Ga0157369_10089382 3300013105 Bacteria 3289
124 Ga0157369_10248251 3300013105 Unclassified 1858
125 Ga0157369_10649231 3300013105 Bacteria 1088
126 Ga0157369_10905271 3300013105 Bacteria 905
127 Ga0157369_10947369 3300013105 Unclassified 882
128 Ga0157374_10105846 3300013296 Bacteria 2702
129 Ga0157374_10177769 3300013296 Unclassified 2078
130 Ga0157374_10636500 3300013296 Bacteria 1078
131 Ga0157378_10099893 3300013297 Unclassified 2648
132 Ga0157378_10670928 3300013297 Bacteria 1054
133 Ga0157378_10718499 3300013297 Bacteria 1020
134 Ga0163162_10000349 3300013306 Bacteria 42017
135 Ga0163162_10000814 3300013306 Bacteria 28937
136 Ga0163162_10005561 3300013306 Bacteria 12192
137 Ga0163162_10293792 3300013306 Bacteria 1756
138 Ga0163162_11057801 3300013306 Bacteria 919
139 Ga0163162_11645470 3300013306 Unclassified 733
140 Ga0157372_10006107 3300013307 Bacteria 12799
141 Ga0157372_10102941 3300013307 Unclassified 3262
142 Ga0157372_10904358 3300013307 Bacteria 1024
143 Ga0157372_10995621 3300013307 Bacteria 971
144 Ga0157375_10083834 3300013308 Bacteria 3233
145 Ga0157375_10461289 3300013308 Unclassified 1436
146 Ga0163163_10329292 3300014325 Bacteria 1582
147 Ga0163163_10503874 3300014325 Unclassified 1272
148 Ga0182008_10000002 3300014497 Bacteria 480216
149 Ga0182008_10000631 3300014497 Bacteria 25814
150 Ga0182008_10000693 3300014497 Bacteria 24266
151 Ga0157379_10001247 3300014968 Bacteria 20630
152 Ga0157376_10004019 3300014969 Bacteria 10179
153 Ga0157376_10089641 3300014969 Bacteria 2660
154 Ga0157376_10384911 3300014969 Bacteria 1352
155 Ga0157376_10491680 3300014969 Unclassified 1204
156 Ga0182006_1000806 3300015261 Bacteria 21001
157 Ga0182006_1008166 3300015261 Bacteria 4750
158 Ga0182006_1009814 3300015261 Bacteria 4280
159 Ga0182006_1016044 3300015261 Bacteria 3201
160 Ga0182006_1020991 3300015261 Bacteria 2729
161 Ga0182007_10000016 3300015262 Bacteria 202375
162 Ga0182005_1064104 3300015265 Unclassified 1005
163 Ga0183373_1012 3300015682 Bacteria 118834
164 Ga0163161_10001031 3300017792 Bacteria 21233
165 Ga0163161_10001633 3300017792 Bacteria 16487
166 Ga0163161_10003521 3300017792 Bacteria 10960
167 Ga0163161_10006424 3300017792 Bacteria 8136
168 Ga0163161_10129316 3300017792 Unclassified 1904
169 Ga0163161_10260023 3300017792 Bacteria 1356
170 Ga0163161_10458063 3300017792 Bacteria 1032
171 Ga0163161_10912923 3300017792 Bacteria 745
172 Ga0163161_10914303 3300017792 Bacteria 744
173 Ga0213876_10109631 3300021384 Unclassified 1465
174 Ga0213871_10001505 3300021441 Bacteria 3938
175 Ga0207425_1000008 3300025245 Bacteria 618024
176 Ga0209646_1002266 3300025246 Bacteria 4408
177 Ga0209129_1000040 3300025258 Bacteria 313043
178 Ga0209676_1000106 3300025292 Bacteria 222576
179 Ga0209025_1000020 3300025294 Bacteria 618024
180 Ga0209758_1000022 3300025297 Bacteria 618024
181 Ga0209050_1000174 3300025298 Bacteria 148871
182 Ga0209051_1060899 3300025303 Bacteria 1189
183 Ga0207656_10001476 3300025321 Bacteria 7789
184 Ga0207655_1012720 3300025728 Bacteria 4890
185 Ga0207680_10003588 3300025903 Bacteria 7291
186 Ga0207680_10238812 3300025903 Bacteria 1251
187 Ga0207647_10094913 3300025904 Bacteria 1776
188 Ga0207685_10318642 3300025905 Bacteria 775
189 Ga0207699_10177279 3300025906 Unclassified 1430
190 Ga0207645_10012445 3300025907 Bacteria 5771
191 Ga0207705_10021772 3300025909 Bacteria 4574
192 Ga0207654_10022283 3300025911 Bacteria 3378
193 Ga0207654_10030836 3300025911 Bacteria 2947
194 Ga0207695_10005162 3300025913 Bacteria 17482
195 Ga0207695_10007643 3300025913 Bacteria 13697
196 Ga0207695_10096879 3300025913 Bacteria 2951
197 Ga0207695_10181673 3300025913 Unclassified 2024
198 Ga0207695_10302064 3300025913 Bacteria 1492
199 Ga0207695_10848581 3300025913 Bacteria 793
200 Ga0207671_10000110 3300025914 Bacteria 126480
201 Ga0207671_10002077 3300025914 Bacteria 21915
202 Ga0207671_10017404 3300025914 Bacteria 5543
203 Ga0207671_10027188 3300025914 Bacteria 4278
204 Ga0207671_10213261 3300025914 Bacteria 1511
205 Ga0207662_10064495 3300025918 Bacteria 2204
206 Ga0207646_10250248 3300025922 Bacteria 1601
207 Ga0207694_10051909 3300025924 Bacteria 3178
208 Ga0207694_10221459 3300025924 Bacteria 1544
209 Ga0207694_10270575 3300025924 Bacteria 1394
210 Ga0207694_10363461 3300025924 Unclassified 1200
211 Ga0207700_10057232 3300025928 Bacteria 2939
212 Ga0207700_10720011 3300025928 Unclassified 891
213 Ga0207706_10163648 3300025933 Bacteria 1955
214 Ga0207686_10086341 3300025934 Unclassified 2060
215 Ga0207686_10142091 3300025934 Bacteria 1661
216 Ga0207704_10273839 3300025938 Unclassified 1279
217 Ga0207665_10350874 3300025939 Unclassified 1114
218 Ga0207665_10593226 3300025939 Bacteria 864
219 Ga0207691_10000060 3300025940 Bacteria 86844
220 Ga0207711_10107541 3300025941 Bacteria 2476
221 Ga0207711_10167963 3300025941 Bacteria 1989
222 Ga0207689_10370034 3300025942 Bacteria 1192
223 Ga0207661_10010543 3300025944 Bacteria 6657
224 Ga0207661_10388430 3300025944 Unclassified 1264
225 Ga0207679_11090386 3300025945 Unclassified 733
226 Ga0207667_10000221 3300025949 Bacteria 79940
227 Ga0207667_10074678 3300025949 Bacteria 3521
228 Ga0207712_10087033 3300025961 Bacteria 2290
229 Ga0207668_10000268 3300025972 Bacteria 34571
230 Ga0207658_10237142 3300025986 Bacteria 1543
231 Ga0207677_10005966 3300026023 Bacteria 6633
232 Ga0207677_10046446 3300026023 Bacteria 2908
233 Ga0207677_10761973 3300026023 Unclassified 864
234 Ga0207703_10008010 3300026035 Bacteria 8350
235 Ga0207639_10114366 3300026041 Bacteria 2205
236 Ga0207702_10305937 3300026078 Unclassified 1510
237 Ga0207702_10326091 3300026078 Bacteria 1463
238 Ga0207641_10005697 3300026088 Bacteria 10601
239 Ga0207641_10111244 3300026088 Unclassified 2428
240 Ga0207641_10173589 3300026088 Bacteria 1970
241 Ga0207641_10649309 3300026088 Bacteria 1036
242 Ga0207648_10002360 3300026089 Bacteria 20382
243 Ga0207648_10335031 3300026089 Bacteria 1362
244 Ga0207676_10002113 3300026095 Bacteria 14399
245 Ga0207676_10078653 3300026095 Bacteria 2672
246 Ga0207676_10429559 3300026095 Unclassified 1241
247 Ga0207674_10003801 3300026116 Bacteria 18411
248 Ga0207675_100070907 3300026118 Bacteria 3257
249 Ga0207698_10007888 3300026142 Bacteria 6703
250 Ga0207698_10418885 3300026142 Bacteria 1284
251 Ga0207698_10637904 3300026142 Bacteria 1054
252 Ga0268266_10000024 3300028379 Bacteria 490820
253 Ga0268266_11329533 3300028379 Unclassified 694
254 Ga0268265_10259604 3300028380 Bacteria 1544
255 Ga0268264_10000243 3300028381 Bacteria 102854
256 Ga0268264_10004484 3300028381 Bacteria 11912
257 Ga0268264_10048348 3300028381 Bacteria 3539
258 Ga0265323_10008118 3300028653 Bacteria 4340
259 Ga0307515_10013124 3300028794 Bacteria 15508
260 Ga0307515_10512043 3300028794 Bacteria 810
261 Ga0316177_1173064 3300030731 Bacteria 1590
262 Ga0316176_1113607 3300030732 Bacteria 11503
263 Ga0316183_1107442 3300030742 Bacteria 17978
264 Ga0316181_1199804 3300030744 Bacteria 917
265 Ga0316181_1214383 3300030744 Bacteria 2615
266 Ga0265760_10023573 3300031090 Bacteria 1789
267 Ga0265331_10071884 3300031250 Bacteria 1617
268 Ga0265316_10000607 3300031344 Bacteria 39905
269 Ga0265316_10117379 3300031344 Bacteria 2011
270 Ga0265316_10198283 3300031344 Bacteria 1489
271 Ga0265316_10261066 3300031344 Unclassified 1270
272 Ga0265316_10279274 3300031344 Bacteria 1220
273 Ga0307513_10151654 3300031456 Bacteria 2225
274 Ga0307513_10238229 3300031456 Bacteria 1627
275 Ga0307509_10218654 3300031507 Bacteria 1721
276 Ga0265342_10114420 3300031712 Bacteria 1524
277 Ga0307405_10000025 3300031731 Bacteria 123095
278 Ga0307405_10053513 3300031731 Bacteria 2515
279 Ga0307407_10000016 3300031903 Bacteria 141499
280 Ga0307412_10000085 3300031911 Bacteria 88692
281 Ga0307412_10129438 3300031911 Bacteria 1831
282 Ga0307412_10168726 3300031911 Bacteria 1634
283 Ga0307412_10221691 3300031911 Bacteria 1450
284 Ga0307409_100109761 3300031995 Bacteria 2310
285 Ga0307416_100000036 3300032002 Bacteria 141505
286 Ga0307414_10000548 3300032004 Bacteria 19615
287 Ga0307414_10011329 3300032004 Bacteria 5225
288 Ga0307414_10016294 3300032004 Bacteria 4514
289 Ga0307414_10051691 3300032004 Bacteria 2854
290 Ga0307414_10141993 3300032004 Bacteria 1881
291 Ga0307414_10144247 3300032004 Bacteria 1868
292 Ga0307414_10504695 3300032004 Bacteria 1071
293 Ga0307414_10712871 3300032004 Bacteria 909
294 Ga0307411_10432161 3300032005 Bacteria 1097
295 Ga0307507_10305558 3300033179 Bacteria 971
296 Ga0373923_0176323 3300035111 Unclassified 981
297 Ga0373954_0020632 3300035118 Bacteria 2982
298 Ga0373956_0137823 3300035119 Unclassified 1145
299 Ga0373955_0362269 3300035172 Unclassified 879
300 Ga0373927_0075221 3300035695 Unclassified 2187
301 Ga0373933_0586755 3300035724 Bacteria 732
302 Ga0373947_0104864 3300035725 Unclassified 1781
303 Ga0373947_0280897 3300035725 Unclassified 1107
304 Ga0436364_0900019 3300037853 Bacteria 4884
305 Ga0436360_0196989 3300039438 Bacteria 16492
306 Ga0436361_0687955 3300039447 Unclassified 870
307 Ga0436361_1195550 3300039447 Unclassified 1010
308 Ga0439439_0007206 3300041406 Bacteria 2594
309 Ga0451791_0203047 3300041451 Bacteria 1657
310 Ga0451793_0529887 3300041452 Bacteria 1338
311 Ga0451800_0828905 3300041459 Bacteria 839
312 Ga0451802_0121489 3300041460 Bacteria 1768
313 Ga0451849_1190738 3300041505 Bacteria 1163
314 Ga0439449_0008287 3300042007 Bacteria 3953
315 Ga0439457_000008 3300042014 Bacteria 42068
316 Ga0439462_0000815 3300042015 Bacteria 6504
317 Ga0450894_015412 3300042131 Bacteria 1012
318 Ga0450893_0045960 3300042532 Bacteria 809
319 Ga0451577_0001955 3300042876 Bacteria 25990
320 Ga0466972_0027294 3300044658 Bacteria 2825
321 Ga0466972_0071677 3300044658 Bacteria 1652
322 Ga0466972_0172645 3300044658 Bacteria 1014
323 Ga0453684_0007415 3300044712 Bacteria 20187
324 Ga0453684_0639751 3300044712 Bacteria 1162
325 Ga0466968_0047844 3300044735 Bacteria 1819
326 Ga0466957_0001154 3300044842 Bacteria 13664
327 Ga0466960_0174253 3300044901 Bacteria 1163
328 Ga0451576_0019383 3300045051 Bacteria 7427
329 Ga0451576_0543317 3300045051 Bacteria 1221
330 Ga0451576_0565365 3300045051 Bacteria 1195
331 Ga0451576_0753675 3300045051 Unclassified 1023
332 Ga0495592_0033185 3300046454 Bacteria 3894
333 Ga0495651_0038977 3300046462 Bacteria 3700
334 Ga0495653_0168286 3300046463 Bacteria 1515
335 Ga0495580_0037781 3300046472 Unclassified 3462
336 Ga0495580_0078768 3300046472 Unclassified 2298
337 Ga0495580_0187578 3300046472 Unclassified 1427
338 Ga0495639_0270849 3300046475 Bacteria 843
339 Ga0495662_0017566 3300046476 Bacteria 3462
340 Ga0495664_0006701 3300046477 Bacteria 6371
341 Ga0495594_0149002 3300046499 Unclassified 1328
342 Ga0495607_0188231 3300046501 Bacteria 1030
343 Ga0495606_0015427 3300046507 Bacteria 5885
344 Ga0495608_0040514 3300046511 Bacteria 3120
345 Ga0495610_0000119 3300046512 Bacteria 89692
346 Ga0495610_0010840 3300046512 Bacteria 5628
347 Ga0495618_0009838 3300046514 Bacteria 5783
348 Ga0495628_0010921 3300046516 Bacteria 7690
349 Ga0495630_0009909 3300046517 Bacteria 6862
350 Ga0495637_0034550 3300046520 Bacteria 2213
351 Ga0495648_0003776 3300046524 Bacteria 13174
352 Ga0495652_0007150 3300046529 Bacteria 10301
353 Ga0495652_0420176 3300046529 Bacteria 942
354 Ga0495665_0070702 3300046531 Unclassified 1839
355 Ga0495665_0137529 3300046531 Unclassified 1278
356 Ga0495640_0022814 3300046533 Bacteria 4570
357 Ga0495586_0080845 3300046535 Unclassified 1786
358 Ga0495587_0026684 3300046536 Bacteria 3521
359 Ga0495587_0112245 3300046536 Bacteria 1565
360 Ga0495609_0014814 3300046538 Bacteria 3659
361 Ga0495645_0003842 3300046543 Bacteria 10223
362 Ga0495667_0042546 3300046559 Bacteria 3012
363 Ga0495634_0008872 3300046642 Bacteria 7455
364 Ga0495635_0029254 3300046663 Bacteria 3830
365 Ga0495588_0102742 3300046674 Unclassified 1503
366 Ga0495657_0202630 3300046675 Bacteria 1209
367 Ga0495599_0006439 3300046678 Bacteria 7083
368 Ga0495599_0122164 3300046678 Unclassified 1619
369 Ga0495623_0054050 3300046679 Unclassified 2534
370 Ga0495658_0393840 3300046683 Unclassified 883
371 Ga0495669_0255980 3300046684 Unclassified 841
372 Ga0495613_0047448 3300046689 Bacteria 3173
373 Ga0495604_0014207 3300047317 Bacteria 6347
374 Ga0495604_0103967 3300047317 Unclassified 2082
375 Ga0495604_0695319 3300047317 Unclassified 646
376 Ga0495674_0032395 3300047319 Bacteria 4740
377 Ga0495680_0063802 3300047322 Bacteria 2827
378 Ga0495680_0167754 3300047322 Unclassified 1591
379 Ga0495687_000014 3300047443 Bacteria 366896
380 Ga0495675_0108346 3300047444 Unclassified 1735
381 Ga0495681_0177336 3300047470 Bacteria 878
382 Ga0495684_0017619 3300047471 Bacteria 5500
383 Ga0495684_0020315 3300047471 Bacteria 5116
384 Ga0495684_0547292 3300047471 Unclassified 789
385 Ga0495686_0286582 3300047472 Bacteria 914
386 Ga0495614_0196457 3300048089 Unclassified 912
387 Ga0496102_0947588 3300048905 Bacteria 782
388 Ga0496109_0428873 3300048912 Bacteria 1249
389 Ga0496112_0220521 3300048915 Bacteria 1853
390 Ga0496115_0042380 3300048918 Bacteria 3626
391 Ga0496115_0318542 3300048918 Bacteria 1272
392 Ga0496122_0000862 3300048925 Bacteria 57049
393 Ga0496123_0003821 3300048926 Bacteria 16441
394 Ga0496125_0073301 3300048928 Bacteria 2663
395 Ga0501046_0297626 3300049580 Bacteria 1179
396 Ga0501047_0018627 3300049581 Bacteria 6657
397 Ga0501047_0246863 3300049581 Bacteria 1634
398 Ga0501223_008818 3300049663 Bacteria 2053
399 Ga0501225_0001777 3300049705 Bacteria 6748
400 Ga0501241_003707 3300049758 Bacteria 2880
401 Ga0501241_004719 3300049758 Bacteria 2543
402 Ga0501044_0021886 3300049823 Bacteria 6817
403 nmdc:mga0n895_1508675_c1 3300050512 Unclassified 638
404 Ga0500578_0000119 3300053086 Bacteria 95584
405 Ga0500578_0159206 3300053086 Bacteria 1402
406 Ga0500646_0105733 3300053090 Bacteria 889
407 Ga0500583_0000014 3300053092 Bacteria 147919
408 Ga0500583_0000841 3300053092 Bacteria 8842
409 Ga0500583_0012959 3300053092 Bacteria 3204
410 Ga0500651_0000078 3300053093 Bacteria 62741
411 Ga0500651_0533902 3300053093 Bacteria 643
412 Ga0500572_029879 3300053111 Bacteria 1511
413 Ga0500642_0032710 3300053130 Bacteria 2184
414 Ga0500652_092996 3300053131 Bacteria 1259
415 Ga0500658_0155856 3300053134 Bacteria 1032
416 Ga0500588_0057966 3300053146 Bacteria 1231
417 Ga0500603_113269 3300053150 Bacteria 816
418 Ga0500604_0110087 3300053151 Bacteria 914
419 Ga0500616_0053524 3300053153 Bacteria 2117
420 Ga0500622_0002764 3300053156 Bacteria 12347
421 Ga0500622_0035190 3300053156 Bacteria 2621
422 Ga0500633_0140207 3300053160 Bacteria 905
423 Ga0500639_164083 3300053163 Bacteria 1006
424 Ga0500611_013713 3300053727 Bacteria 1397
425 Ga0501082_0000163 3300060353 Bacteria 56753

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025941 Ga0207711_10167963 Ga0207711_101679632 156
2 3300048905 Ga0496102_0947588 Ga0496102_0947588_48_578 171
3 3300006237 Ga0097621_100282052 Ga0097621_1002820521 179
4 3300021384 Ga0213876_10109631 Ga0213876_101096312 179
5 3300039447 Ga0436361_1195550 Ga0436361_1195550_145_732 180
6 3300039447 Ga0436361_0687955 Ga0436361_0687955_234_818 181
7 3300021441 Ga0213871_10001505 Ga0213871_100015053 182
8 3300039438 Ga0436360_0196989 Ga0436360_0196989_5811_6404 182
9 iso_pu_bacteria 2585427687 2586209771 182
10 iso_pu_bacteria 2738541278 2738729080 182
11 iso_pu_bacteria 2738541302 2738854244 182
12 iso_pu_bacteria 2738543023 2739301945 182
13 iso_pu_bacteria 2739367651 2739587348 182
14 iso_pu_bacteria 2739367656 2739617486 182
15 iso_pu_bacteria 2739367663 2739647926 182
16 iso_pu_bacteria 2775506987 2776615299 182
17 iso_pu_bacteria 2818991437 2819550171 182
18 iso_pu_bacteria 2842722452 2842726795 182
19 iso_pu_bacteria 2842903701 2842908866 182
20 iso_pu_bacteria 2842909656 2842911636 182
21 iso_pu_bacteria 2849281842 2849285176 182
22 iso_pu_bacteria 2852627209 2852629083 182
23 iso_pu_bacteria 2857627736 2857630426 182
24 iso_pu_bacteria 2902048731 2902049377 182
25 iso_pu_bacteria 2904445276 2904448904 182
26 iso_pu_bacteria 2919186247 2919189040 182
27 iso_pu_bacteria 2939664404 2939666805 182
28 iso_pu_bacteria 2945997725 2946002889 182
29 iso_pu_bacteria 2954016120 2954019748 182
30 3300025933 Ga0207706_10163648 Ga0207706_101636483 184
31 3300044712 Ga0453684_0007415 Ga0453684_0007415_3990_4550 184
32 3300045051 Ga0451576_0565365 Ga0451576_0565365_504_1064 184
33 iso_pu_bacteria 8055588893 8055590817 184
34 3300005329 Ga0070683_100021602 Ga0070683_1000216027 185
35 3300005329 Ga0070683_100349723 Ga0070683_1003497232 185
36 3300005329 Ga0070683_100656784 Ga0070683_1006567842 185
37 3300005364 Ga0070673_100377221 Ga0070673_1003772213 185
38 3300005434 Ga0070709_10236797 Ga0070709_102367972 185
39 3300005535 Ga0070684_100168610 Ga0070684_1001686102 185
40 3300005548 Ga0070665_100242951 Ga0070665_1002429512 185
41 3300005563 Ga0068855_100039247 Ga0068855_1000392478 185
42 3300005841 Ga0068863_100170020 Ga0068863_1001700203 185
43 3300005841 Ga0068863_100438642 Ga0068863_1004386421 185
44 3300006028 Ga0070717_10304216 Ga0070717_103042162 185
45 3300006028 Ga0070717_10312939 Ga0070717_103129392 185
46 3300006358 Ga0068871_100491816 Ga0068871_1004918162 185
47 3300009093 Ga0105240_10003646 Ga0105240_100036463 185
48 3300009093 Ga0105240_10244571 Ga0105240_102445713 185
49 3300009094 Ga0111539_10551517 Ga0111539_105515172 185
50 3300009147 Ga0114129_11344376 Ga0114129_113443762 185
51 3300009174 Ga0105241_10278730 Ga0105241_102787302 185
52 3300009174 Ga0105241_10863934 Ga0105241_108639342 185
53 3300009176 Ga0105242_10605725 Ga0105242_106057251 185
54 3300009545 Ga0105237_10219405 Ga0105237_102194052 185
55 3300009551 Ga0105238_11065592 Ga0105238_110655921 185
56 3300009553 Ga0105249_10236781 Ga0105249_102367812 185
57 3300011119 Ga0105246_10426411 Ga0105246_104264112 185
58 3300013104 Ga0157370_10526309 Ga0157370_105263092 185
59 3300013105 Ga0157369_10089382 Ga0157369_100893823 185
60 3300013105 Ga0157369_10248251 Ga0157369_102482514 185
61 3300013105 Ga0157369_10649231 Ga0157369_106492312 185
62 3300013105 Ga0157369_10947369 Ga0157369_109473691 185
63 3300013296 Ga0157374_10177769 Ga0157374_101777692 185
64 3300013297 Ga0157378_10670928 Ga0157378_106709282 185
65 3300013297 Ga0157378_10718499 Ga0157378_107184992 185
66 3300013306 Ga0163162_11057801 Ga0163162_110578012 185
67 3300013306 Ga0163162_11645470 Ga0163162_116454702 185
68 3300013307 Ga0157372_10102941 Ga0157372_101029415 185
69 3300013307 Ga0157372_10995621 Ga0157372_109956212 185
70 3300013308 Ga0157375_10461289 Ga0157375_104612892 185
71 3300014325 Ga0163163_10503874 Ga0163163_105038742 185
72 3300014969 Ga0157376_10089641 Ga0157376_100896413 185
73 3300014969 Ga0157376_10384911 Ga0157376_103849112 185
74 3300014969 Ga0157376_10491680 Ga0157376_104916802 185
75 3300015265 Ga0182005_1064104 Ga0182005_10641042 185
76 3300025905 Ga0207685_10318642 Ga0207685_103186422 185
77 3300025906 Ga0207699_10177279 Ga0207699_101772793 185
78 3300025913 Ga0207695_10007643 Ga0207695_100076436 185
79 3300025913 Ga0207695_10181673 Ga0207695_101816733 185
80 3300025914 Ga0207671_10213261 Ga0207671_102132612 185
81 3300025918 Ga0207662_10064495 Ga0207662_100644952 185
82 3300025924 Ga0207694_10363461 Ga0207694_103634612 185
83 3300025928 Ga0207700_10057232 Ga0207700_100572323 185
84 3300025928 Ga0207700_10720011 Ga0207700_107200112 185
85 3300025934 Ga0207686_10142091 Ga0207686_101420912 185
86 3300025938 Ga0207704_10273839 Ga0207704_102738392 185
87 3300025939 Ga0207665_10350874 Ga0207665_103508742 185
88 3300025939 Ga0207665_10593226 Ga0207665_105932262 185
89 3300025941 Ga0207711_10107541 Ga0207711_101075413 185
90 3300025942 Ga0207689_10370034 Ga0207689_103700342 185
91 3300025944 Ga0207661_10010543 Ga0207661_100105432 185
92 3300025944 Ga0207661_10388430 Ga0207661_103884302 185
93 3300026023 Ga0207677_10761973 Ga0207677_107619732 185
94 3300026088 Ga0207641_10111244 Ga0207641_101112443 185
95 3300026088 Ga0207641_10173589 Ga0207641_101735892 185
96 3300026088 Ga0207641_10649309 Ga0207641_106493092 185
97 3300026089 Ga0207648_10335031 Ga0207648_103350312 185
98 3300026095 Ga0207676_10429559 Ga0207676_104295592 185
99 3300028379 Ga0268266_11329533 Ga0268266_113295331 185
100 3300028653 Ga0265323_10008118 Ga0265323_100081184 185
101 3300031250 Ga0265331_10071884 Ga0265331_100718842 185
102 3300031344 Ga0265316_10000607 Ga0265316_1000060733 185
103 3300031344 Ga0265316_10117379 Ga0265316_101173792 185
104 3300031344 Ga0265316_10198283 Ga0265316_101982832 185
105 3300031344 Ga0265316_10261066 Ga0265316_102610662 185
106 3300031344 Ga0265316_10279274 Ga0265316_102792741 185
107 3300031712 Ga0265342_10114420 Ga0265342_101144202 185
108 3300035111 Ga0373923_0176323 Ga0373923_0176323_236_826 185
109 3300035118 Ga0373954_0020632 Ga0373954_0020632_788_1378 185
110 3300035119 Ga0373956_0137823 Ga0373956_0137823_396_986 185
111 3300035172 Ga0373955_0362269 Ga0373955_0362269_241_831 185
112 3300035695 Ga0373927_0075221 Ga0373927_0075221_942_1532 185
113 3300035724 Ga0373933_0586755 Ga0373933_0586755_78_668 185
114 3300035725 Ga0373947_0104864 Ga0373947_0104864_631_1221 185
115 3300035725 Ga0373947_0280897 Ga0373947_0280897_380_970 185
116 3300037853 Ga0436364_0900019 Ga0436364_0900019_2463_3053 185
117 3300044712 Ga0453684_0639751 Ga0453684_0639751_538_1128 185
118 3300045051 Ga0451576_0019383 Ga0451576_0019383_4838_5428 185
119 3300045051 Ga0451576_0543317 Ga0451576_0543317_564_1154 185
120 3300045051 Ga0451576_0753675 Ga0451576_0753675_153_743 185
121 3300046454 Ga0495592_0033185 Ga0495592_0033185_1960_2550 185
122 3300046462 Ga0495651_0038977 Ga0495651_0038977_1850_2440 185
123 3300046463 Ga0495653_0168286 Ga0495653_0168286_156_746 185
124 3300046472 Ga0495580_0037781 Ga0495580_0037781_792_1382 185
125 3300046472 Ga0495580_0078768 Ga0495580_0078768_535_1125 185
126 3300046472 Ga0495580_0187578 Ga0495580_0187578_112_702 185
127 3300046475 Ga0495639_0270849 Ga0495639_0270849_171_761 185
128 3300046476 Ga0495662_0017566 Ga0495662_0017566_2062_2652 185
129 3300046477 Ga0495664_0006701 Ga0495664_0006701_3872_4462 185
130 3300046499 Ga0495594_0149002 Ga0495594_0149002_340_930 185
131 3300046511 Ga0495608_0040514 Ga0495608_0040514_1256_1846 185
132 3300046514 Ga0495618_0009838 Ga0495618_0009838_4656_5246 185
133 3300046516 Ga0495628_0010921 Ga0495628_0010921_2082_2672 185
134 3300046517 Ga0495630_0009909 Ga0495630_0009909_3868_4458 185
135 3300046529 Ga0495652_0007150 Ga0495652_0007150_7704_8294 185
136 3300046529 Ga0495652_0420176 Ga0495652_0420176_231_821 185
137 3300046531 Ga0495665_0070702 Ga0495665_0070702_492_1082 185
138 3300046531 Ga0495665_0137529 Ga0495665_0137529_456_1046 185
139 3300046533 Ga0495640_0022814 Ga0495640_0022814_2686_3276 185
140 3300046535 Ga0495586_0080845 Ga0495586_0080845_945_1535 185
141 3300046536 Ga0495587_0026684 Ga0495587_0026684_1023_1613 185
142 3300046536 Ga0495587_0112245 Ga0495587_0112245_126_716 185
143 3300046543 Ga0495645_0003842 Ga0495645_0003842_2096_2686 185
144 3300046559 Ga0495667_0042546 Ga0495667_0042546_1704_2294 185
145 3300046642 Ga0495634_0008872 Ga0495634_0008872_1793_2383 185
146 3300046663 Ga0495635_0029254 Ga0495635_0029254_2218_2808 185
147 3300046674 Ga0495588_0102742 Ga0495588_0102742_765_1355 185
148 3300046675 Ga0495657_0202630 Ga0495657_0202630_546_1136 185
149 3300046678 Ga0495599_0006439 Ga0495599_0006439_1315_1905 185
150 3300046678 Ga0495599_0122164 Ga0495599_0122164_179_769 185
151 3300046679 Ga0495623_0054050 Ga0495623_0054050_1266_1856 185
152 3300046683 Ga0495658_0393840 Ga0495658_0393840_251_841 185
153 3300046684 Ga0495669_0255980 Ga0495669_0255980_84_674 185
154 3300046689 Ga0495613_0047448 Ga0495613_0047448_1696_2286 185
155 3300047317 Ga0495604_0014207 Ga0495604_0014207_1896_2486 185
156 3300047317 Ga0495604_0103967 Ga0495604_0103967_405_995 185
157 3300047317 Ga0495604_0695319 Ga0495604_0695319_22_612 185
158 3300047319 Ga0495674_0032395 Ga0495674_0032395_2608_3198 185
159 3300047322 Ga0495680_0063802 Ga0495680_0063802_408_998 185
160 3300047322 Ga0495680_0167754 Ga0495680_0167754_444_1034 185
161 3300047444 Ga0495675_0108346 Ga0495675_0108346_1117_1707 185
162 3300047471 Ga0495684_0017619 Ga0495684_0017619_3190_3780 185
163 3300047471 Ga0495684_0020315 Ga0495684_0020315_1144_1734 185
164 3300047471 Ga0495684_0547292 Ga0495684_0547292_183_773 185
165 3300048089 Ga0495614_0196457 Ga0495614_0196457_294_884 185
166 3300048915 Ga0496112_0220521 Ga0496112_0220521_1104_1694 185
167 3300048918 Ga0496115_0042380 Ga0496115_0042380_804_1394 185
168 3300050512 nmdc:mga0n895_1508675_c1 nmdc:mga0n895_1508675_c1_28_618 185
169 3300060353 Ga0501082_0000163 Ga0501082_0000163_33207_33797 185
170 3300002773 JGI25152J39213_1000006 JGI25152J39213_1000006102 186
171 3300002774 JGI25150J39212_1000005 JGI25150J39212_1000005132 186
172 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004300 186
173 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004300 186
174 3300003322 rootL2_10082792 rootL2_100827925 186
175 3300003323 rootH1_10303714 rootH1_103037142 186
176 3300003781 Ga0055536_1000016 Ga0055536_100001652 186
177 3300003791 Ga0055530_10005786 Ga0055530_100057862 186
178 3300005288 Ga0065714_10002573 Ga0065714_100025734 186
179 3300005288 Ga0065714_10002973 Ga0065714_1000297312 186
180 3300005288 Ga0065714_10012335 Ga0065714_100123351 186
181 3300005288 Ga0065714_10070557 Ga0065714_100705573 186
182 3300005288 Ga0065714_10078139 Ga0065714_100781393 186
183 3300005288 Ga0065714_10134859 Ga0065714_101348592 186
184 3300005289 Ga0065704_10070246 Ga0065704_1007024612 186
185 3300005289 Ga0065704_10087243 Ga0065704_100872434 186
186 3300005289 Ga0065704_10246133 Ga0065704_102461332 186
187 3300005328 Ga0070676_10004845 Ga0070676_100048454 186
188 3300005331 Ga0070670_100360435 Ga0070670_1003604352 186
189 3300005335 Ga0070666_10003308 Ga0070666_100033083 186
190 3300005338 Ga0068868_100013965 Ga0068868_1000139655 186
191 3300005339 Ga0070660_100209481 Ga0070660_1002094812 186
192 3300005354 Ga0070675_100128933 Ga0070675_1001289332 186
193 3300005356 Ga0070674_100151986 Ga0070674_1001519862 186
194 3300005366 Ga0070659_100421563 Ga0070659_1004215632 186
195 3300005367 Ga0070667_100000957 Ga0070667_1000009579 186
196 3300005367 Ga0070667_100220620 Ga0070667_1002206202 186
197 3300005367 Ga0070667_100635095 Ga0070667_1006350952 186
198 3300005367 Ga0070667_100761816 Ga0070667_1007618162 186
199 3300005434 Ga0070709_10136077 Ga0070709_101360772 186
200 3300005471 Ga0070698_100129915 Ga0070698_1001299154 186
201 3300005539 Ga0068853_100076028 Ga0068853_1000760283 186
202 3300005543 Ga0070672_100000365 Ga0070672_10000036513 186
203 3300005548 Ga0070665_100000013 Ga0070665_100000013346 186
204 3300005548 Ga0070665_100001739 Ga0070665_10000173915 186
205 3300005563 Ga0068855_100097359 Ga0068855_1000973593 186
206 3300005563 Ga0068855_100129056 Ga0068855_1001290563 186
207 3300005564 Ga0070664_101307906 Ga0070664_1013079061 186
208 3300005577 Ga0068857_100076672 Ga0068857_1000766723 186
209 3300005614 Ga0068856_100117366 Ga0068856_1001173663 186
210 3300005614 Ga0068856_100123662 Ga0068856_1001236623 186
211 3300005616 Ga0068852_100000197 Ga0068852_1000001979 186
212 3300005616 Ga0068852_100674548 Ga0068852_1006745481 186
213 3300005618 Ga0068864_100000176 Ga0068864_10000017627 186
214 3300005618 Ga0068864_100107907 Ga0068864_1001079073 186
215 3300005719 Ga0068861_100041841 Ga0068861_1000418416 186
216 3300005834 Ga0068851_10000284 Ga0068851_100002844 186
217 3300005841 Ga0068863_100001185 Ga0068863_1000011852 186
218 3300005841 Ga0068863_100737536 Ga0068863_1007375362 186
219 3300005842 Ga0068858_100201144 Ga0068858_1002011442 186
220 3300005843 Ga0068860_100000060 Ga0068860_10000006016 186
221 3300005843 Ga0068860_100004691 Ga0068860_1000046919 186
222 3300005843 Ga0068860_100412559 Ga0068860_1004125592 186
223 3300006195 Ga0075366_10293392 Ga0075366_102933921 186
224 3300006237 Ga0097621_100556836 Ga0097621_1005568361 186
225 3300006358 Ga0068871_100069347 Ga0068871_1000693474 186
226 3300009036 Ga0105244_10006081 Ga0105244_100060814 186
227 3300009093 Ga0105240_10000570 Ga0105240_100005708 186
228 3300009093 Ga0105240_10135655 Ga0105240_101356553 186
229 3300009093 Ga0105240_10186114 Ga0105240_101861143 186
230 3300009093 Ga0105240_10274589 Ga0105240_102745892 186
231 3300009093 Ga0105240_10439339 Ga0105240_104393391 186
232 3300009148 Ga0105243_10584906 Ga0105243_105849062 186
233 3300009174 Ga0105241_10004753 Ga0105241_100047534 186
234 3300009174 Ga0105241_10074540 Ga0105241_100745403 186
235 3300009174 Ga0105241_10259505 Ga0105241_102595052 186
236 3300009176 Ga0105242_10059155 Ga0105242_100591554 186
237 3300009545 Ga0105237_10008171 Ga0105237_100081719 186
238 3300009545 Ga0105237_10008278 Ga0105237_1000827811 186
239 3300009545 Ga0105237_10010165 Ga0105237_100101651 186
240 3300009545 Ga0105237_10045930 Ga0105237_100459305 186
241 3300009551 Ga0105238_10002790 Ga0105238_1000279010 186
242 3300009551 Ga0105238_10075124 Ga0105238_100751242 186
243 3300009551 Ga0105238_10218932 Ga0105238_102189322 186
244 3300009553 Ga0105249_10031809 Ga0105249_100318093 186
245 3300010375 Ga0105239_10093588 Ga0105239_100935883 186
246 3300010375 Ga0105239_10454171 Ga0105239_104541711 186
247 3300011119 Ga0105246_10046004 Ga0105246_100460043 186
248 3300013100 Ga0157373_10001474 Ga0157373_100014744 186
249 3300013100 Ga0157373_10002252 Ga0157373_100022526 186
250 3300013100 Ga0157373_10027194 Ga0157373_100271945 186
251 3300013100 Ga0157373_10172945 Ga0157373_101729452 186
252 3300013100 Ga0157373_10278306 Ga0157373_102783061 186
253 3300013102 Ga0157371_10003596 Ga0157371_1000359611 186
254 3300013102 Ga0157371_10003601 Ga0157371_1000360111 186
255 3300013102 Ga0157371_10010108 Ga0157371_100101082 186
256 3300013104 Ga0157370_10000084 Ga0157370_1000008423 186
257 3300013104 Ga0157370_10002073 Ga0157370_1000207314 186
258 3300013104 Ga0157370_10005660 Ga0157370_1000566011 186
259 3300013104 Ga0157370_10007536 Ga0157370_100075362 186
260 3300013104 Ga0157370_10188858 Ga0157370_101888582 186
261 3300013104 Ga0157370_10327999 Ga0157370_103279992 186
262 3300013104 Ga0157370_10334375 Ga0157370_103343752 186
263 3300013104 Ga0157370_10702972 Ga0157370_107029722 186
264 3300013105 Ga0157369_10000169 Ga0157369_100001691 186
265 3300013105 Ga0157369_10068203 Ga0157369_100682033 186
266 3300013105 Ga0157369_10905271 Ga0157369_109052712 186
267 3300013296 Ga0157374_10105846 Ga0157374_101058463 186
268 3300013296 Ga0157374_10636500 Ga0157374_106365002 186
269 3300013297 Ga0157378_10099893 Ga0157378_100998932 186
270 3300013306 Ga0163162_10000349 Ga0163162_1000034922 186
271 3300013306 Ga0163162_10000814 Ga0163162_1000081420 186
272 3300013306 Ga0163162_10005561 Ga0163162_100055613 186
273 3300013306 Ga0163162_10293792 Ga0163162_102937922 186
274 3300013307 Ga0157372_10006107 Ga0157372_100061073 186
275 3300013307 Ga0157372_10904358 Ga0157372_109043581 186
276 3300013308 Ga0157375_10083834 Ga0157375_100838342 186
277 3300014325 Ga0163163_10329292 Ga0163163_103292922 186
278 3300014497 Ga0182008_10000002 Ga0182008_10000002406 186
279 3300014497 Ga0182008_10000631 Ga0182008_1000063113 186
280 3300014497 Ga0182008_10000693 Ga0182008_100006937 186
281 3300014968 Ga0157379_10001247 Ga0157379_100012473 186
282 3300014969 Ga0157376_10004019 Ga0157376_100040192 186
283 3300015261 Ga0182006_1000806 Ga0182006_100080625 186
284 3300015261 Ga0182006_1008166 Ga0182006_10081664 186
285 3300015261 Ga0182006_1009814 Ga0182006_10098142 186
286 3300015261 Ga0182006_1016044 Ga0182006_10160442 186
287 3300015261 Ga0182006_1020991 Ga0182006_10209912 186
288 3300015262 Ga0182007_10000016 Ga0182007_1000001631 186
289 3300015682 Ga0183373_1012 Ga0183373_10121 186
290 3300017792 Ga0163161_10001031 Ga0163161_100010312 186
291 3300017792 Ga0163161_10001633 Ga0163161_100016332 186
292 3300017792 Ga0163161_10003521 Ga0163161_1000352114 186
293 3300017792 Ga0163161_10006424 Ga0163161_100064244 186
294 3300017792 Ga0163161_10129316 Ga0163161_101293163 186
295 3300017792 Ga0163161_10260023 Ga0163161_102600232 186
296 3300017792 Ga0163161_10458063 Ga0163161_104580631 186
297 3300017792 Ga0163161_10912923 Ga0163161_109129231 186
298 3300017792 Ga0163161_10914303 Ga0163161_109143031 186
299 3300025245 Ga0207425_1000008 Ga0207425_1000008138 186
300 3300025246 Ga0209646_1002266 Ga0209646_10022664 186
301 3300025258 Ga0209129_1000040 Ga0209129_1000040127 186
302 3300025292 Ga0209676_1000106 Ga0209676_1000106152 186
303 3300025294 Ga0209025_1000020 Ga0209025_1000020138 186
304 3300025297 Ga0209758_1000022 Ga0209758_1000022138 186
305 3300025298 Ga0209050_1000174 Ga0209050_10001745 186
306 3300025303 Ga0209051_1060899 Ga0209051_10608991 186
307 3300025321 Ga0207656_10001476 Ga0207656_100014764 186
308 3300025728 Ga0207655_1012720 Ga0207655_10127205 186
309 3300025903 Ga0207680_10003588 Ga0207680_100035885 186
310 3300025903 Ga0207680_10238812 Ga0207680_102388122 186
311 3300025904 Ga0207647_10094913 Ga0207647_100949132 186
312 3300025907 Ga0207645_10012445 Ga0207645_100124453 186
313 3300025909 Ga0207705_10021772 Ga0207705_100217724 186
314 3300025911 Ga0207654_10022283 Ga0207654_100222833 186
315 3300025911 Ga0207654_10030836 Ga0207654_100308362 186
316 3300025913 Ga0207695_10005162 Ga0207695_100051628 186
317 3300025913 Ga0207695_10096879 Ga0207695_100968792 186
318 3300025913 Ga0207695_10302064 Ga0207695_103020642 186
319 3300025913 Ga0207695_10848581 Ga0207695_108485811 186
320 3300025914 Ga0207671_10000110 Ga0207671_1000011089 186
321 3300025914 Ga0207671_10002077 Ga0207671_100020774 186
322 3300025914 Ga0207671_10017404 Ga0207671_100174044 186
323 3300025914 Ga0207671_10027188 Ga0207671_100271883 186
324 3300025922 Ga0207646_10250248 Ga0207646_102502482 186
325 3300025924 Ga0207694_10051909 Ga0207694_100519093 186
326 3300025924 Ga0207694_10221459 Ga0207694_102214592 186
327 3300025924 Ga0207694_10270575 Ga0207694_102705751 186
328 3300025934 Ga0207686_10086341 Ga0207686_100863413 186
329 3300025940 Ga0207691_10000060 Ga0207691_1000006042 186
330 3300025945 Ga0207679_11090386 Ga0207679_110903861 186
331 3300025949 Ga0207667_10000221 Ga0207667_1000022114 186
332 3300025949 Ga0207667_10074678 Ga0207667_100746784 186
333 3300025961 Ga0207712_10087033 Ga0207712_100870332 186
334 3300025972 Ga0207668_10000268 Ga0207668_1000026828 186
335 3300025986 Ga0207658_10237142 Ga0207658_102371422 186
336 3300026023 Ga0207677_10005966 Ga0207677_100059664 186
337 3300026023 Ga0207677_10046446 Ga0207677_100464463 186
338 3300026035 Ga0207703_10008010 Ga0207703_100080105 186
339 3300026041 Ga0207639_10114366 Ga0207639_101143662 186
340 3300026078 Ga0207702_10305937 Ga0207702_103059372 186
341 3300026078 Ga0207702_10326091 Ga0207702_103260911 186
342 3300026088 Ga0207641_10005697 Ga0207641_100056976 186
343 3300026089 Ga0207648_10002360 Ga0207648_1000236010 186
344 3300026095 Ga0207676_10002113 Ga0207676_100021137 186
345 3300026095 Ga0207676_10078653 Ga0207676_100786533 186
346 3300026116 Ga0207674_10003801 Ga0207674_100038013 186
347 3300026118 Ga0207675_100070907 Ga0207675_1000709074 186
348 3300026142 Ga0207698_10007888 Ga0207698_100078885 186
349 3300026142 Ga0207698_10418885 Ga0207698_104188852 186
350 3300026142 Ga0207698_10637904 Ga0207698_106379042 186
351 3300028379 Ga0268266_10000024 Ga0268266_1000002458 186
352 3300028380 Ga0268265_10259604 Ga0268265_102596042 186
353 3300028381 Ga0268264_10000243 Ga0268264_1000024384 186
354 3300028381 Ga0268264_10004484 Ga0268264_100044848 186
355 3300028381 Ga0268264_10048348 Ga0268264_100483481 186
356 3300028794 Ga0307515_10013124 Ga0307515_100131246 186
357 3300028794 Ga0307515_10512043 Ga0307515_105120431 186
358 3300030731 Ga0316177_1173064 Ga0316177_11730643 186
359 3300030732 Ga0316176_1113607 Ga0316176_11136075 186
360 3300030742 Ga0316183_1107442 Ga0316183_110744220 186
361 3300030744 Ga0316181_1199804 Ga0316181_11998041 186
362 3300030744 Ga0316181_1214383 Ga0316181_12143833 186
363 3300031090 Ga0265760_10023573 Ga0265760_100235732 186
364 3300031456 Ga0307513_10151654 Ga0307513_101516542 186
365 3300031456 Ga0307513_10238229 Ga0307513_102382292 186
366 3300031507 Ga0307509_10218654 Ga0307509_102186541 186
367 3300031731 Ga0307405_10000025 Ga0307405_1000002585 186
368 3300031731 Ga0307405_10053513 Ga0307405_100535132 186
369 3300031903 Ga0307407_10000016 Ga0307407_1000001658 186
370 3300031911 Ga0307412_10000085 Ga0307412_1000008523 186
371 3300031911 Ga0307412_10129438 Ga0307412_101294383 186
372 3300031911 Ga0307412_10168726 Ga0307412_101687262 186
373 3300031911 Ga0307412_10221691 Ga0307412_102216911 186
374 3300031995 Ga0307409_100109761 Ga0307409_1001097613 186
375 3300032002 Ga0307416_100000036 Ga0307416_10000003658 186
376 3300032004 Ga0307414_10000548 Ga0307414_100005483 186
377 3300032004 Ga0307414_10011329 Ga0307414_100113294 186
378 3300032004 Ga0307414_10016294 Ga0307414_100162942 186
379 3300032004 Ga0307414_10051691 Ga0307414_100516912 186
380 3300032004 Ga0307414_10141993 Ga0307414_101419932 186
381 3300032004 Ga0307414_10144247 Ga0307414_101442473 186
382 3300032004 Ga0307414_10504695 Ga0307414_105046952 186
383 3300032004 Ga0307414_10712871 Ga0307414_107128711 186
384 3300032005 Ga0307411_10432161 Ga0307411_104321611 186
385 3300033179 Ga0307507_10305558 Ga0307507_103055582 186
386 3300041406 Ga0439439_0007206 Ga0439439_0007206_1402_1977 186
387 3300041451 Ga0451791_0203047 Ga0451791_0203047_683_1258 186
388 3300041452 Ga0451793_0529887 Ga0451793_0529887_696_1271 186
389 3300041459 Ga0451800_0828905 Ga0451800_0828905_167_805 186
390 3300041460 Ga0451802_0121489 Ga0451802_0121489_541_1116 186
391 3300041505 Ga0451849_1190738 Ga0451849_1190738_38_613 186
392 3300042007 Ga0439449_0008287 Ga0439449_0008287_3066_3641 186
393 3300042014 Ga0439457_000008 Ga0439457_000008_32721_33296 186
394 3300042015 Ga0439462_0000815 Ga0439462_0000815_4491_5066 186
395 3300042131 Ga0450894_015412 Ga0450894_015412_222_797 186
396 3300042532 Ga0450893_0045960 Ga0450893_0045960_203_778 186
397 3300042876 Ga0451577_0001955 Ga0451577_0001955_23403_23981 186
398 3300044658 Ga0466972_0027294 Ga0466972_0027294_1141_1719 186
399 3300044658 Ga0466972_0071677 Ga0466972_0071677_903_1478 186
400 3300044658 Ga0466972_0172645 Ga0466972_0172645_229_804 186
401 3300044735 Ga0466968_0047844 Ga0466968_0047844_717_1295 186
402 3300044842 Ga0466957_0001154 Ga0466957_0001154_2336_2986 186
403 3300044901 Ga0466960_0174253 Ga0466960_0174253_139_714 186
404 3300046501 Ga0495607_0188231 Ga0495607_0188231_174_734 186
405 3300046507 Ga0495606_0015427 Ga0495606_0015427_3586_4146 186
406 3300046512 Ga0495610_0000119 Ga0495610_0000119_88420_88980 186
407 3300046512 Ga0495610_0010840 Ga0495610_0010840_635_1195 186
408 3300046520 Ga0495637_0034550 Ga0495637_0034550_1149_1709 186
409 3300046524 Ga0495648_0003776 Ga0495648_0003776_8114_8692 186
410 3300046538 Ga0495609_0014814 Ga0495609_0014814_1954_2514 186
411 3300047443 Ga0495687_000014 Ga0495687_000014_305883_306461 186
412 3300047470 Ga0495681_0177336 Ga0495681_0177336_59_619 186
413 3300047472 Ga0495686_0286582 Ga0495686_0286582_33_608 186
414 3300048912 Ga0496109_0428873 Ga0496109_0428873_420_998 186
415 3300048918 Ga0496115_0318542 Ga0496115_0318542_597_1157 186
416 3300048925 Ga0496122_0000862 Ga0496122_0000862_56224_56784 186
417 3300048926 Ga0496123_0003821 Ga0496123_0003821_15610_16170 186
418 3300048928 Ga0496125_0073301 Ga0496125_0073301_311_871 186
419 3300049580 Ga0501046_0297626 Ga0501046_0297626_584_1159 186
420 3300049581 Ga0501047_0018627 Ga0501047_0018627_926_1501 186
421 3300049581 Ga0501047_0246863 Ga0501047_0246863_950_1525 186
422 3300049663 Ga0501223_008818 Ga0501223_008818_492_1055 186
423 3300049705 Ga0501225_0001777 Ga0501225_0001777_4819_5394 186
424 3300049758 Ga0501241_003707 Ga0501241_003707_481_1041 186
425 3300049758 Ga0501241_004719 Ga0501241_004719_957_1517 186
426 3300049823 Ga0501044_0021886 Ga0501044_0021886_699_1274 186
427 3300053086 Ga0500578_0000119 Ga0500578_0000119_16149_16724 186
428 3300053086 Ga0500578_0159206 Ga0500578_0159206_503_1177 186
429 3300053090 Ga0500646_0105733 Ga0500646_0105733_113_691 186
430 3300053092 Ga0500583_0000014 Ga0500583_0000014_53730_54305 186
431 3300053092 Ga0500583_0000841 Ga0500583_0000841_1703_2281 186
432 3300053092 Ga0500583_0012959 Ga0500583_0012959_2515_3090 186
433 3300053093 Ga0500651_0000078 Ga0500651_0000078_47233_47793 186
434 3300053093 Ga0500651_0533902 Ga0500651_0533902_24_599 186
435 3300053111 Ga0500572_029879 Ga0500572_029879_469_1044 186
436 3300053130 Ga0500642_0032710 Ga0500642_0032710_1170_1748 186
437 3300053131 Ga0500652_092996 Ga0500652_092996_219_794 186
438 3300053134 Ga0500658_0155856 Ga0500658_0155856_202_777 186
439 3300053146 Ga0500588_0057966 Ga0500588_0057966_412_987 186
440 3300053150 Ga0500603_113269 Ga0500603_113269_131_772 186
441 3300053151 Ga0500604_0110087 Ga0500604_0110087_86_661 186
442 3300053153 Ga0500616_0053524 Ga0500616_0053524_486_1061 186
443 3300053156 Ga0500622_0002764 Ga0500622_0002764_2134_2712 186
444 3300053156 Ga0500622_0035190 Ga0500622_0035190_21_596 186
445 3300053160 Ga0500633_0140207 Ga0500633_0140207_25_699 186
446 3300053163 Ga0500639_164083 Ga0500639_164083_216_857 186
447 3300053727 Ga0500611_013713 Ga0500611_013713_431_1069 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

37

218

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9609 2 176
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9553 2 186
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9533 2 176
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.953 1 185
4yly-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.9508 3 186
ID Description Score Start End Superfamily
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9552 60 186 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9508 3 186 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9495 1 186 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9446 1 186 3.40.50.1470
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9413 3 185 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A4Q3RK09-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.994 1 130 GO:0004045
AF-C3J8L0-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9889 2 186 GO:0004045
GO:0005737
GO:0006412
AF-A0A2P7TW18-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9887 1 185 GO:0004045
GO:0005737
GO:0006412
AF-A0A2E8SK81-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9872 2 185 GO:0004045
GO:0005737
GO:0006412
AF-A0A1Z8QKR5-F1-model_v4 deleted 0.9869 1 186

Feature Viewer

pLDDT pTM Quality
95.25 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map