F446052
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 447 | 267 | 425 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300053086|Ga0500578_0159206|Ga0500578_0159206_503_1177 |
| Length | 224 |
| Sequence | LPNLTLDSKDCFDHFWPFLHVAYPTTHYSTIAGMKFLLIGLGNIGEDYAYTRHNIGFDVVDAFAQKHGGLFGVGRLAHVCELKWKGKKLTIIKPTTYMNLSGKAVKYWIEKESVALEQLLVIVDDIALPLSKIRLRSSGSSAGHNGLRSIEETLLTDKYPRLRFGVGNNFPKGAQADFVLSRWTPEESPLVKRKVEKCVEVVENFITIGIERTMNEANKLEFTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 4 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 5 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 6 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 7 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 8 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 9 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 10 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 11 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 12 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 13 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 14 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 15 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 16 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 17 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 18 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 19 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 20 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 21 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 22 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 23 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 24 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 96 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 146 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 147 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 148 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 149 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 150 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 151 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 165 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 172 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 173 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 174 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 175 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 176 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 181 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 182 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 183 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 184 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 185 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 186 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 241 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 248 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 251 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 252 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 253 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 254 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 255 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 256 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 257 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 259 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 260 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 261 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 262 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 263 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 264 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 265 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.85 |
| Metatranscriptomes | 0.22 |
| Isolates | 4.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.83 |
| Nodule | 0 |
| Rhizoplane | 2.01 |
| Rhizosphere | 84.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000006 | 3300002773 | Bacteria | 158516 |
| 2 | JGI25150J39212_1000005 | 3300002774 | Bacteria | 311800 |
| 3 | JGI25151J46595_10000004 | 3300003187 | Bacteria | 494006 |
| 4 | JGI25153J46596_10000004 | 3300003215 | Bacteria | 494006 |
| 5 | rootL2_10082792 | 3300003322 | Unclassified | 3858 |
| 6 | rootH1_10303714 | 3300003323 | Bacteria | 2012 |
| 7 | Ga0055536_1000016 | 3300003781 | Bacteria | 222134 |
| 8 | Ga0055530_10005786 | 3300003791 | Bacteria | 5740 |
| 9 | Ga0065714_10002573 | 3300005288 | Bacteria | 14218 |
| 10 | Ga0065714_10002973 | 3300005288 | Bacteria | 13923 |
| 11 | Ga0065714_10012335 | 3300005288 | Bacteria | 1821 |
| 12 | Ga0065714_10070557 | 3300005288 | Bacteria | 3832 |
| 13 | Ga0065714_10078139 | 3300005288 | Bacteria | 2610 |
| 14 | Ga0065714_10134859 | 3300005288 | Bacteria | 1218 |
| 15 | Ga0065704_10070246 | 3300005289 | Bacteria | 48710 |
| 16 | Ga0065704_10087243 | 3300005289 | Bacteria | 3043 |
| 17 | Ga0065704_10246133 | 3300005289 | Bacteria | 1002 |
| 18 | Ga0070676_10004845 | 3300005328 | Bacteria | 7122 |
| 19 | Ga0070683_100021602 | 3300005329 | Bacteria | 5745 |
| 20 | Ga0070683_100349723 | 3300005329 | Bacteria | 1408 |
| 21 | Ga0070683_100656784 | 3300005329 | Unclassified | 1004 |
| 22 | Ga0070670_100360435 | 3300005331 | Bacteria | 1278 |
| 23 | Ga0070666_10003308 | 3300005335 | Bacteria | 9771 |
| 24 | Ga0068868_100013965 | 3300005338 | Bacteria | 5908 |
| 25 | Ga0070660_100209481 | 3300005339 | Bacteria | 1582 |
| 26 | Ga0070675_100128933 | 3300005354 | Unclassified | 2154 |
| 27 | Ga0070674_100151986 | 3300005356 | Bacteria | 1748 |
| 28 | Ga0070673_100377221 | 3300005364 | Unclassified | 1264 |
| 29 | Ga0070659_100421563 | 3300005366 | Bacteria | 1129 |
| 30 | Ga0070667_100000957 | 3300005367 | Bacteria | 26589 |
| 31 | Ga0070667_100220620 | 3300005367 | Bacteria | 1688 |
| 32 | Ga0070667_100635095 | 3300005367 | Bacteria | 985 |
| 33 | Ga0070667_100761816 | 3300005367 | Bacteria | 898 |
| 34 | Ga0070709_10136077 | 3300005434 | Bacteria | 1683 |
| 35 | Ga0070709_10236797 | 3300005434 | Unclassified | 1309 |
| 36 | Ga0070698_100129915 | 3300005471 | Bacteria | 2475 |
| 37 | Ga0070684_100168610 | 3300005535 | Bacteria | 1988 |
| 38 | Ga0068853_100076028 | 3300005539 | Bacteria | 2931 |
| 39 | Ga0070672_100000365 | 3300005543 | Bacteria | 26063 |
| 40 | Ga0070665_100000013 | 3300005548 | Bacteria | 484927 |
| 41 | Ga0070665_100001739 | 3300005548 | Bacteria | 24906 |
| 42 | Ga0070665_100242951 | 3300005548 | Bacteria | 1801 |
| 43 | Ga0068855_100039247 | 3300005563 | Bacteria | 5621 |
| 44 | Ga0068855_100097359 | 3300005563 | Unclassified | 3389 |
| 45 | Ga0068855_100129056 | 3300005563 | Bacteria | 2888 |
| 46 | Ga0070664_101307906 | 3300005564 | Unclassified | 685 |
| 47 | Ga0068857_100076672 | 3300005577 | Bacteria | 2982 |
| 48 | Ga0068856_100117366 | 3300005614 | Bacteria | 2662 |
| 49 | Ga0068856_100123662 | 3300005614 | Bacteria | 2590 |
| 50 | Ga0068852_100000197 | 3300005616 | Bacteria | 41267 |
| 51 | Ga0068852_100674548 | 3300005616 | Bacteria | 1042 |
| 52 | Ga0068864_100000176 | 3300005618 | Bacteria | 59064 |
| 53 | Ga0068864_100107907 | 3300005618 | Bacteria | 2477 |
| 54 | Ga0068861_100041841 | 3300005719 | Bacteria | 3433 |
| 55 | Ga0068851_10000284 | 3300005834 | Bacteria | 23388 |
| 56 | Ga0068863_100001185 | 3300005841 | Bacteria | 26042 |
| 57 | Ga0068863_100170020 | 3300005841 | Unclassified | 2090 |
| 58 | Ga0068863_100438642 | 3300005841 | Unclassified | 1280 |
| 59 | Ga0068863_100737536 | 3300005841 | Bacteria | 980 |
| 60 | Ga0068858_100201144 | 3300005842 | Bacteria | 1884 |
| 61 | Ga0068860_100000060 | 3300005843 | Bacteria | 195631 |
| 62 | Ga0068860_100004691 | 3300005843 | Bacteria | 13946 |
| 63 | Ga0068860_100412559 | 3300005843 | Bacteria | 1338 |
| 64 | Ga0070717_10304216 | 3300006028 | Bacteria | 1418 |
| 65 | Ga0070717_10312939 | 3300006028 | Unclassified | 1398 |
| 66 | Ga0075366_10293392 | 3300006195 | Bacteria | 994 |
| 67 | Ga0097621_100282052 | 3300006237 | Bacteria | 1462 |
| 68 | Ga0097621_100556836 | 3300006237 | Bacteria | 1044 |
| 69 | Ga0068871_100069347 | 3300006358 | Unclassified | 2895 |
| 70 | Ga0068871_100491816 | 3300006358 | Bacteria | 1105 |
| 71 | Ga0105244_10006081 | 3300009036 | Bacteria | 7892 |
| 72 | Ga0105240_10000570 | 3300009093 | Bacteria | 68288 |
| 73 | Ga0105240_10003646 | 3300009093 | Bacteria | 23852 |
| 74 | Ga0105240_10135655 | 3300009093 | Bacteria | 2948 |
| 75 | Ga0105240_10186114 | 3300009093 | Bacteria | 2446 |
| 76 | Ga0105240_10244571 | 3300009093 | Unclassified | 2078 |
| 77 | Ga0105240_10274589 | 3300009093 | Bacteria | 1939 |
| 78 | Ga0105240_10439339 | 3300009093 | Bacteria | 1462 |
| 79 | Ga0111539_10551517 | 3300009094 | Bacteria | 1342 |
| 80 | Ga0114129_11344376 | 3300009147 | Bacteria | 884 |
| 81 | Ga0105243_10584906 | 3300009148 | Bacteria | 1072 |
| 82 | Ga0105241_10004753 | 3300009174 | Bacteria | 10008 |
| 83 | Ga0105241_10074540 | 3300009174 | Bacteria | 2643 |
| 84 | Ga0105241_10259505 | 3300009174 | Bacteria | 1476 |
| 85 | Ga0105241_10278730 | 3300009174 | Unclassified | 1427 |
| 86 | Ga0105241_10863934 | 3300009174 | Unclassified | 838 |
| 87 | Ga0105242_10059155 | 3300009176 | Bacteria | 3143 |
| 88 | Ga0105242_10605725 | 3300009176 | Unclassified | 1059 |
| 89 | Ga0105237_10008171 | 3300009545 | Bacteria | 11369 |
| 90 | Ga0105237_10008278 | 3300009545 | Bacteria | 11293 |
| 91 | Ga0105237_10010165 | 3300009545 | Bacteria | 10027 |
| 92 | Ga0105237_10045930 | 3300009545 | Bacteria | 4394 |
| 93 | Ga0105237_10219405 | 3300009545 | Bacteria | 1902 |
| 94 | Ga0105238_10002790 | 3300009551 | Bacteria | 17438 |
| 95 | Ga0105238_10075124 | 3300009551 | Bacteria | 3371 |
| 96 | Ga0105238_10218932 | 3300009551 | Bacteria | 1880 |
| 97 | Ga0105238_11065592 | 3300009551 | Unclassified | 830 |
| 98 | Ga0105249_10031809 | 3300009553 | Bacteria | 4773 |
| 99 | Ga0105249_10236781 | 3300009553 | Unclassified | 1803 |
| 100 | Ga0105239_10093588 | 3300010375 | Bacteria | 3318 |
| 101 | Ga0105239_10454171 | 3300010375 | Bacteria | 1454 |
| 102 | Ga0105246_10046004 | 3300011119 | Bacteria | 2975 |
| 103 | Ga0105246_10426411 | 3300011119 | Bacteria | 1108 |
| 104 | Ga0157373_10001474 | 3300013100 | Bacteria | 17936 |
| 105 | Ga0157373_10002252 | 3300013100 | Bacteria | 14613 |
| 106 | Ga0157373_10027194 | 3300013100 | Bacteria | 4126 |
| 107 | Ga0157373_10172945 | 3300013100 | Bacteria | 1520 |
| 108 | Ga0157373_10278306 | 3300013100 | Bacteria | 1185 |
| 109 | Ga0157371_10003596 | 3300013102 | Bacteria | 13968 |
| 110 | Ga0157371_10003601 | 3300013102 | Bacteria | 13954 |
| 111 | Ga0157371_10010108 | 3300013102 | Bacteria | 7374 |
| 112 | Ga0157370_10000084 | 3300013104 | Bacteria | 104159 |
| 113 | Ga0157370_10002073 | 3300013104 | Bacteria | 24536 |
| 114 | Ga0157370_10005660 | 3300013104 | Bacteria | 13968 |
| 115 | Ga0157370_10007536 | 3300013104 | Bacteria | 11823 |
| 116 | Ga0157370_10188858 | 3300013104 | Bacteria | 1913 |
| 117 | Ga0157370_10327999 | 3300013104 | Bacteria | 1411 |
| 118 | Ga0157370_10334375 | 3300013104 | Bacteria | 1396 |
| 119 | Ga0157370_10526309 | 3300013104 | Bacteria | 1085 |
| 120 | Ga0157370_10702972 | 3300013104 | Bacteria | 923 |
| 121 | Ga0157369_10000169 | 3300013105 | Bacteria | 91977 |
| 122 | Ga0157369_10068203 | 3300013105 | Bacteria | 3821 |
| 123 | Ga0157369_10089382 | 3300013105 | Bacteria | 3289 |
| 124 | Ga0157369_10248251 | 3300013105 | Unclassified | 1858 |
| 125 | Ga0157369_10649231 | 3300013105 | Bacteria | 1088 |
| 126 | Ga0157369_10905271 | 3300013105 | Bacteria | 905 |
| 127 | Ga0157369_10947369 | 3300013105 | Unclassified | 882 |
| 128 | Ga0157374_10105846 | 3300013296 | Bacteria | 2702 |
| 129 | Ga0157374_10177769 | 3300013296 | Unclassified | 2078 |
| 130 | Ga0157374_10636500 | 3300013296 | Bacteria | 1078 |
| 131 | Ga0157378_10099893 | 3300013297 | Unclassified | 2648 |
| 132 | Ga0157378_10670928 | 3300013297 | Bacteria | 1054 |
| 133 | Ga0157378_10718499 | 3300013297 | Bacteria | 1020 |
| 134 | Ga0163162_10000349 | 3300013306 | Bacteria | 42017 |
| 135 | Ga0163162_10000814 | 3300013306 | Bacteria | 28937 |
| 136 | Ga0163162_10005561 | 3300013306 | Bacteria | 12192 |
| 137 | Ga0163162_10293792 | 3300013306 | Bacteria | 1756 |
| 138 | Ga0163162_11057801 | 3300013306 | Bacteria | 919 |
| 139 | Ga0163162_11645470 | 3300013306 | Unclassified | 733 |
| 140 | Ga0157372_10006107 | 3300013307 | Bacteria | 12799 |
| 141 | Ga0157372_10102941 | 3300013307 | Unclassified | 3262 |
| 142 | Ga0157372_10904358 | 3300013307 | Bacteria | 1024 |
| 143 | Ga0157372_10995621 | 3300013307 | Bacteria | 971 |
| 144 | Ga0157375_10083834 | 3300013308 | Bacteria | 3233 |
| 145 | Ga0157375_10461289 | 3300013308 | Unclassified | 1436 |
| 146 | Ga0163163_10329292 | 3300014325 | Bacteria | 1582 |
| 147 | Ga0163163_10503874 | 3300014325 | Unclassified | 1272 |
| 148 | Ga0182008_10000002 | 3300014497 | Bacteria | 480216 |
| 149 | Ga0182008_10000631 | 3300014497 | Bacteria | 25814 |
| 150 | Ga0182008_10000693 | 3300014497 | Bacteria | 24266 |
| 151 | Ga0157379_10001247 | 3300014968 | Bacteria | 20630 |
| 152 | Ga0157376_10004019 | 3300014969 | Bacteria | 10179 |
| 153 | Ga0157376_10089641 | 3300014969 | Bacteria | 2660 |
| 154 | Ga0157376_10384911 | 3300014969 | Bacteria | 1352 |
| 155 | Ga0157376_10491680 | 3300014969 | Unclassified | 1204 |
| 156 | Ga0182006_1000806 | 3300015261 | Bacteria | 21001 |
| 157 | Ga0182006_1008166 | 3300015261 | Bacteria | 4750 |
| 158 | Ga0182006_1009814 | 3300015261 | Bacteria | 4280 |
| 159 | Ga0182006_1016044 | 3300015261 | Bacteria | 3201 |
| 160 | Ga0182006_1020991 | 3300015261 | Bacteria | 2729 |
| 161 | Ga0182007_10000016 | 3300015262 | Bacteria | 202375 |
| 162 | Ga0182005_1064104 | 3300015265 | Unclassified | 1005 |
| 163 | Ga0183373_1012 | 3300015682 | Bacteria | 118834 |
| 164 | Ga0163161_10001031 | 3300017792 | Bacteria | 21233 |
| 165 | Ga0163161_10001633 | 3300017792 | Bacteria | 16487 |
| 166 | Ga0163161_10003521 | 3300017792 | Bacteria | 10960 |
| 167 | Ga0163161_10006424 | 3300017792 | Bacteria | 8136 |
| 168 | Ga0163161_10129316 | 3300017792 | Unclassified | 1904 |
| 169 | Ga0163161_10260023 | 3300017792 | Bacteria | 1356 |
| 170 | Ga0163161_10458063 | 3300017792 | Bacteria | 1032 |
| 171 | Ga0163161_10912923 | 3300017792 | Bacteria | 745 |
| 172 | Ga0163161_10914303 | 3300017792 | Bacteria | 744 |
| 173 | Ga0213876_10109631 | 3300021384 | Unclassified | 1465 |
| 174 | Ga0213871_10001505 | 3300021441 | Bacteria | 3938 |
| 175 | Ga0207425_1000008 | 3300025245 | Bacteria | 618024 |
| 176 | Ga0209646_1002266 | 3300025246 | Bacteria | 4408 |
| 177 | Ga0209129_1000040 | 3300025258 | Bacteria | 313043 |
| 178 | Ga0209676_1000106 | 3300025292 | Bacteria | 222576 |
| 179 | Ga0209025_1000020 | 3300025294 | Bacteria | 618024 |
| 180 | Ga0209758_1000022 | 3300025297 | Bacteria | 618024 |
| 181 | Ga0209050_1000174 | 3300025298 | Bacteria | 148871 |
| 182 | Ga0209051_1060899 | 3300025303 | Bacteria | 1189 |
| 183 | Ga0207656_10001476 | 3300025321 | Bacteria | 7789 |
| 184 | Ga0207655_1012720 | 3300025728 | Bacteria | 4890 |
| 185 | Ga0207680_10003588 | 3300025903 | Bacteria | 7291 |
| 186 | Ga0207680_10238812 | 3300025903 | Bacteria | 1251 |
| 187 | Ga0207647_10094913 | 3300025904 | Bacteria | 1776 |
| 188 | Ga0207685_10318642 | 3300025905 | Bacteria | 775 |
| 189 | Ga0207699_10177279 | 3300025906 | Unclassified | 1430 |
| 190 | Ga0207645_10012445 | 3300025907 | Bacteria | 5771 |
| 191 | Ga0207705_10021772 | 3300025909 | Bacteria | 4574 |
| 192 | Ga0207654_10022283 | 3300025911 | Bacteria | 3378 |
| 193 | Ga0207654_10030836 | 3300025911 | Bacteria | 2947 |
| 194 | Ga0207695_10005162 | 3300025913 | Bacteria | 17482 |
| 195 | Ga0207695_10007643 | 3300025913 | Bacteria | 13697 |
| 196 | Ga0207695_10096879 | 3300025913 | Bacteria | 2951 |
| 197 | Ga0207695_10181673 | 3300025913 | Unclassified | 2024 |
| 198 | Ga0207695_10302064 | 3300025913 | Bacteria | 1492 |
| 199 | Ga0207695_10848581 | 3300025913 | Bacteria | 793 |
| 200 | Ga0207671_10000110 | 3300025914 | Bacteria | 126480 |
| 201 | Ga0207671_10002077 | 3300025914 | Bacteria | 21915 |
| 202 | Ga0207671_10017404 | 3300025914 | Bacteria | 5543 |
| 203 | Ga0207671_10027188 | 3300025914 | Bacteria | 4278 |
| 204 | Ga0207671_10213261 | 3300025914 | Bacteria | 1511 |
| 205 | Ga0207662_10064495 | 3300025918 | Bacteria | 2204 |
| 206 | Ga0207646_10250248 | 3300025922 | Bacteria | 1601 |
| 207 | Ga0207694_10051909 | 3300025924 | Bacteria | 3178 |
| 208 | Ga0207694_10221459 | 3300025924 | Bacteria | 1544 |
| 209 | Ga0207694_10270575 | 3300025924 | Bacteria | 1394 |
| 210 | Ga0207694_10363461 | 3300025924 | Unclassified | 1200 |
| 211 | Ga0207700_10057232 | 3300025928 | Bacteria | 2939 |
| 212 | Ga0207700_10720011 | 3300025928 | Unclassified | 891 |
| 213 | Ga0207706_10163648 | 3300025933 | Bacteria | 1955 |
| 214 | Ga0207686_10086341 | 3300025934 | Unclassified | 2060 |
| 215 | Ga0207686_10142091 | 3300025934 | Bacteria | 1661 |
| 216 | Ga0207704_10273839 | 3300025938 | Unclassified | 1279 |
| 217 | Ga0207665_10350874 | 3300025939 | Unclassified | 1114 |
| 218 | Ga0207665_10593226 | 3300025939 | Bacteria | 864 |
| 219 | Ga0207691_10000060 | 3300025940 | Bacteria | 86844 |
| 220 | Ga0207711_10107541 | 3300025941 | Bacteria | 2476 |
| 221 | Ga0207711_10167963 | 3300025941 | Bacteria | 1989 |
| 222 | Ga0207689_10370034 | 3300025942 | Bacteria | 1192 |
| 223 | Ga0207661_10010543 | 3300025944 | Bacteria | 6657 |
| 224 | Ga0207661_10388430 | 3300025944 | Unclassified | 1264 |
| 225 | Ga0207679_11090386 | 3300025945 | Unclassified | 733 |
| 226 | Ga0207667_10000221 | 3300025949 | Bacteria | 79940 |
| 227 | Ga0207667_10074678 | 3300025949 | Bacteria | 3521 |
| 228 | Ga0207712_10087033 | 3300025961 | Bacteria | 2290 |
| 229 | Ga0207668_10000268 | 3300025972 | Bacteria | 34571 |
| 230 | Ga0207658_10237142 | 3300025986 | Bacteria | 1543 |
| 231 | Ga0207677_10005966 | 3300026023 | Bacteria | 6633 |
| 232 | Ga0207677_10046446 | 3300026023 | Bacteria | 2908 |
| 233 | Ga0207677_10761973 | 3300026023 | Unclassified | 864 |
| 234 | Ga0207703_10008010 | 3300026035 | Bacteria | 8350 |
| 235 | Ga0207639_10114366 | 3300026041 | Bacteria | 2205 |
| 236 | Ga0207702_10305937 | 3300026078 | Unclassified | 1510 |
| 237 | Ga0207702_10326091 | 3300026078 | Bacteria | 1463 |
| 238 | Ga0207641_10005697 | 3300026088 | Bacteria | 10601 |
| 239 | Ga0207641_10111244 | 3300026088 | Unclassified | 2428 |
| 240 | Ga0207641_10173589 | 3300026088 | Bacteria | 1970 |
| 241 | Ga0207641_10649309 | 3300026088 | Bacteria | 1036 |
| 242 | Ga0207648_10002360 | 3300026089 | Bacteria | 20382 |
| 243 | Ga0207648_10335031 | 3300026089 | Bacteria | 1362 |
| 244 | Ga0207676_10002113 | 3300026095 | Bacteria | 14399 |
| 245 | Ga0207676_10078653 | 3300026095 | Bacteria | 2672 |
| 246 | Ga0207676_10429559 | 3300026095 | Unclassified | 1241 |
| 247 | Ga0207674_10003801 | 3300026116 | Bacteria | 18411 |
| 248 | Ga0207675_100070907 | 3300026118 | Bacteria | 3257 |
| 249 | Ga0207698_10007888 | 3300026142 | Bacteria | 6703 |
| 250 | Ga0207698_10418885 | 3300026142 | Bacteria | 1284 |
| 251 | Ga0207698_10637904 | 3300026142 | Bacteria | 1054 |
| 252 | Ga0268266_10000024 | 3300028379 | Bacteria | 490820 |
| 253 | Ga0268266_11329533 | 3300028379 | Unclassified | 694 |
| 254 | Ga0268265_10259604 | 3300028380 | Bacteria | 1544 |
| 255 | Ga0268264_10000243 | 3300028381 | Bacteria | 102854 |
| 256 | Ga0268264_10004484 | 3300028381 | Bacteria | 11912 |
| 257 | Ga0268264_10048348 | 3300028381 | Bacteria | 3539 |
| 258 | Ga0265323_10008118 | 3300028653 | Bacteria | 4340 |
| 259 | Ga0307515_10013124 | 3300028794 | Bacteria | 15508 |
| 260 | Ga0307515_10512043 | 3300028794 | Bacteria | 810 |
| 261 | Ga0316177_1173064 | 3300030731 | Bacteria | 1590 |
| 262 | Ga0316176_1113607 | 3300030732 | Bacteria | 11503 |
| 263 | Ga0316183_1107442 | 3300030742 | Bacteria | 17978 |
| 264 | Ga0316181_1199804 | 3300030744 | Bacteria | 917 |
| 265 | Ga0316181_1214383 | 3300030744 | Bacteria | 2615 |
| 266 | Ga0265760_10023573 | 3300031090 | Bacteria | 1789 |
| 267 | Ga0265331_10071884 | 3300031250 | Bacteria | 1617 |
| 268 | Ga0265316_10000607 | 3300031344 | Bacteria | 39905 |
| 269 | Ga0265316_10117379 | 3300031344 | Bacteria | 2011 |
| 270 | Ga0265316_10198283 | 3300031344 | Bacteria | 1489 |
| 271 | Ga0265316_10261066 | 3300031344 | Unclassified | 1270 |
| 272 | Ga0265316_10279274 | 3300031344 | Bacteria | 1220 |
| 273 | Ga0307513_10151654 | 3300031456 | Bacteria | 2225 |
| 274 | Ga0307513_10238229 | 3300031456 | Bacteria | 1627 |
| 275 | Ga0307509_10218654 | 3300031507 | Bacteria | 1721 |
| 276 | Ga0265342_10114420 | 3300031712 | Bacteria | 1524 |
| 277 | Ga0307405_10000025 | 3300031731 | Bacteria | 123095 |
| 278 | Ga0307405_10053513 | 3300031731 | Bacteria | 2515 |
| 279 | Ga0307407_10000016 | 3300031903 | Bacteria | 141499 |
| 280 | Ga0307412_10000085 | 3300031911 | Bacteria | 88692 |
| 281 | Ga0307412_10129438 | 3300031911 | Bacteria | 1831 |
| 282 | Ga0307412_10168726 | 3300031911 | Bacteria | 1634 |
| 283 | Ga0307412_10221691 | 3300031911 | Bacteria | 1450 |
| 284 | Ga0307409_100109761 | 3300031995 | Bacteria | 2310 |
| 285 | Ga0307416_100000036 | 3300032002 | Bacteria | 141505 |
| 286 | Ga0307414_10000548 | 3300032004 | Bacteria | 19615 |
| 287 | Ga0307414_10011329 | 3300032004 | Bacteria | 5225 |
| 288 | Ga0307414_10016294 | 3300032004 | Bacteria | 4514 |
| 289 | Ga0307414_10051691 | 3300032004 | Bacteria | 2854 |
| 290 | Ga0307414_10141993 | 3300032004 | Bacteria | 1881 |
| 291 | Ga0307414_10144247 | 3300032004 | Bacteria | 1868 |
| 292 | Ga0307414_10504695 | 3300032004 | Bacteria | 1071 |
| 293 | Ga0307414_10712871 | 3300032004 | Bacteria | 909 |
| 294 | Ga0307411_10432161 | 3300032005 | Bacteria | 1097 |
| 295 | Ga0307507_10305558 | 3300033179 | Bacteria | 971 |
| 296 | Ga0373923_0176323 | 3300035111 | Unclassified | 981 |
| 297 | Ga0373954_0020632 | 3300035118 | Bacteria | 2982 |
| 298 | Ga0373956_0137823 | 3300035119 | Unclassified | 1145 |
| 299 | Ga0373955_0362269 | 3300035172 | Unclassified | 879 |
| 300 | Ga0373927_0075221 | 3300035695 | Unclassified | 2187 |
| 301 | Ga0373933_0586755 | 3300035724 | Bacteria | 732 |
| 302 | Ga0373947_0104864 | 3300035725 | Unclassified | 1781 |
| 303 | Ga0373947_0280897 | 3300035725 | Unclassified | 1107 |
| 304 | Ga0436364_0900019 | 3300037853 | Bacteria | 4884 |
| 305 | Ga0436360_0196989 | 3300039438 | Bacteria | 16492 |
| 306 | Ga0436361_0687955 | 3300039447 | Unclassified | 870 |
| 307 | Ga0436361_1195550 | 3300039447 | Unclassified | 1010 |
| 308 | Ga0439439_0007206 | 3300041406 | Bacteria | 2594 |
| 309 | Ga0451791_0203047 | 3300041451 | Bacteria | 1657 |
| 310 | Ga0451793_0529887 | 3300041452 | Bacteria | 1338 |
| 311 | Ga0451800_0828905 | 3300041459 | Bacteria | 839 |
| 312 | Ga0451802_0121489 | 3300041460 | Bacteria | 1768 |
| 313 | Ga0451849_1190738 | 3300041505 | Bacteria | 1163 |
| 314 | Ga0439449_0008287 | 3300042007 | Bacteria | 3953 |
| 315 | Ga0439457_000008 | 3300042014 | Bacteria | 42068 |
| 316 | Ga0439462_0000815 | 3300042015 | Bacteria | 6504 |
| 317 | Ga0450894_015412 | 3300042131 | Bacteria | 1012 |
| 318 | Ga0450893_0045960 | 3300042532 | Bacteria | 809 |
| 319 | Ga0451577_0001955 | 3300042876 | Bacteria | 25990 |
| 320 | Ga0466972_0027294 | 3300044658 | Bacteria | 2825 |
| 321 | Ga0466972_0071677 | 3300044658 | Bacteria | 1652 |
| 322 | Ga0466972_0172645 | 3300044658 | Bacteria | 1014 |
| 323 | Ga0453684_0007415 | 3300044712 | Bacteria | 20187 |
| 324 | Ga0453684_0639751 | 3300044712 | Bacteria | 1162 |
| 325 | Ga0466968_0047844 | 3300044735 | Bacteria | 1819 |
| 326 | Ga0466957_0001154 | 3300044842 | Bacteria | 13664 |
| 327 | Ga0466960_0174253 | 3300044901 | Bacteria | 1163 |
| 328 | Ga0451576_0019383 | 3300045051 | Bacteria | 7427 |
| 329 | Ga0451576_0543317 | 3300045051 | Bacteria | 1221 |
| 330 | Ga0451576_0565365 | 3300045051 | Bacteria | 1195 |
| 331 | Ga0451576_0753675 | 3300045051 | Unclassified | 1023 |
| 332 | Ga0495592_0033185 | 3300046454 | Bacteria | 3894 |
| 333 | Ga0495651_0038977 | 3300046462 | Bacteria | 3700 |
| 334 | Ga0495653_0168286 | 3300046463 | Bacteria | 1515 |
| 335 | Ga0495580_0037781 | 3300046472 | Unclassified | 3462 |
| 336 | Ga0495580_0078768 | 3300046472 | Unclassified | 2298 |
| 337 | Ga0495580_0187578 | 3300046472 | Unclassified | 1427 |
| 338 | Ga0495639_0270849 | 3300046475 | Bacteria | 843 |
| 339 | Ga0495662_0017566 | 3300046476 | Bacteria | 3462 |
| 340 | Ga0495664_0006701 | 3300046477 | Bacteria | 6371 |
| 341 | Ga0495594_0149002 | 3300046499 | Unclassified | 1328 |
| 342 | Ga0495607_0188231 | 3300046501 | Bacteria | 1030 |
| 343 | Ga0495606_0015427 | 3300046507 | Bacteria | 5885 |
| 344 | Ga0495608_0040514 | 3300046511 | Bacteria | 3120 |
| 345 | Ga0495610_0000119 | 3300046512 | Bacteria | 89692 |
| 346 | Ga0495610_0010840 | 3300046512 | Bacteria | 5628 |
| 347 | Ga0495618_0009838 | 3300046514 | Bacteria | 5783 |
| 348 | Ga0495628_0010921 | 3300046516 | Bacteria | 7690 |
| 349 | Ga0495630_0009909 | 3300046517 | Bacteria | 6862 |
| 350 | Ga0495637_0034550 | 3300046520 | Bacteria | 2213 |
| 351 | Ga0495648_0003776 | 3300046524 | Bacteria | 13174 |
| 352 | Ga0495652_0007150 | 3300046529 | Bacteria | 10301 |
| 353 | Ga0495652_0420176 | 3300046529 | Bacteria | 942 |
| 354 | Ga0495665_0070702 | 3300046531 | Unclassified | 1839 |
| 355 | Ga0495665_0137529 | 3300046531 | Unclassified | 1278 |
| 356 | Ga0495640_0022814 | 3300046533 | Bacteria | 4570 |
| 357 | Ga0495586_0080845 | 3300046535 | Unclassified | 1786 |
| 358 | Ga0495587_0026684 | 3300046536 | Bacteria | 3521 |
| 359 | Ga0495587_0112245 | 3300046536 | Bacteria | 1565 |
| 360 | Ga0495609_0014814 | 3300046538 | Bacteria | 3659 |
| 361 | Ga0495645_0003842 | 3300046543 | Bacteria | 10223 |
| 362 | Ga0495667_0042546 | 3300046559 | Bacteria | 3012 |
| 363 | Ga0495634_0008872 | 3300046642 | Bacteria | 7455 |
| 364 | Ga0495635_0029254 | 3300046663 | Bacteria | 3830 |
| 365 | Ga0495588_0102742 | 3300046674 | Unclassified | 1503 |
| 366 | Ga0495657_0202630 | 3300046675 | Bacteria | 1209 |
| 367 | Ga0495599_0006439 | 3300046678 | Bacteria | 7083 |
| 368 | Ga0495599_0122164 | 3300046678 | Unclassified | 1619 |
| 369 | Ga0495623_0054050 | 3300046679 | Unclassified | 2534 |
| 370 | Ga0495658_0393840 | 3300046683 | Unclassified | 883 |
| 371 | Ga0495669_0255980 | 3300046684 | Unclassified | 841 |
| 372 | Ga0495613_0047448 | 3300046689 | Bacteria | 3173 |
| 373 | Ga0495604_0014207 | 3300047317 | Bacteria | 6347 |
| 374 | Ga0495604_0103967 | 3300047317 | Unclassified | 2082 |
| 375 | Ga0495604_0695319 | 3300047317 | Unclassified | 646 |
| 376 | Ga0495674_0032395 | 3300047319 | Bacteria | 4740 |
| 377 | Ga0495680_0063802 | 3300047322 | Bacteria | 2827 |
| 378 | Ga0495680_0167754 | 3300047322 | Unclassified | 1591 |
| 379 | Ga0495687_000014 | 3300047443 | Bacteria | 366896 |
| 380 | Ga0495675_0108346 | 3300047444 | Unclassified | 1735 |
| 381 | Ga0495681_0177336 | 3300047470 | Bacteria | 878 |
| 382 | Ga0495684_0017619 | 3300047471 | Bacteria | 5500 |
| 383 | Ga0495684_0020315 | 3300047471 | Bacteria | 5116 |
| 384 | Ga0495684_0547292 | 3300047471 | Unclassified | 789 |
| 385 | Ga0495686_0286582 | 3300047472 | Bacteria | 914 |
| 386 | Ga0495614_0196457 | 3300048089 | Unclassified | 912 |
| 387 | Ga0496102_0947588 | 3300048905 | Bacteria | 782 |
| 388 | Ga0496109_0428873 | 3300048912 | Bacteria | 1249 |
| 389 | Ga0496112_0220521 | 3300048915 | Bacteria | 1853 |
| 390 | Ga0496115_0042380 | 3300048918 | Bacteria | 3626 |
| 391 | Ga0496115_0318542 | 3300048918 | Bacteria | 1272 |
| 392 | Ga0496122_0000862 | 3300048925 | Bacteria | 57049 |
| 393 | Ga0496123_0003821 | 3300048926 | Bacteria | 16441 |
| 394 | Ga0496125_0073301 | 3300048928 | Bacteria | 2663 |
| 395 | Ga0501046_0297626 | 3300049580 | Bacteria | 1179 |
| 396 | Ga0501047_0018627 | 3300049581 | Bacteria | 6657 |
| 397 | Ga0501047_0246863 | 3300049581 | Bacteria | 1634 |
| 398 | Ga0501223_008818 | 3300049663 | Bacteria | 2053 |
| 399 | Ga0501225_0001777 | 3300049705 | Bacteria | 6748 |
| 400 | Ga0501241_003707 | 3300049758 | Bacteria | 2880 |
| 401 | Ga0501241_004719 | 3300049758 | Bacteria | 2543 |
| 402 | Ga0501044_0021886 | 3300049823 | Bacteria | 6817 |
| 403 | nmdc:mga0n895_1508675_c1 | 3300050512 | Unclassified | 638 |
| 404 | Ga0500578_0000119 | 3300053086 | Bacteria | 95584 |
| 405 | Ga0500578_0159206 | 3300053086 | Bacteria | 1402 |
| 406 | Ga0500646_0105733 | 3300053090 | Bacteria | 889 |
| 407 | Ga0500583_0000014 | 3300053092 | Bacteria | 147919 |
| 408 | Ga0500583_0000841 | 3300053092 | Bacteria | 8842 |
| 409 | Ga0500583_0012959 | 3300053092 | Bacteria | 3204 |
| 410 | Ga0500651_0000078 | 3300053093 | Bacteria | 62741 |
| 411 | Ga0500651_0533902 | 3300053093 | Bacteria | 643 |
| 412 | Ga0500572_029879 | 3300053111 | Bacteria | 1511 |
| 413 | Ga0500642_0032710 | 3300053130 | Bacteria | 2184 |
| 414 | Ga0500652_092996 | 3300053131 | Bacteria | 1259 |
| 415 | Ga0500658_0155856 | 3300053134 | Bacteria | 1032 |
| 416 | Ga0500588_0057966 | 3300053146 | Bacteria | 1231 |
| 417 | Ga0500603_113269 | 3300053150 | Bacteria | 816 |
| 418 | Ga0500604_0110087 | 3300053151 | Bacteria | 914 |
| 419 | Ga0500616_0053524 | 3300053153 | Bacteria | 2117 |
| 420 | Ga0500622_0002764 | 3300053156 | Bacteria | 12347 |
| 421 | Ga0500622_0035190 | 3300053156 | Bacteria | 2621 |
| 422 | Ga0500633_0140207 | 3300053160 | Bacteria | 905 |
| 423 | Ga0500639_164083 | 3300053163 | Bacteria | 1006 |
| 424 | Ga0500611_013713 | 3300053727 | Bacteria | 1397 |
| 425 | Ga0501082_0000163 | 3300060353 | Bacteria | 56753 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025941 | Ga0207711_10167963 | Ga0207711_101679632 | 156 |
| 2 | 3300048905 | Ga0496102_0947588 | Ga0496102_0947588_48_578 | 171 |
| 3 | 3300006237 | Ga0097621_100282052 | Ga0097621_1002820521 | 179 |
| 4 | 3300021384 | Ga0213876_10109631 | Ga0213876_101096312 | 179 |
| 5 | 3300039447 | Ga0436361_1195550 | Ga0436361_1195550_145_732 | 180 |
| 6 | 3300039447 | Ga0436361_0687955 | Ga0436361_0687955_234_818 | 181 |
| 7 | 3300021441 | Ga0213871_10001505 | Ga0213871_100015053 | 182 |
| 8 | 3300039438 | Ga0436360_0196989 | Ga0436360_0196989_5811_6404 | 182 |
| 9 | iso_pu_bacteria | 2585427687 | 2586209771 | 182 |
| 10 | iso_pu_bacteria | 2738541278 | 2738729080 | 182 |
| 11 | iso_pu_bacteria | 2738541302 | 2738854244 | 182 |
| 12 | iso_pu_bacteria | 2738543023 | 2739301945 | 182 |
| 13 | iso_pu_bacteria | 2739367651 | 2739587348 | 182 |
| 14 | iso_pu_bacteria | 2739367656 | 2739617486 | 182 |
| 15 | iso_pu_bacteria | 2739367663 | 2739647926 | 182 |
| 16 | iso_pu_bacteria | 2775506987 | 2776615299 | 182 |
| 17 | iso_pu_bacteria | 2818991437 | 2819550171 | 182 |
| 18 | iso_pu_bacteria | 2842722452 | 2842726795 | 182 |
| 19 | iso_pu_bacteria | 2842903701 | 2842908866 | 182 |
| 20 | iso_pu_bacteria | 2842909656 | 2842911636 | 182 |
| 21 | iso_pu_bacteria | 2849281842 | 2849285176 | 182 |
| 22 | iso_pu_bacteria | 2852627209 | 2852629083 | 182 |
| 23 | iso_pu_bacteria | 2857627736 | 2857630426 | 182 |
| 24 | iso_pu_bacteria | 2902048731 | 2902049377 | 182 |
| 25 | iso_pu_bacteria | 2904445276 | 2904448904 | 182 |
| 26 | iso_pu_bacteria | 2919186247 | 2919189040 | 182 |
| 27 | iso_pu_bacteria | 2939664404 | 2939666805 | 182 |
| 28 | iso_pu_bacteria | 2945997725 | 2946002889 | 182 |
| 29 | iso_pu_bacteria | 2954016120 | 2954019748 | 182 |
| 30 | 3300025933 | Ga0207706_10163648 | Ga0207706_101636483 | 184 |
| 31 | 3300044712 | Ga0453684_0007415 | Ga0453684_0007415_3990_4550 | 184 |
| 32 | 3300045051 | Ga0451576_0565365 | Ga0451576_0565365_504_1064 | 184 |
| 33 | iso_pu_bacteria | 8055588893 | 8055590817 | 184 |
| 34 | 3300005329 | Ga0070683_100021602 | Ga0070683_1000216027 | 185 |
| 35 | 3300005329 | Ga0070683_100349723 | Ga0070683_1003497232 | 185 |
| 36 | 3300005329 | Ga0070683_100656784 | Ga0070683_1006567842 | 185 |
| 37 | 3300005364 | Ga0070673_100377221 | Ga0070673_1003772213 | 185 |
| 38 | 3300005434 | Ga0070709_10236797 | Ga0070709_102367972 | 185 |
| 39 | 3300005535 | Ga0070684_100168610 | Ga0070684_1001686102 | 185 |
| 40 | 3300005548 | Ga0070665_100242951 | Ga0070665_1002429512 | 185 |
| 41 | 3300005563 | Ga0068855_100039247 | Ga0068855_1000392478 | 185 |
| 42 | 3300005841 | Ga0068863_100170020 | Ga0068863_1001700203 | 185 |
| 43 | 3300005841 | Ga0068863_100438642 | Ga0068863_1004386421 | 185 |
| 44 | 3300006028 | Ga0070717_10304216 | Ga0070717_103042162 | 185 |
| 45 | 3300006028 | Ga0070717_10312939 | Ga0070717_103129392 | 185 |
| 46 | 3300006358 | Ga0068871_100491816 | Ga0068871_1004918162 | 185 |
| 47 | 3300009093 | Ga0105240_10003646 | Ga0105240_100036463 | 185 |
| 48 | 3300009093 | Ga0105240_10244571 | Ga0105240_102445713 | 185 |
| 49 | 3300009094 | Ga0111539_10551517 | Ga0111539_105515172 | 185 |
| 50 | 3300009147 | Ga0114129_11344376 | Ga0114129_113443762 | 185 |
| 51 | 3300009174 | Ga0105241_10278730 | Ga0105241_102787302 | 185 |
| 52 | 3300009174 | Ga0105241_10863934 | Ga0105241_108639342 | 185 |
| 53 | 3300009176 | Ga0105242_10605725 | Ga0105242_106057251 | 185 |
| 54 | 3300009545 | Ga0105237_10219405 | Ga0105237_102194052 | 185 |
| 55 | 3300009551 | Ga0105238_11065592 | Ga0105238_110655921 | 185 |
| 56 | 3300009553 | Ga0105249_10236781 | Ga0105249_102367812 | 185 |
| 57 | 3300011119 | Ga0105246_10426411 | Ga0105246_104264112 | 185 |
| 58 | 3300013104 | Ga0157370_10526309 | Ga0157370_105263092 | 185 |
| 59 | 3300013105 | Ga0157369_10089382 | Ga0157369_100893823 | 185 |
| 60 | 3300013105 | Ga0157369_10248251 | Ga0157369_102482514 | 185 |
| 61 | 3300013105 | Ga0157369_10649231 | Ga0157369_106492312 | 185 |
| 62 | 3300013105 | Ga0157369_10947369 | Ga0157369_109473691 | 185 |
| 63 | 3300013296 | Ga0157374_10177769 | Ga0157374_101777692 | 185 |
| 64 | 3300013297 | Ga0157378_10670928 | Ga0157378_106709282 | 185 |
| 65 | 3300013297 | Ga0157378_10718499 | Ga0157378_107184992 | 185 |
| 66 | 3300013306 | Ga0163162_11057801 | Ga0163162_110578012 | 185 |
| 67 | 3300013306 | Ga0163162_11645470 | Ga0163162_116454702 | 185 |
| 68 | 3300013307 | Ga0157372_10102941 | Ga0157372_101029415 | 185 |
| 69 | 3300013307 | Ga0157372_10995621 | Ga0157372_109956212 | 185 |
| 70 | 3300013308 | Ga0157375_10461289 | Ga0157375_104612892 | 185 |
| 71 | 3300014325 | Ga0163163_10503874 | Ga0163163_105038742 | 185 |
| 72 | 3300014969 | Ga0157376_10089641 | Ga0157376_100896413 | 185 |
| 73 | 3300014969 | Ga0157376_10384911 | Ga0157376_103849112 | 185 |
| 74 | 3300014969 | Ga0157376_10491680 | Ga0157376_104916802 | 185 |
| 75 | 3300015265 | Ga0182005_1064104 | Ga0182005_10641042 | 185 |
| 76 | 3300025905 | Ga0207685_10318642 | Ga0207685_103186422 | 185 |
| 77 | 3300025906 | Ga0207699_10177279 | Ga0207699_101772793 | 185 |
| 78 | 3300025913 | Ga0207695_10007643 | Ga0207695_100076436 | 185 |
| 79 | 3300025913 | Ga0207695_10181673 | Ga0207695_101816733 | 185 |
| 80 | 3300025914 | Ga0207671_10213261 | Ga0207671_102132612 | 185 |
| 81 | 3300025918 | Ga0207662_10064495 | Ga0207662_100644952 | 185 |
| 82 | 3300025924 | Ga0207694_10363461 | Ga0207694_103634612 | 185 |
| 83 | 3300025928 | Ga0207700_10057232 | Ga0207700_100572323 | 185 |
| 84 | 3300025928 | Ga0207700_10720011 | Ga0207700_107200112 | 185 |
| 85 | 3300025934 | Ga0207686_10142091 | Ga0207686_101420912 | 185 |
| 86 | 3300025938 | Ga0207704_10273839 | Ga0207704_102738392 | 185 |
| 87 | 3300025939 | Ga0207665_10350874 | Ga0207665_103508742 | 185 |
| 88 | 3300025939 | Ga0207665_10593226 | Ga0207665_105932262 | 185 |
| 89 | 3300025941 | Ga0207711_10107541 | Ga0207711_101075413 | 185 |
| 90 | 3300025942 | Ga0207689_10370034 | Ga0207689_103700342 | 185 |
| 91 | 3300025944 | Ga0207661_10010543 | Ga0207661_100105432 | 185 |
| 92 | 3300025944 | Ga0207661_10388430 | Ga0207661_103884302 | 185 |
| 93 | 3300026023 | Ga0207677_10761973 | Ga0207677_107619732 | 185 |
| 94 | 3300026088 | Ga0207641_10111244 | Ga0207641_101112443 | 185 |
| 95 | 3300026088 | Ga0207641_10173589 | Ga0207641_101735892 | 185 |
| 96 | 3300026088 | Ga0207641_10649309 | Ga0207641_106493092 | 185 |
| 97 | 3300026089 | Ga0207648_10335031 | Ga0207648_103350312 | 185 |
| 98 | 3300026095 | Ga0207676_10429559 | Ga0207676_104295592 | 185 |
| 99 | 3300028379 | Ga0268266_11329533 | Ga0268266_113295331 | 185 |
| 100 | 3300028653 | Ga0265323_10008118 | Ga0265323_100081184 | 185 |
| 101 | 3300031250 | Ga0265331_10071884 | Ga0265331_100718842 | 185 |
| 102 | 3300031344 | Ga0265316_10000607 | Ga0265316_1000060733 | 185 |
| 103 | 3300031344 | Ga0265316_10117379 | Ga0265316_101173792 | 185 |
| 104 | 3300031344 | Ga0265316_10198283 | Ga0265316_101982832 | 185 |
| 105 | 3300031344 | Ga0265316_10261066 | Ga0265316_102610662 | 185 |
| 106 | 3300031344 | Ga0265316_10279274 | Ga0265316_102792741 | 185 |
| 107 | 3300031712 | Ga0265342_10114420 | Ga0265342_101144202 | 185 |
| 108 | 3300035111 | Ga0373923_0176323 | Ga0373923_0176323_236_826 | 185 |
| 109 | 3300035118 | Ga0373954_0020632 | Ga0373954_0020632_788_1378 | 185 |
| 110 | 3300035119 | Ga0373956_0137823 | Ga0373956_0137823_396_986 | 185 |
| 111 | 3300035172 | Ga0373955_0362269 | Ga0373955_0362269_241_831 | 185 |
| 112 | 3300035695 | Ga0373927_0075221 | Ga0373927_0075221_942_1532 | 185 |
| 113 | 3300035724 | Ga0373933_0586755 | Ga0373933_0586755_78_668 | 185 |
| 114 | 3300035725 | Ga0373947_0104864 | Ga0373947_0104864_631_1221 | 185 |
| 115 | 3300035725 | Ga0373947_0280897 | Ga0373947_0280897_380_970 | 185 |
| 116 | 3300037853 | Ga0436364_0900019 | Ga0436364_0900019_2463_3053 | 185 |
| 117 | 3300044712 | Ga0453684_0639751 | Ga0453684_0639751_538_1128 | 185 |
| 118 | 3300045051 | Ga0451576_0019383 | Ga0451576_0019383_4838_5428 | 185 |
| 119 | 3300045051 | Ga0451576_0543317 | Ga0451576_0543317_564_1154 | 185 |
| 120 | 3300045051 | Ga0451576_0753675 | Ga0451576_0753675_153_743 | 185 |
| 121 | 3300046454 | Ga0495592_0033185 | Ga0495592_0033185_1960_2550 | 185 |
| 122 | 3300046462 | Ga0495651_0038977 | Ga0495651_0038977_1850_2440 | 185 |
| 123 | 3300046463 | Ga0495653_0168286 | Ga0495653_0168286_156_746 | 185 |
| 124 | 3300046472 | Ga0495580_0037781 | Ga0495580_0037781_792_1382 | 185 |
| 125 | 3300046472 | Ga0495580_0078768 | Ga0495580_0078768_535_1125 | 185 |
| 126 | 3300046472 | Ga0495580_0187578 | Ga0495580_0187578_112_702 | 185 |
| 127 | 3300046475 | Ga0495639_0270849 | Ga0495639_0270849_171_761 | 185 |
| 128 | 3300046476 | Ga0495662_0017566 | Ga0495662_0017566_2062_2652 | 185 |
| 129 | 3300046477 | Ga0495664_0006701 | Ga0495664_0006701_3872_4462 | 185 |
| 130 | 3300046499 | Ga0495594_0149002 | Ga0495594_0149002_340_930 | 185 |
| 131 | 3300046511 | Ga0495608_0040514 | Ga0495608_0040514_1256_1846 | 185 |
| 132 | 3300046514 | Ga0495618_0009838 | Ga0495618_0009838_4656_5246 | 185 |
| 133 | 3300046516 | Ga0495628_0010921 | Ga0495628_0010921_2082_2672 | 185 |
| 134 | 3300046517 | Ga0495630_0009909 | Ga0495630_0009909_3868_4458 | 185 |
| 135 | 3300046529 | Ga0495652_0007150 | Ga0495652_0007150_7704_8294 | 185 |
| 136 | 3300046529 | Ga0495652_0420176 | Ga0495652_0420176_231_821 | 185 |
| 137 | 3300046531 | Ga0495665_0070702 | Ga0495665_0070702_492_1082 | 185 |
| 138 | 3300046531 | Ga0495665_0137529 | Ga0495665_0137529_456_1046 | 185 |
| 139 | 3300046533 | Ga0495640_0022814 | Ga0495640_0022814_2686_3276 | 185 |
| 140 | 3300046535 | Ga0495586_0080845 | Ga0495586_0080845_945_1535 | 185 |
| 141 | 3300046536 | Ga0495587_0026684 | Ga0495587_0026684_1023_1613 | 185 |
| 142 | 3300046536 | Ga0495587_0112245 | Ga0495587_0112245_126_716 | 185 |
| 143 | 3300046543 | Ga0495645_0003842 | Ga0495645_0003842_2096_2686 | 185 |
| 144 | 3300046559 | Ga0495667_0042546 | Ga0495667_0042546_1704_2294 | 185 |
| 145 | 3300046642 | Ga0495634_0008872 | Ga0495634_0008872_1793_2383 | 185 |
| 146 | 3300046663 | Ga0495635_0029254 | Ga0495635_0029254_2218_2808 | 185 |
| 147 | 3300046674 | Ga0495588_0102742 | Ga0495588_0102742_765_1355 | 185 |
| 148 | 3300046675 | Ga0495657_0202630 | Ga0495657_0202630_546_1136 | 185 |
| 149 | 3300046678 | Ga0495599_0006439 | Ga0495599_0006439_1315_1905 | 185 |
| 150 | 3300046678 | Ga0495599_0122164 | Ga0495599_0122164_179_769 | 185 |
| 151 | 3300046679 | Ga0495623_0054050 | Ga0495623_0054050_1266_1856 | 185 |
| 152 | 3300046683 | Ga0495658_0393840 | Ga0495658_0393840_251_841 | 185 |
| 153 | 3300046684 | Ga0495669_0255980 | Ga0495669_0255980_84_674 | 185 |
| 154 | 3300046689 | Ga0495613_0047448 | Ga0495613_0047448_1696_2286 | 185 |
| 155 | 3300047317 | Ga0495604_0014207 | Ga0495604_0014207_1896_2486 | 185 |
| 156 | 3300047317 | Ga0495604_0103967 | Ga0495604_0103967_405_995 | 185 |
| 157 | 3300047317 | Ga0495604_0695319 | Ga0495604_0695319_22_612 | 185 |
| 158 | 3300047319 | Ga0495674_0032395 | Ga0495674_0032395_2608_3198 | 185 |
| 159 | 3300047322 | Ga0495680_0063802 | Ga0495680_0063802_408_998 | 185 |
| 160 | 3300047322 | Ga0495680_0167754 | Ga0495680_0167754_444_1034 | 185 |
| 161 | 3300047444 | Ga0495675_0108346 | Ga0495675_0108346_1117_1707 | 185 |
| 162 | 3300047471 | Ga0495684_0017619 | Ga0495684_0017619_3190_3780 | 185 |
| 163 | 3300047471 | Ga0495684_0020315 | Ga0495684_0020315_1144_1734 | 185 |
| 164 | 3300047471 | Ga0495684_0547292 | Ga0495684_0547292_183_773 | 185 |
| 165 | 3300048089 | Ga0495614_0196457 | Ga0495614_0196457_294_884 | 185 |
| 166 | 3300048915 | Ga0496112_0220521 | Ga0496112_0220521_1104_1694 | 185 |
| 167 | 3300048918 | Ga0496115_0042380 | Ga0496115_0042380_804_1394 | 185 |
| 168 | 3300050512 | nmdc:mga0n895_1508675_c1 | nmdc:mga0n895_1508675_c1_28_618 | 185 |
| 169 | 3300060353 | Ga0501082_0000163 | Ga0501082_0000163_33207_33797 | 185 |
| 170 | 3300002773 | JGI25152J39213_1000006 | JGI25152J39213_1000006102 | 186 |
| 171 | 3300002774 | JGI25150J39212_1000005 | JGI25150J39212_1000005132 | 186 |
| 172 | 3300003187 | JGI25151J46595_10000004 | JGI25151J46595_10000004300 | 186 |
| 173 | 3300003215 | JGI25153J46596_10000004 | JGI25153J46596_10000004300 | 186 |
| 174 | 3300003322 | rootL2_10082792 | rootL2_100827925 | 186 |
| 175 | 3300003323 | rootH1_10303714 | rootH1_103037142 | 186 |
| 176 | 3300003781 | Ga0055536_1000016 | Ga0055536_100001652 | 186 |
| 177 | 3300003791 | Ga0055530_10005786 | Ga0055530_100057862 | 186 |
| 178 | 3300005288 | Ga0065714_10002573 | Ga0065714_100025734 | 186 |
| 179 | 3300005288 | Ga0065714_10002973 | Ga0065714_1000297312 | 186 |
| 180 | 3300005288 | Ga0065714_10012335 | Ga0065714_100123351 | 186 |
| 181 | 3300005288 | Ga0065714_10070557 | Ga0065714_100705573 | 186 |
| 182 | 3300005288 | Ga0065714_10078139 | Ga0065714_100781393 | 186 |
| 183 | 3300005288 | Ga0065714_10134859 | Ga0065714_101348592 | 186 |
| 184 | 3300005289 | Ga0065704_10070246 | Ga0065704_1007024612 | 186 |
| 185 | 3300005289 | Ga0065704_10087243 | Ga0065704_100872434 | 186 |
| 186 | 3300005289 | Ga0065704_10246133 | Ga0065704_102461332 | 186 |
| 187 | 3300005328 | Ga0070676_10004845 | Ga0070676_100048454 | 186 |
| 188 | 3300005331 | Ga0070670_100360435 | Ga0070670_1003604352 | 186 |
| 189 | 3300005335 | Ga0070666_10003308 | Ga0070666_100033083 | 186 |
| 190 | 3300005338 | Ga0068868_100013965 | Ga0068868_1000139655 | 186 |
| 191 | 3300005339 | Ga0070660_100209481 | Ga0070660_1002094812 | 186 |
| 192 | 3300005354 | Ga0070675_100128933 | Ga0070675_1001289332 | 186 |
| 193 | 3300005356 | Ga0070674_100151986 | Ga0070674_1001519862 | 186 |
| 194 | 3300005366 | Ga0070659_100421563 | Ga0070659_1004215632 | 186 |
| 195 | 3300005367 | Ga0070667_100000957 | Ga0070667_1000009579 | 186 |
| 196 | 3300005367 | Ga0070667_100220620 | Ga0070667_1002206202 | 186 |
| 197 | 3300005367 | Ga0070667_100635095 | Ga0070667_1006350952 | 186 |
| 198 | 3300005367 | Ga0070667_100761816 | Ga0070667_1007618162 | 186 |
| 199 | 3300005434 | Ga0070709_10136077 | Ga0070709_101360772 | 186 |
| 200 | 3300005471 | Ga0070698_100129915 | Ga0070698_1001299154 | 186 |
| 201 | 3300005539 | Ga0068853_100076028 | Ga0068853_1000760283 | 186 |
| 202 | 3300005543 | Ga0070672_100000365 | Ga0070672_10000036513 | 186 |
| 203 | 3300005548 | Ga0070665_100000013 | Ga0070665_100000013346 | 186 |
| 204 | 3300005548 | Ga0070665_100001739 | Ga0070665_10000173915 | 186 |
| 205 | 3300005563 | Ga0068855_100097359 | Ga0068855_1000973593 | 186 |
| 206 | 3300005563 | Ga0068855_100129056 | Ga0068855_1001290563 | 186 |
| 207 | 3300005564 | Ga0070664_101307906 | Ga0070664_1013079061 | 186 |
| 208 | 3300005577 | Ga0068857_100076672 | Ga0068857_1000766723 | 186 |
| 209 | 3300005614 | Ga0068856_100117366 | Ga0068856_1001173663 | 186 |
| 210 | 3300005614 | Ga0068856_100123662 | Ga0068856_1001236623 | 186 |
| 211 | 3300005616 | Ga0068852_100000197 | Ga0068852_1000001979 | 186 |
| 212 | 3300005616 | Ga0068852_100674548 | Ga0068852_1006745481 | 186 |
| 213 | 3300005618 | Ga0068864_100000176 | Ga0068864_10000017627 | 186 |
| 214 | 3300005618 | Ga0068864_100107907 | Ga0068864_1001079073 | 186 |
| 215 | 3300005719 | Ga0068861_100041841 | Ga0068861_1000418416 | 186 |
| 216 | 3300005834 | Ga0068851_10000284 | Ga0068851_100002844 | 186 |
| 217 | 3300005841 | Ga0068863_100001185 | Ga0068863_1000011852 | 186 |
| 218 | 3300005841 | Ga0068863_100737536 | Ga0068863_1007375362 | 186 |
| 219 | 3300005842 | Ga0068858_100201144 | Ga0068858_1002011442 | 186 |
| 220 | 3300005843 | Ga0068860_100000060 | Ga0068860_10000006016 | 186 |
| 221 | 3300005843 | Ga0068860_100004691 | Ga0068860_1000046919 | 186 |
| 222 | 3300005843 | Ga0068860_100412559 | Ga0068860_1004125592 | 186 |
| 223 | 3300006195 | Ga0075366_10293392 | Ga0075366_102933921 | 186 |
| 224 | 3300006237 | Ga0097621_100556836 | Ga0097621_1005568361 | 186 |
| 225 | 3300006358 | Ga0068871_100069347 | Ga0068871_1000693474 | 186 |
| 226 | 3300009036 | Ga0105244_10006081 | Ga0105244_100060814 | 186 |
| 227 | 3300009093 | Ga0105240_10000570 | Ga0105240_100005708 | 186 |
| 228 | 3300009093 | Ga0105240_10135655 | Ga0105240_101356553 | 186 |
| 229 | 3300009093 | Ga0105240_10186114 | Ga0105240_101861143 | 186 |
| 230 | 3300009093 | Ga0105240_10274589 | Ga0105240_102745892 | 186 |
| 231 | 3300009093 | Ga0105240_10439339 | Ga0105240_104393391 | 186 |
| 232 | 3300009148 | Ga0105243_10584906 | Ga0105243_105849062 | 186 |
| 233 | 3300009174 | Ga0105241_10004753 | Ga0105241_100047534 | 186 |
| 234 | 3300009174 | Ga0105241_10074540 | Ga0105241_100745403 | 186 |
| 235 | 3300009174 | Ga0105241_10259505 | Ga0105241_102595052 | 186 |
| 236 | 3300009176 | Ga0105242_10059155 | Ga0105242_100591554 | 186 |
| 237 | 3300009545 | Ga0105237_10008171 | Ga0105237_100081719 | 186 |
| 238 | 3300009545 | Ga0105237_10008278 | Ga0105237_1000827811 | 186 |
| 239 | 3300009545 | Ga0105237_10010165 | Ga0105237_100101651 | 186 |
| 240 | 3300009545 | Ga0105237_10045930 | Ga0105237_100459305 | 186 |
| 241 | 3300009551 | Ga0105238_10002790 | Ga0105238_1000279010 | 186 |
| 242 | 3300009551 | Ga0105238_10075124 | Ga0105238_100751242 | 186 |
| 243 | 3300009551 | Ga0105238_10218932 | Ga0105238_102189322 | 186 |
| 244 | 3300009553 | Ga0105249_10031809 | Ga0105249_100318093 | 186 |
| 245 | 3300010375 | Ga0105239_10093588 | Ga0105239_100935883 | 186 |
| 246 | 3300010375 | Ga0105239_10454171 | Ga0105239_104541711 | 186 |
| 247 | 3300011119 | Ga0105246_10046004 | Ga0105246_100460043 | 186 |
| 248 | 3300013100 | Ga0157373_10001474 | Ga0157373_100014744 | 186 |
| 249 | 3300013100 | Ga0157373_10002252 | Ga0157373_100022526 | 186 |
| 250 | 3300013100 | Ga0157373_10027194 | Ga0157373_100271945 | 186 |
| 251 | 3300013100 | Ga0157373_10172945 | Ga0157373_101729452 | 186 |
| 252 | 3300013100 | Ga0157373_10278306 | Ga0157373_102783061 | 186 |
| 253 | 3300013102 | Ga0157371_10003596 | Ga0157371_1000359611 | 186 |
| 254 | 3300013102 | Ga0157371_10003601 | Ga0157371_1000360111 | 186 |
| 255 | 3300013102 | Ga0157371_10010108 | Ga0157371_100101082 | 186 |
| 256 | 3300013104 | Ga0157370_10000084 | Ga0157370_1000008423 | 186 |
| 257 | 3300013104 | Ga0157370_10002073 | Ga0157370_1000207314 | 186 |
| 258 | 3300013104 | Ga0157370_10005660 | Ga0157370_1000566011 | 186 |
| 259 | 3300013104 | Ga0157370_10007536 | Ga0157370_100075362 | 186 |
| 260 | 3300013104 | Ga0157370_10188858 | Ga0157370_101888582 | 186 |
| 261 | 3300013104 | Ga0157370_10327999 | Ga0157370_103279992 | 186 |
| 262 | 3300013104 | Ga0157370_10334375 | Ga0157370_103343752 | 186 |
| 263 | 3300013104 | Ga0157370_10702972 | Ga0157370_107029722 | 186 |
| 264 | 3300013105 | Ga0157369_10000169 | Ga0157369_100001691 | 186 |
| 265 | 3300013105 | Ga0157369_10068203 | Ga0157369_100682033 | 186 |
| 266 | 3300013105 | Ga0157369_10905271 | Ga0157369_109052712 | 186 |
| 267 | 3300013296 | Ga0157374_10105846 | Ga0157374_101058463 | 186 |
| 268 | 3300013296 | Ga0157374_10636500 | Ga0157374_106365002 | 186 |
| 269 | 3300013297 | Ga0157378_10099893 | Ga0157378_100998932 | 186 |
| 270 | 3300013306 | Ga0163162_10000349 | Ga0163162_1000034922 | 186 |
| 271 | 3300013306 | Ga0163162_10000814 | Ga0163162_1000081420 | 186 |
| 272 | 3300013306 | Ga0163162_10005561 | Ga0163162_100055613 | 186 |
| 273 | 3300013306 | Ga0163162_10293792 | Ga0163162_102937922 | 186 |
| 274 | 3300013307 | Ga0157372_10006107 | Ga0157372_100061073 | 186 |
| 275 | 3300013307 | Ga0157372_10904358 | Ga0157372_109043581 | 186 |
| 276 | 3300013308 | Ga0157375_10083834 | Ga0157375_100838342 | 186 |
| 277 | 3300014325 | Ga0163163_10329292 | Ga0163163_103292922 | 186 |
| 278 | 3300014497 | Ga0182008_10000002 | Ga0182008_10000002406 | 186 |
| 279 | 3300014497 | Ga0182008_10000631 | Ga0182008_1000063113 | 186 |
| 280 | 3300014497 | Ga0182008_10000693 | Ga0182008_100006937 | 186 |
| 281 | 3300014968 | Ga0157379_10001247 | Ga0157379_100012473 | 186 |
| 282 | 3300014969 | Ga0157376_10004019 | Ga0157376_100040192 | 186 |
| 283 | 3300015261 | Ga0182006_1000806 | Ga0182006_100080625 | 186 |
| 284 | 3300015261 | Ga0182006_1008166 | Ga0182006_10081664 | 186 |
| 285 | 3300015261 | Ga0182006_1009814 | Ga0182006_10098142 | 186 |
| 286 | 3300015261 | Ga0182006_1016044 | Ga0182006_10160442 | 186 |
| 287 | 3300015261 | Ga0182006_1020991 | Ga0182006_10209912 | 186 |
| 288 | 3300015262 | Ga0182007_10000016 | Ga0182007_1000001631 | 186 |
| 289 | 3300015682 | Ga0183373_1012 | Ga0183373_10121 | 186 |
| 290 | 3300017792 | Ga0163161_10001031 | Ga0163161_100010312 | 186 |
| 291 | 3300017792 | Ga0163161_10001633 | Ga0163161_100016332 | 186 |
| 292 | 3300017792 | Ga0163161_10003521 | Ga0163161_1000352114 | 186 |
| 293 | 3300017792 | Ga0163161_10006424 | Ga0163161_100064244 | 186 |
| 294 | 3300017792 | Ga0163161_10129316 | Ga0163161_101293163 | 186 |
| 295 | 3300017792 | Ga0163161_10260023 | Ga0163161_102600232 | 186 |
| 296 | 3300017792 | Ga0163161_10458063 | Ga0163161_104580631 | 186 |
| 297 | 3300017792 | Ga0163161_10912923 | Ga0163161_109129231 | 186 |
| 298 | 3300017792 | Ga0163161_10914303 | Ga0163161_109143031 | 186 |
| 299 | 3300025245 | Ga0207425_1000008 | Ga0207425_1000008138 | 186 |
| 300 | 3300025246 | Ga0209646_1002266 | Ga0209646_10022664 | 186 |
| 301 | 3300025258 | Ga0209129_1000040 | Ga0209129_1000040127 | 186 |
| 302 | 3300025292 | Ga0209676_1000106 | Ga0209676_1000106152 | 186 |
| 303 | 3300025294 | Ga0209025_1000020 | Ga0209025_1000020138 | 186 |
| 304 | 3300025297 | Ga0209758_1000022 | Ga0209758_1000022138 | 186 |
| 305 | 3300025298 | Ga0209050_1000174 | Ga0209050_10001745 | 186 |
| 306 | 3300025303 | Ga0209051_1060899 | Ga0209051_10608991 | 186 |
| 307 | 3300025321 | Ga0207656_10001476 | Ga0207656_100014764 | 186 |
| 308 | 3300025728 | Ga0207655_1012720 | Ga0207655_10127205 | 186 |
| 309 | 3300025903 | Ga0207680_10003588 | Ga0207680_100035885 | 186 |
| 310 | 3300025903 | Ga0207680_10238812 | Ga0207680_102388122 | 186 |
| 311 | 3300025904 | Ga0207647_10094913 | Ga0207647_100949132 | 186 |
| 312 | 3300025907 | Ga0207645_10012445 | Ga0207645_100124453 | 186 |
| 313 | 3300025909 | Ga0207705_10021772 | Ga0207705_100217724 | 186 |
| 314 | 3300025911 | Ga0207654_10022283 | Ga0207654_100222833 | 186 |
| 315 | 3300025911 | Ga0207654_10030836 | Ga0207654_100308362 | 186 |
| 316 | 3300025913 | Ga0207695_10005162 | Ga0207695_100051628 | 186 |
| 317 | 3300025913 | Ga0207695_10096879 | Ga0207695_100968792 | 186 |
| 318 | 3300025913 | Ga0207695_10302064 | Ga0207695_103020642 | 186 |
| 319 | 3300025913 | Ga0207695_10848581 | Ga0207695_108485811 | 186 |
| 320 | 3300025914 | Ga0207671_10000110 | Ga0207671_1000011089 | 186 |
| 321 | 3300025914 | Ga0207671_10002077 | Ga0207671_100020774 | 186 |
| 322 | 3300025914 | Ga0207671_10017404 | Ga0207671_100174044 | 186 |
| 323 | 3300025914 | Ga0207671_10027188 | Ga0207671_100271883 | 186 |
| 324 | 3300025922 | Ga0207646_10250248 | Ga0207646_102502482 | 186 |
| 325 | 3300025924 | Ga0207694_10051909 | Ga0207694_100519093 | 186 |
| 326 | 3300025924 | Ga0207694_10221459 | Ga0207694_102214592 | 186 |
| 327 | 3300025924 | Ga0207694_10270575 | Ga0207694_102705751 | 186 |
| 328 | 3300025934 | Ga0207686_10086341 | Ga0207686_100863413 | 186 |
| 329 | 3300025940 | Ga0207691_10000060 | Ga0207691_1000006042 | 186 |
| 330 | 3300025945 | Ga0207679_11090386 | Ga0207679_110903861 | 186 |
| 331 | 3300025949 | Ga0207667_10000221 | Ga0207667_1000022114 | 186 |
| 332 | 3300025949 | Ga0207667_10074678 | Ga0207667_100746784 | 186 |
| 333 | 3300025961 | Ga0207712_10087033 | Ga0207712_100870332 | 186 |
| 334 | 3300025972 | Ga0207668_10000268 | Ga0207668_1000026828 | 186 |
| 335 | 3300025986 | Ga0207658_10237142 | Ga0207658_102371422 | 186 |
| 336 | 3300026023 | Ga0207677_10005966 | Ga0207677_100059664 | 186 |
| 337 | 3300026023 | Ga0207677_10046446 | Ga0207677_100464463 | 186 |
| 338 | 3300026035 | Ga0207703_10008010 | Ga0207703_100080105 | 186 |
| 339 | 3300026041 | Ga0207639_10114366 | Ga0207639_101143662 | 186 |
| 340 | 3300026078 | Ga0207702_10305937 | Ga0207702_103059372 | 186 |
| 341 | 3300026078 | Ga0207702_10326091 | Ga0207702_103260911 | 186 |
| 342 | 3300026088 | Ga0207641_10005697 | Ga0207641_100056976 | 186 |
| 343 | 3300026089 | Ga0207648_10002360 | Ga0207648_1000236010 | 186 |
| 344 | 3300026095 | Ga0207676_10002113 | Ga0207676_100021137 | 186 |
| 345 | 3300026095 | Ga0207676_10078653 | Ga0207676_100786533 | 186 |
| 346 | 3300026116 | Ga0207674_10003801 | Ga0207674_100038013 | 186 |
| 347 | 3300026118 | Ga0207675_100070907 | Ga0207675_1000709074 | 186 |
| 348 | 3300026142 | Ga0207698_10007888 | Ga0207698_100078885 | 186 |
| 349 | 3300026142 | Ga0207698_10418885 | Ga0207698_104188852 | 186 |
| 350 | 3300026142 | Ga0207698_10637904 | Ga0207698_106379042 | 186 |
| 351 | 3300028379 | Ga0268266_10000024 | Ga0268266_1000002458 | 186 |
| 352 | 3300028380 | Ga0268265_10259604 | Ga0268265_102596042 | 186 |
| 353 | 3300028381 | Ga0268264_10000243 | Ga0268264_1000024384 | 186 |
| 354 | 3300028381 | Ga0268264_10004484 | Ga0268264_100044848 | 186 |
| 355 | 3300028381 | Ga0268264_10048348 | Ga0268264_100483481 | 186 |
| 356 | 3300028794 | Ga0307515_10013124 | Ga0307515_100131246 | 186 |
| 357 | 3300028794 | Ga0307515_10512043 | Ga0307515_105120431 | 186 |
| 358 | 3300030731 | Ga0316177_1173064 | Ga0316177_11730643 | 186 |
| 359 | 3300030732 | Ga0316176_1113607 | Ga0316176_11136075 | 186 |
| 360 | 3300030742 | Ga0316183_1107442 | Ga0316183_110744220 | 186 |
| 361 | 3300030744 | Ga0316181_1199804 | Ga0316181_11998041 | 186 |
| 362 | 3300030744 | Ga0316181_1214383 | Ga0316181_12143833 | 186 |
| 363 | 3300031090 | Ga0265760_10023573 | Ga0265760_100235732 | 186 |
| 364 | 3300031456 | Ga0307513_10151654 | Ga0307513_101516542 | 186 |
| 365 | 3300031456 | Ga0307513_10238229 | Ga0307513_102382292 | 186 |
| 366 | 3300031507 | Ga0307509_10218654 | Ga0307509_102186541 | 186 |
| 367 | 3300031731 | Ga0307405_10000025 | Ga0307405_1000002585 | 186 |
| 368 | 3300031731 | Ga0307405_10053513 | Ga0307405_100535132 | 186 |
| 369 | 3300031903 | Ga0307407_10000016 | Ga0307407_1000001658 | 186 |
| 370 | 3300031911 | Ga0307412_10000085 | Ga0307412_1000008523 | 186 |
| 371 | 3300031911 | Ga0307412_10129438 | Ga0307412_101294383 | 186 |
| 372 | 3300031911 | Ga0307412_10168726 | Ga0307412_101687262 | 186 |
| 373 | 3300031911 | Ga0307412_10221691 | Ga0307412_102216911 | 186 |
| 374 | 3300031995 | Ga0307409_100109761 | Ga0307409_1001097613 | 186 |
| 375 | 3300032002 | Ga0307416_100000036 | Ga0307416_10000003658 | 186 |
| 376 | 3300032004 | Ga0307414_10000548 | Ga0307414_100005483 | 186 |
| 377 | 3300032004 | Ga0307414_10011329 | Ga0307414_100113294 | 186 |
| 378 | 3300032004 | Ga0307414_10016294 | Ga0307414_100162942 | 186 |
| 379 | 3300032004 | Ga0307414_10051691 | Ga0307414_100516912 | 186 |
| 380 | 3300032004 | Ga0307414_10141993 | Ga0307414_101419932 | 186 |
| 381 | 3300032004 | Ga0307414_10144247 | Ga0307414_101442473 | 186 |
| 382 | 3300032004 | Ga0307414_10504695 | Ga0307414_105046952 | 186 |
| 383 | 3300032004 | Ga0307414_10712871 | Ga0307414_107128711 | 186 |
| 384 | 3300032005 | Ga0307411_10432161 | Ga0307411_104321611 | 186 |
| 385 | 3300033179 | Ga0307507_10305558 | Ga0307507_103055582 | 186 |
| 386 | 3300041406 | Ga0439439_0007206 | Ga0439439_0007206_1402_1977 | 186 |
| 387 | 3300041451 | Ga0451791_0203047 | Ga0451791_0203047_683_1258 | 186 |
| 388 | 3300041452 | Ga0451793_0529887 | Ga0451793_0529887_696_1271 | 186 |
| 389 | 3300041459 | Ga0451800_0828905 | Ga0451800_0828905_167_805 | 186 |
| 390 | 3300041460 | Ga0451802_0121489 | Ga0451802_0121489_541_1116 | 186 |
| 391 | 3300041505 | Ga0451849_1190738 | Ga0451849_1190738_38_613 | 186 |
| 392 | 3300042007 | Ga0439449_0008287 | Ga0439449_0008287_3066_3641 | 186 |
| 393 | 3300042014 | Ga0439457_000008 | Ga0439457_000008_32721_33296 | 186 |
| 394 | 3300042015 | Ga0439462_0000815 | Ga0439462_0000815_4491_5066 | 186 |
| 395 | 3300042131 | Ga0450894_015412 | Ga0450894_015412_222_797 | 186 |
| 396 | 3300042532 | Ga0450893_0045960 | Ga0450893_0045960_203_778 | 186 |
| 397 | 3300042876 | Ga0451577_0001955 | Ga0451577_0001955_23403_23981 | 186 |
| 398 | 3300044658 | Ga0466972_0027294 | Ga0466972_0027294_1141_1719 | 186 |
| 399 | 3300044658 | Ga0466972_0071677 | Ga0466972_0071677_903_1478 | 186 |
| 400 | 3300044658 | Ga0466972_0172645 | Ga0466972_0172645_229_804 | 186 |
| 401 | 3300044735 | Ga0466968_0047844 | Ga0466968_0047844_717_1295 | 186 |
| 402 | 3300044842 | Ga0466957_0001154 | Ga0466957_0001154_2336_2986 | 186 |
| 403 | 3300044901 | Ga0466960_0174253 | Ga0466960_0174253_139_714 | 186 |
| 404 | 3300046501 | Ga0495607_0188231 | Ga0495607_0188231_174_734 | 186 |
| 405 | 3300046507 | Ga0495606_0015427 | Ga0495606_0015427_3586_4146 | 186 |
| 406 | 3300046512 | Ga0495610_0000119 | Ga0495610_0000119_88420_88980 | 186 |
| 407 | 3300046512 | Ga0495610_0010840 | Ga0495610_0010840_635_1195 | 186 |
| 408 | 3300046520 | Ga0495637_0034550 | Ga0495637_0034550_1149_1709 | 186 |
| 409 | 3300046524 | Ga0495648_0003776 | Ga0495648_0003776_8114_8692 | 186 |
| 410 | 3300046538 | Ga0495609_0014814 | Ga0495609_0014814_1954_2514 | 186 |
| 411 | 3300047443 | Ga0495687_000014 | Ga0495687_000014_305883_306461 | 186 |
| 412 | 3300047470 | Ga0495681_0177336 | Ga0495681_0177336_59_619 | 186 |
| 413 | 3300047472 | Ga0495686_0286582 | Ga0495686_0286582_33_608 | 186 |
| 414 | 3300048912 | Ga0496109_0428873 | Ga0496109_0428873_420_998 | 186 |
| 415 | 3300048918 | Ga0496115_0318542 | Ga0496115_0318542_597_1157 | 186 |
| 416 | 3300048925 | Ga0496122_0000862 | Ga0496122_0000862_56224_56784 | 186 |
| 417 | 3300048926 | Ga0496123_0003821 | Ga0496123_0003821_15610_16170 | 186 |
| 418 | 3300048928 | Ga0496125_0073301 | Ga0496125_0073301_311_871 | 186 |
| 419 | 3300049580 | Ga0501046_0297626 | Ga0501046_0297626_584_1159 | 186 |
| 420 | 3300049581 | Ga0501047_0018627 | Ga0501047_0018627_926_1501 | 186 |
| 421 | 3300049581 | Ga0501047_0246863 | Ga0501047_0246863_950_1525 | 186 |
| 422 | 3300049663 | Ga0501223_008818 | Ga0501223_008818_492_1055 | 186 |
| 423 | 3300049705 | Ga0501225_0001777 | Ga0501225_0001777_4819_5394 | 186 |
| 424 | 3300049758 | Ga0501241_003707 | Ga0501241_003707_481_1041 | 186 |
| 425 | 3300049758 | Ga0501241_004719 | Ga0501241_004719_957_1517 | 186 |
| 426 | 3300049823 | Ga0501044_0021886 | Ga0501044_0021886_699_1274 | 186 |
| 427 | 3300053086 | Ga0500578_0000119 | Ga0500578_0000119_16149_16724 | 186 |
| 428 | 3300053086 | Ga0500578_0159206 | Ga0500578_0159206_503_1177 | 186 |
| 429 | 3300053090 | Ga0500646_0105733 | Ga0500646_0105733_113_691 | 186 |
| 430 | 3300053092 | Ga0500583_0000014 | Ga0500583_0000014_53730_54305 | 186 |
| 431 | 3300053092 | Ga0500583_0000841 | Ga0500583_0000841_1703_2281 | 186 |
| 432 | 3300053092 | Ga0500583_0012959 | Ga0500583_0012959_2515_3090 | 186 |
| 433 | 3300053093 | Ga0500651_0000078 | Ga0500651_0000078_47233_47793 | 186 |
| 434 | 3300053093 | Ga0500651_0533902 | Ga0500651_0533902_24_599 | 186 |
| 435 | 3300053111 | Ga0500572_029879 | Ga0500572_029879_469_1044 | 186 |
| 436 | 3300053130 | Ga0500642_0032710 | Ga0500642_0032710_1170_1748 | 186 |
| 437 | 3300053131 | Ga0500652_092996 | Ga0500652_092996_219_794 | 186 |
| 438 | 3300053134 | Ga0500658_0155856 | Ga0500658_0155856_202_777 | 186 |
| 439 | 3300053146 | Ga0500588_0057966 | Ga0500588_0057966_412_987 | 186 |
| 440 | 3300053150 | Ga0500603_113269 | Ga0500603_113269_131_772 | 186 |
| 441 | 3300053151 | Ga0500604_0110087 | Ga0500604_0110087_86_661 | 186 |
| 442 | 3300053153 | Ga0500616_0053524 | Ga0500616_0053524_486_1061 | 186 |
| 443 | 3300053156 | Ga0500622_0002764 | Ga0500622_0002764_2134_2712 | 186 |
| 444 | 3300053156 | Ga0500622_0035190 | Ga0500622_0035190_21_596 | 186 |
| 445 | 3300053160 | Ga0500633_0140207 | Ga0500633_0140207_25_699 | 186 |
| 446 | 3300053163 | Ga0500639_164083 | Ga0500639_164083_216_857 | 186 |
| 447 | 3300053727 | Ga0500611_013713 | Ga0500611_013713_431_1069 | 186 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ryb-assembly1.cif.gz_A | crystal structure of the chloroplast group ii intron splicing factor crs2 | 0.9609 | 2 | 176 |
| 3p2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution | 0.9553 | 2 | 186 |
| 2z2j-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.9533 | 2 | 176 |
| 7wt6-assembly1.cif.gz_A | crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis | 0.953 | 1 | 185 |
| 4yly-assembly1.cif.gz_A | crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution | 0.9508 | 3 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54V95_265_452_3.40.50.1470 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9552 | 60 | 186 | 3.40.50.1470 |
| 4ylyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9508 | 3 | 186 | 3.40.50.1470 |
| 4q55B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9495 | 1 | 186 | 3.40.50.1470 |
| 4q55B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9446 | 1 | 186 | 3.40.50.1470 |
| 5ektA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase | 0.9413 | 3 | 185 | 3.40.50.1470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3RK09-F1-model_v4 | peptidyl-tRNA hydrolase (EC 3.1.1.29) | 0.994 | 1 | 130 |
GO:0004045
|
| AF-C3J8L0-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9889 | 2 | 186 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A2P7TW18-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9887 | 1 | 185 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A2E8SK81-F1-model_v4 | Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) | 0.9872 | 2 | 185 |
GO:0004045
GO:0005737 GO:0006412 |
| AF-A0A1Z8QKR5-F1-model_v4 | deleted | 0.9869 | 1 | 186 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar