F446063

General Info

Members Datasets Scaffolds Average Seq Length
447 362 298 204

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2965062239|2965066461
Length 232
Sequence IAKPAPRMRKEPRQARSVATVEAIIEAGARVLSEIGWAGFSTNKVAETAGVSIGSLYQYFPDKLALVDAIRRRHFDHVLSVIRDAAAEEKPLRQFARELVRGMIAAHSIHPTLHQVLLDETPVDRGSRAAHASFQARYLEHYAAAVAQYRRRLKNTETVARVLSSAVEGVIHNAARRNMLDAPELQKQLGELICAYLSGQRPPLKALRVSGARRSTMSLPRRPTKAAGSRAP

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
5 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
6 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
7 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
8 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
9 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
10 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
11 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
12 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
13 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
14 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
15 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
16 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
17 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
18 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
19 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
20 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
21 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
22 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
23 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
24 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
25 2841760612 Bosea sp. Tri-49 Isolate Nodule
26 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
27 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
28 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
29 2844104063 Bosea sp. Tri-39 Isolate Nodule
30 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
31 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
32 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
33 2851182111 Bosea sp. Tri-44 Isolate Nodule
34 2851246043 Bosea sp. Tri-54 Isolate Nodule
35 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
36 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
37 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
38 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
39 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
40 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
41 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
42 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
43 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
44 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
45 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
46 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
47 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
48 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
49 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
50 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
51 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
52 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
53 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
54 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
55 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
56 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
57 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
58 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
59 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
60 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
61 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
62 2884411467 Dyella sp. AD56 Isolate Rhizosphere
63 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
64 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
65 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
66 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
67 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
68 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
69 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
70 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
71 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
72 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
73 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
74 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
75 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
76 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
77 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
78 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
79 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
80 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
81 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
82 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
83 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
84 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
85 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
86 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
87 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
88 2928163908 Burkholderia sp. 567 Isolate Unclassified
89 2933599457 Rhizobium phaseoli M3 Isolate Nodule
90 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
91 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
92 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
93 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
94 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
95 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
96 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
97 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
98 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
99 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
100 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
101 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
102 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
103 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
104 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
105 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
106 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
107 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
108 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
109 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
110 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
111 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
112 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
113 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
114 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
115 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
116 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
117 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
118 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
119 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
120 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
121 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
122 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
123 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
124 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
125 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
126 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
127 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
128 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
129 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
130 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
131 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
132 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
133 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
134 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
135 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
136 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
137 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
138 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
139 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
140 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
141 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
142 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
143 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
144 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
145 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
146 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
147 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
148 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
149 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
150 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
151 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
152 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
153 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
154 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
155 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
156 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
157 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
158 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
159 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
160 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
161 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
162 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
163 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
164 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
165 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
166 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
167 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
168 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
169 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
170 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
171 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
172 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
173 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
174 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
175 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
176 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
177 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
178 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
179 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
180 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
181 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
182 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
183 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
184 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
185 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
186 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
187 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
188 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
189 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
190 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
191 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
194 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
195 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
197 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
198 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
223 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
246 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
259 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
275 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
320 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
327 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
330 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
331 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
332 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
335 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
336 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
337 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
338 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
339 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
340 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
341 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
342 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
343 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
344 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
345 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
346 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
351 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
352 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
353 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
354 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
355 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
356 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
357 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
358 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
359 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
360 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
361 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
362 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.67
Metatranscriptomes 0
Isolates 33.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 17.9
Nodule 25.06
Rhizoplane 2.01
Rhizosphere 44.07
Stem 0
Stem Tuber 0
Unclassified 10.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10009111 3300001989 Bacteria 3702
2 JGI25162J39368_1002828 3300002737 Bacteria 6062
3 JGI25157J39369_1000624 3300002741 Bacteria 19993
4 JGI25159J45721_1002735 3300002987 Bacteria 6539
5 JGI25165J46597_1000028 3300003214 Bacteria 325146
6 JGI25165J46597_1000448 3300003214 Bacteria 41488
7 JGI25165J46597_1007146 3300003214 Bacteria 1888
8 JGI25153J46596_10000123 3300003215 Bacteria 86708
9 rootH2_10004296 3300003320 Bacteria 5955
10 rootH2_10067805 3300003320 Bacteria 2385
11 rootL2_10012764 3300003322 Bacteria 7656
12 Ga0055531_10013761 3300003794 Bacteria 3706
13 Ga0058692_1019072 3300003856 Bacteria 1470
14 Ga0065165_1000141 3300005262 Bacteria 125536
15 Ga0065165_1000807 3300005262 Bacteria 41747
16 Ga0070676_10089297 3300005328 Bacteria 1885
17 Ga0070670_100000183 3300005331 Bacteria 57446
18 Ga0070682_100000323 3300005337 Bacteria 32774
19 Ga0070669_100232366 3300005353 Bacteria 1462
20 Ga0070662_100057388 3300005457 Bacteria 2829
21 Ga0068867_100041822 3300005459 Bacteria 3350
22 Ga0070706_100001419 3300005467 Bacteria 25378
23 Ga0070707_100142018 3300005468 Bacteria 2337
24 Ga0070665_100176588 3300005548 Bacteria 2137
25 Ga0070665_100228728 3300005548 Bacteria 1860
26 Ga0070665_100729934 3300005548 Bacteria 1004
27 Ga0068855_100208888 3300005563 Bacteria 2195
28 Ga0068855_100234608 3300005563 Bacteria 2052
29 Ga0068857_100080799 3300005577 Bacteria 2903
30 Ga0068854_100010157 3300005578 Bacteria 6099
31 Ga0068852_100054124 3300005616 Bacteria 3458
32 Ga0068862_100111538 3300005844 Bacteria 2401
33 Ga0070717_10181016 3300006028 Bacteria 1837
34 Ga0075365_10012485 3300006038 Bacteria 5048
35 Ga0075368_10032553 3300006042 Bacteria 2026
36 Ga0075364_10448179 3300006051 Bacteria 882
37 Ga0075362_10008807 3300006177 Bacteria 3877
38 Ga0075362_10015986 3300006177 Bacteria 3064
39 Ga0075367_10003028 3300006178 Bacteria 7870
40 Ga0075367_10093173 3300006178 Bacteria 1835
41 Ga0075369_10018674 3300006186 Bacteria 2825
42 Ga0075369_10022970 3300006186 Bacteria 2575
43 Ga0075366_10027975 3300006195 Bacteria 3308
44 Ga0075370_10013062 3300006353 Bacteria 4406
45 Ga0105240_10000005 3300009093 Bacteria 702630
46 Ga0105240_10343476 3300009093 Bacteria 1695
47 Ga0105240_10916285 3300009093 Bacteria 942
48 Ga0105245_10601577 3300009098 Bacteria 1126
49 Ga0105243_10095295 3300009148 Bacteria 2459
50 Ga0105243_10265064 3300009148 Bacteria 1540
51 Ga0105248_10337546 3300009177 Bacteria 1697
52 Ga0105237_10001070 3300009545 Bacteria 36790
53 Ga0105237_10011875 3300009545 Bacteria 9209
54 Ga0105238_10000866 3300009551 Bacteria 31246
55 Ga0105239_10008784 3300010375 Bacteria 11435
56 Ga0105239_10025695 3300010375 Bacteria 6485
57 Ga0105239_10144967 3300010375 Bacteria 2648
58 Ga0105239_10216462 3300010375 Bacteria 2148
59 Ga0105246_10166829 3300011119 Bacteria 1682
60 Ga0157370_10001758 3300013104 Bacteria 26714
61 Ga0157369_10224058 3300013105 Bacteria 1967
62 Ga0157369_10436284 3300013105 Bacteria 1357
63 Ga0171462_1028 3300013250 Bacteria 110760
64 Ga0163162_10176746 3300013306 Bacteria 2260
65 Ga0182008_10008919 3300014497 Bacteria 5439
66 Ga0182006_1017373 3300015261 Bacteria 3057
67 Ga0182007_10009044 3300015262 Bacteria 4051
68 Ga0182005_1004056 3300015265 Bacteria 4805
69 Ga0182005_1015942 3300015265 Bacteria 2092
70 Ga0209760_105327 3300025207 Bacteria 1065
71 Ga0209672_106762 3300025228 Bacteria 1831
72 Ga0209437_100153 3300025233 Bacteria 154068
73 Ga0209026_1000120 3300025250 Bacteria 130091
74 Ga0209677_101628 3300025253 Bacteria 9463
75 Ga0209759_1000288 3300025256 Bacteria 69733
76 Ga0209233_1000087 3300025261 Bacteria 325225
77 Ga0209233_1000175 3300025261 Bacteria 144221
78 Ga0209233_1000338 3300025261 Bacteria 46030
79 Ga0209130_1000178 3300025284 Bacteria 90293
80 Ga0209025_1003835 3300025294 Bacteria 13686
81 Ga0209758_1000471 3300025297 Bacteria 66374
82 Ga0209050_1019661 3300025298 Bacteria 2552
83 Ga0209257_1000114 3300025304 Bacteria 233013
84 Ga0207647_10002023 3300025904 Bacteria 15494
85 Ga0207647_10020202 3300025904 Bacteria 4469
86 Ga0207647_10147046 3300025904 Bacteria 1378
87 Ga0207684_10051987 3300025910 Bacteria 3476
88 Ga0207695_10000011 3300025913 Bacteria 910221
89 Ga0207695_10579938 3300025913 Bacteria 1003
90 Ga0207671_10001852 3300025914 Bacteria 23614
91 Ga0207694_10313535 3300025924 Bacteria 1293
92 Ga0207650_10000151 3300025925 Bacteria 83229
93 Ga0207709_10049448 3300025935 Bacteria 2566
94 Ga0207669_10084257 3300025937 Bacteria 2048
95 Ga0207667_10335716 3300025949 Bacteria 1543
96 Ga0207667_10917157 3300025949 Bacteria 867
97 Ga0207668_10328991 3300025972 Bacteria 1271
98 Ga0207640_10007184 3300025981 Bacteria 6137
99 Ga0207658_10390741 3300025986 Bacteria 1221
100 Ga0207639_10003205 3300026041 Bacteria 10996
101 Ga0207678_10034482 3300026067 Bacteria 4408
102 Ga0207678_10145408 3300026067 Bacteria 2024
103 Ga0207648_10096896 3300026089 Bacteria 2581
104 Ga0207683_10130909 3300026121 Bacteria 2257
105 Ga0209371_1003233 3300027312 Bacteria 8134
106 Ga0209371_1055605 3300027312 Bacteria 744
107 Ga0268266_10516989 3300028379 Bacteria 1141
108 Ga0268266_11253757 3300028379 Bacteria 717
109 Ga0268265_10003345 3300028380 Bacteria 11598
110 Ga0307517_10242433 3300028786 Bacteria 1068
111 Ga0268256_1002934 3300030500 Bacteria 8134
112 Ga0268256_1062353 3300030500 Bacteria 744
113 Ga0307408_100068473 3300031548 Bacteria 2614
114 Ga0373941_0148825 3300035115 Bacteria 857
115 Ga0395900_0028692 3300037418 Bacteria 5704
116 Ga0395900_0086174 3300037418 Bacteria 3228
117 Ga0395900_0290671 3300037418 Bacteria 1623
118 Ga0395898_0090252 3300037466 Bacteria 2949
119 Ga0395898_0213730 3300037466 Bacteria 1840
120 Ga0395905_0007924 3300037471 Bacteria 10508
121 Ga0395905_0345472 3300037471 Bacteria 1379
122 Ga0395905_0426033 3300037471 Bacteria 1223
123 Ga0395901_0033423 3300038443 Bacteria 5310
124 Ga0395901_0037446 3300038443 Bacteria 5017
125 Ga0395901_0077917 3300038443 Bacteria 3460
126 Ga0439465_0013340 3300041413 Bacteria 2564
127 Ga0451807_1101745 3300041486 Bacteria 960
128 Ga0439431_0132784 3300041997 Bacteria 700
129 Ga0466966_0069981 3300044684 Bacteria 2200
130 Ga0466961_0064611 3300044693 Bacteria 2325
131 Ga0466960_0079072 3300044901 Bacteria 1653
132 Ga0466967_0129115 3300045976 Bacteria 2344
133 Ga0495603_0352139 3300046455 Bacteria 845
134 Ga0495590_0041977 3300046457 Bacteria 1594
135 Ga0495590_0128983 3300046457 Bacteria 909
136 Ga0495629_0000052 3300046459 Bacteria 106578
137 Ga0495638_0084534 3300046460 Bacteria 1920
138 Ga0495653_0001943 3300046463 Bacteria 16253
139 Ga0495650_0013435 3300046471 Bacteria 4327
140 Ga0495650_0042202 3300046471 Bacteria 1944
141 Ga0495580_0004723 3300046472 Bacteria 11417
142 Ga0495580_0011040 3300046472 Bacteria 7001
143 Ga0495662_0007485 3300046476 Bacteria 5397
144 Ga0495662_0066222 3300046476 Bacteria 1747
145 Ga0495607_0086371 3300046501 Bacteria 1710
146 Ga0495583_0059248 3300046506 Bacteria 1716
147 Ga0495610_0002933 3300046512 Bacteria 13793
148 Ga0495610_0102102 3300046512 Bacteria 1283
149 Ga0495610_0183305 3300046512 Bacteria 869
150 Ga0495616_0124652 3300046513 Bacteria 1186
151 Ga0495620_0021717 3300046515 Bacteria 3110
152 Ga0495620_0068057 3300046515 Bacteria 1463
153 Ga0495620_0131672 3300046515 Bacteria 981
154 Ga0495628_0038131 3300046516 Bacteria 3848
155 Ga0495630_0008386 3300046517 Bacteria 7412
156 Ga0495631_0168123 3300046518 Bacteria 941
157 Ga0495637_0018553 3300046520 Bacteria 3225
158 Ga0495637_0061508 3300046520 Bacteria 1539
159 Ga0495637_0076262 3300046520 Bacteria 1344
160 Ga0495643_0010872 3300046522 Bacteria 5576
161 Ga0495643_0067082 3300046522 Bacteria 1891
162 Ga0495666_0061455 3300046526 Bacteria 1795
163 Ga0495665_0017397 3300046531 Bacteria 3866
164 Ga0495597_0058251 3300046542 Bacteria 1689
165 Ga0495622_0046582 3300046557 Bacteria 2015
166 Ga0495633_0072319 3300046558 Bacteria 1608
167 Ga0495668_0023339 3300046616 Bacteria 3530
168 Ga0495611_0032014 3300046648 Bacteria 2317
169 Ga0495635_0100316 3300046663 Bacteria 1979
170 Ga0495661_0070740 3300046665 Bacteria 2041
171 Ga0495588_0056901 3300046674 Bacteria 2019
172 Ga0495588_0057911 3300046674 Bacteria 2002
173 Ga0495646_0040205 3300046680 Bacteria 2881
174 Ga0495669_0035420 3300046684 Bacteria 2204
175 Ga0495624_0008497 3300046690 Bacteria 7152
176 Ga0495624_0110496 3300046690 Bacteria 1690
177 Ga0495624_0251915 3300046690 Bacteria 1068
178 Ga0495670_0256658 3300046691 Bacteria 932
179 Ga0495671_0002512 3300046692 Bacteria 11541
180 Ga0495671_0127410 3300046692 Bacteria 1241
181 Ga0495600_0133438 3300046809 Bacteria 1613
182 Ga0495604_0023069 3300047317 Bacteria 4966
183 Ga0495674_0006941 3300047319 Bacteria 10832
184 Ga0495674_0072914 3300047319 Bacteria 2960
185 Ga0495676_0208297 3300047321 Bacteria 1354
186 Ga0495687_021116 3300047443 Bacteria 3159
187 Ga0495687_035507 3300047443 Bacteria 2241
188 Ga0495687_065219 3300047443 Bacteria 1483
189 Ga0495679_000023 3300047446 Bacteria 209366
190 Ga0495673_0012722 3300047469 Bacteria 4445
191 Ga0495681_0029758 3300047470 Bacteria 2790
192 Ga0495686_0009855 3300047472 Bacteria 6848
193 Ga0495686_0029484 3300047472 Bacteria 3569
194 Ga0495593_0160846 3300047673 Bacteria 1133
195 Ga0495614_0095895 3300048089 Bacteria 1293
196 Ga0495626_0024478 3300048091 Bacteria 2960
197 Ga0496100_0087129 3300048903 Bacteria 2122
198 Ga0496101_0482524 3300048904 Bacteria 979
199 Ga0496103_0021908 3300048906 Bacteria 3845
200 Ga0496104_0233231 3300048907 Bacteria 1752
201 Ga0496112_0174840 3300048915 Bacteria 2112
202 Ga0496112_0269819 3300048915 Bacteria 1650
203 Ga0496113_0061413 3300048916 Bacteria 2836
204 Ga0496116_0023405 3300048919 Bacteria 4600
205 Ga0496116_0101763 3300048919 Bacteria 1714
206 Ga0496117_0009500 3300048920 Bacteria 9037
207 Ga0496117_0066028 3300048920 Bacteria 2456
208 Ga0496118_0001382 3300048921 Bacteria 36581
209 Ga0496118_0080058 3300048921 Bacteria 2301
210 Ga0496119_0030846 3300048922 Bacteria 3605
211 Ga0496119_0069725 3300048922 Bacteria 2065
212 Ga0496120_0001733 3300048923 Bacteria 24824
213 Ga0496120_0017721 3300048923 Bacteria 4605
214 Ga0496121_0014149 3300048924 Bacteria 8498
215 Ga0496121_0028418 3300048924 Bacteria 5205
216 Ga0496121_0208561 3300048924 Bacteria 1386
217 Ga0496122_0065353 3300048925 Bacteria 2638
218 Ga0496122_0068411 3300048925 Bacteria 2549
219 Ga0496122_0139768 3300048925 Bacteria 1517
220 Ga0496123_0025840 3300048926 Bacteria 4414
221 Ga0496123_0119793 3300048926 Bacteria 1483
222 Ga0496124_0177927 3300048927 Bacteria 1640
223 Ga0496124_0275858 3300048927 Bacteria 1228
224 Ga0496125_0025521 3300048928 Bacteria 5409
225 Ga0496126_0000522 3300048929 Bacteria 74922
226 Ga0496126_0723824 3300048929 Bacteria 771
227 Ga0495678_025962 3300049459 Bacteria 2508
228 Ga0495678_036769 3300049459 Bacteria 1995
229 Ga0501032_0036879 3300049569 Bacteria 3335
230 Ga0501033_0086198 3300049570 Bacteria 2299
231 Ga0501034_0356441 3300049571 Bacteria 1390
232 Ga0501037_0076457 3300049573 Bacteria 2430
233 Ga0501038_0083990 3300049574 Bacteria 2679
234 Ga0501042_0064376 3300049578 Bacteria 2620
235 Ga0501047_0219329 3300049581 Bacteria 1759
236 Ga0501048_0045534 3300049582 Bacteria 3133
237 Ga0501069_0057115 3300049585 Bacteria 2175
238 Ga0501070_0097966 3300049586 Bacteria 2425
239 Ga0501071_0042282 3300049587 Bacteria 3264
240 Ga0501072_0127604 3300049588 Bacteria 2027
241 Ga0501073_0037573 3300049589 Bacteria 3437
242 Ga0501079_0086034 3300049741 Bacteria 2433
243 Ga0501080_0065399 3300049742 Bacteria 3382
244 Ga0501083_0245613 3300049744 Bacteria 1165
245 Ga0501035_0061723 3300049822 Bacteria 3335
246 Ga0501044_0076758 3300049823 Bacteria 3389
247 Ga0501045_0037719 3300049824 Bacteria 3513
248 nmdc:mga03683_5981_c1 3300050489 Bacteria 4143
249 nmdc:mga03n38_369929_c1 3300050490 Bacteria 783
250 nmdc:mga00v17_401100_c1 3300050491 Bacteria 891
251 nmdc:mga00v17_85749_c1 3300050491 Bacteria 1972
252 nmdc:mga0yw44_115261_c1 3300050492 Bacteria 1726
253 nmdc:mga0yw44_16806_c1 3300050492 Bacteria 3963
254 nmdc:mga07m45_54010_c1 3300050496 Bacteria 2271
255 nmdc:mga0sz30_102517_c1 3300050516 Bacteria 1251
256 nmdc:mga0sz30_236951_c1 3300050516 Bacteria 812
257 Ga0495601_0576069 3300053077 Bacteria 723
258 Ga0500610_0000111 3300053079 Bacteria 24806
259 Ga0500610_0001183 3300053079 Bacteria 8652
260 Ga0500610_0022765 3300053079 Bacteria 3094
261 Ga0495655_0014476 3300053083 Bacteria 1655
262 Ga0495619_0123213 3300053085 Bacteria 1778
263 Ga0500578_0226652 3300053086 Bacteria 1134
264 Ga0500578_0379420 3300053086 Bacteria 820
265 Ga0500646_0009750 3300053090 Bacteria 2457
266 Ga0500583_0260405 3300053092 Bacteria 855
267 Ga0500651_0012185 3300053093 Bacteria 5207
268 Ga0500566_0083732 3300053094 Bacteria 1771
269 Ga0500650_0238326 3300053098 Bacteria 819
270 Ga0500556_0133884 3300053104 Bacteria 972
271 Ga0500594_0005646 3300053118 Bacteria 2778
272 Ga0500595_002968 3300053119 Bacteria 8078
273 Ga0500607_000765 3300053121 Bacteria 30946
274 Ga0500607_282651 3300053121 Bacteria 630
275 Ga0500614_077097 3300053123 Bacteria 926
276 Ga0500618_003351 3300053125 Bacteria 5538
277 Ga0500642_0001267 3300053130 Bacteria 7229
278 Ga0500658_0022246 3300053134 Bacteria 2408
279 Ga0500658_0037555 3300053134 Bacteria 1927
280 Ga0500658_0045493 3300053134 Bacteria 1774
281 Ga0500568_0003298 3300053139 Bacteria 9102
282 Ga0500577_0055838 3300053142 Bacteria 1501
283 Ga0500588_0010891 3300053146 Bacteria 2211
284 Ga0500604_0001520 3300053151 Bacteria 6486
285 Ga0500604_0003598 3300053151 Bacteria 4171
286 Ga0500616_0001420 3300053153 Bacteria 23105
287 Ga0500620_000114 3300053155 Bacteria 15877
288 Ga0500622_0265870 3300053156 Bacteria 746
289 Ga0500627_0063096 3300053158 Bacteria 1633
290 Ga0500627_0091907 3300053158 Bacteria 1358
291 Ga0500634_0000041 3300053161 Bacteria 59177
292 Ga0500634_0012266 3300053161 Bacteria 4458
293 Ga0500636_0042121 3300053177 Bacteria 2699
294 Ga0500636_0102250 3300053177 Bacteria 1627
295 Ga0500636_0172199 3300053177 Bacteria 1170
296 Ga0500609_000165 3300053731 Bacteria 9170
297 Ga0500609_008548 3300053731 Bacteria 1381
298 Ga0500599_002962 3300053736 Bacteria 2059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0021717 Ga0495620_0021717_1355_1984 175
2 3300046457 Ga0495590_0128983 Ga0495590_0128983_10_552 178
3 3300053121 Ga0500607_000765 Ga0500607_000765_5834_6463 184
4 3300046520 Ga0495637_0018553 Ga0495637_0018553_1194_1823 185
5 3300046691 Ga0495670_0256658 Ga0495670_0256658_10_639 185
6 3300053079 Ga0500610_0001183 Ga0500610_0001183_6078_6707 185
7 3300053086 Ga0500578_0226652 Ga0500578_0226652_64_690 185
8 3300005467 Ga0070706_100001419 Ga0070706_1000014192 186
9 3300005468 Ga0070707_100142018 Ga0070707_1001420183 186
10 3300006042 Ga0075368_10032553 Ga0075368_100325532 186
11 3300006178 Ga0075367_10003028 Ga0075367_100030282 186
12 3300006195 Ga0075366_10027975 Ga0075366_100279753 186
13 3300025910 Ga0207684_10051987 Ga0207684_100519873 186
14 3300050490 nmdc:mga03n38_369929_c1 nmdc:mga03n38_369929_c1_70_690 186
15 3300050496 nmdc:mga07m45_54010_c1 nmdc:mga07m45_54010_c1_254_874 186
16 3300053079 Ga0500610_0000111 Ga0500610_0000111_3960_4589 187
17 3300041413 Ga0439465_0013340 Ga0439465_0013340_1006_1578 189
18 3300046512 Ga0495610_0183305 Ga0495610_0183305_122_802 189
19 iso_pu_bacteria 2585427527 2585534927 190
20 iso_pu_bacteria 2585427530 2585551626 190
21 iso_pu_bacteria 2693429783 2694633643 190
22 iso_pu_bacteria 2693429784 2694640018 190
23 3300006028 Ga0070717_10181016 Ga0070717_101810162 191
24 3300053153 Ga0500616_0001420 Ga0500616_0001420_4270_4848 191
25 3300005337 Ga0070682_100000323 Ga0070682_1000003238 192
26 3300049569 Ga0501032_0036879 Ga0501032_0036879_1535_2119 192
27 3300049570 Ga0501033_0086198 Ga0501033_0086198_1535_2119 192
28 3300049573 Ga0501037_0076457 Ga0501037_0076457_561_1145 192
29 3300049574 Ga0501038_0083990 Ga0501038_0083990_1535_2119 192
30 3300049578 Ga0501042_0064376 Ga0501042_0064376_1593_2177 192
31 3300049582 Ga0501048_0045534 Ga0501048_0045534_2527_3111 192
32 3300049585 Ga0501069_0057115 Ga0501069_0057115_18_602 192
33 3300049586 Ga0501070_0097966 Ga0501070_0097966_261_845 192
34 3300049587 Ga0501071_0042282 Ga0501071_0042282_1807_2391 192
35 3300049588 Ga0501072_0127604 Ga0501072_0127604_883_1467 192
36 3300049589 Ga0501073_0037573 Ga0501073_0037573_2295_2879 192
37 3300049741 Ga0501079_0086034 Ga0501079_0086034_67_651 192
38 3300049742 Ga0501080_0065399 Ga0501080_0065399_2025_2609 192
39 3300049744 Ga0501083_0245613 Ga0501083_0245613_173_757 192
40 3300049822 Ga0501035_0061723 Ga0501035_0061723_1217_1801 192
41 3300049823 Ga0501044_0076758 Ga0501044_0076758_1271_1855 192
42 3300049824 Ga0501045_0037719 Ga0501045_0037719_990_1574 192
43 iso_pu_bacteria 2919166419 2919169819 192
44 3300009545 Ga0105237_10011875 Ga0105237_1001187511 193
45 3300010375 Ga0105239_10025695 Ga0105239_100256958 193
46 3300010375 Ga0105239_10216462 Ga0105239_102164622 193
47 3300037418 Ga0395900_0086174 Ga0395900_0086174_164_754 193
48 3300037471 Ga0395905_0345472 Ga0395905_0345472_757_1347 193
49 3300038443 Ga0395901_0033423 Ga0395901_0033423_1694_2284 193
50 3300048915 Ga0496112_0269819 Ga0496112_0269819_527_1117 193
51 3300048922 Ga0496119_0069725 Ga0496119_0069725_59_649 193
52 3300048923 Ga0496120_0001733 Ga0496120_0001733_14430_15020 193
53 3300053121 Ga0500607_282651 Ga0500607_282651_17_601 193
54 3300005457 Ga0070662_100057388 Ga0070662_1000573882 194
55 3300005563 Ga0068855_100234608 Ga0068855_1002346083 194
56 3300005578 Ga0068854_100010157 Ga0068854_1000101577 194
57 3300010375 Ga0105239_10144967 Ga0105239_101449673 194
58 3300025261 Ga0209233_1000338 Ga0209233_10003386 194
59 3300025904 Ga0207647_10147046 Ga0207647_101470462 194
60 3300025913 Ga0207695_10000011 Ga0207695_10000011883 194
61 3300025981 Ga0207640_10007184 Ga0207640_100071847 194
62 3300027312 Ga0209371_1055605 Ga0209371_10556051 194
63 3300028379 Ga0268266_10516989 Ga0268266_105169891 194
64 3300030500 Ga0268256_1062353 Ga0268256_10623531 194
65 3300035115 Ga0373941_0148825 Ga0373941_0148825_118_711 194
66 3300037418 Ga0395900_0290671 Ga0395900_0290671_839_1429 194
67 3300037466 Ga0395898_0090252 Ga0395898_0090252_594_1184 194
68 3300037466 Ga0395898_0213730 Ga0395898_0213730_562_1155 194
69 3300037471 Ga0395905_0007924 Ga0395905_0007924_4983_5573 194
70 3300038443 Ga0395901_0037446 Ga0395901_0037446_1015_1605 194
71 3300044901 Ga0466960_0079072 Ga0466960_0079072_930_1520 194
72 3300050516 nmdc:mga0sz30_236951_c1 nmdc:mga0sz30_236951_c1_149_739 194
73 3300053125 Ga0500618_003351 Ga0500618_003351_3633_4223 194
74 3300053155 Ga0500620_000114 Ga0500620_000114_7800_8390 194
75 3300013306 Ga0163162_10176746 Ga0163162_101767463 195
76 3300041486 Ga0451807_1101745 Ga0451807_1101745_285_878 195
77 3300046513 Ga0495616_0124652 Ga0495616_0124652_153_746 195
78 3300046515 Ga0495620_0131672 Ga0495620_0131672_341_934 195
79 3300046518 Ga0495631_0168123 Ga0495631_0168123_244_837 195
80 3300046520 Ga0495637_0076262 Ga0495637_0076262_225_818 195
81 3300046522 Ga0495643_0067082 Ga0495643_0067082_912_1505 195
82 3300046542 Ga0495597_0058251 Ga0495597_0058251_57_650 195
83 3300046558 Ga0495633_0072319 Ga0495633_0072319_215_811 195
84 3300046616 Ga0495668_0023339 Ga0495668_0023339_2676_3269 195
85 3300047443 Ga0495687_035507 Ga0495687_035507_332_925 195
86 3300047470 Ga0495681_0029758 Ga0495681_0029758_1316_1912 195
87 3300048091 Ga0495626_0024478 Ga0495626_0024478_732_1325 195
88 3300048927 Ga0496124_0177927 Ga0496124_0177927_633_1226 195
89 3300048929 Ga0496126_0000522 Ga0496126_0000522_53090_53683 195
90 3300050491 nmdc:mga00v17_85749_c1 nmdc:mga00v17_85749_c1_807_1400 195
91 3300050492 nmdc:mga0yw44_115261_c1 nmdc:mga0yw44_115261_c1_552_1145 195
92 3300053079 Ga0500610_0022765 Ga0500610_0022765_739_1332 195
93 3300053083 Ga0495655_0014476 Ga0495655_0014476_324_917 195
94 3300053086 Ga0500578_0379420 Ga0500578_0379420_123_716 195
95 3300053090 Ga0500646_0009750 Ga0500646_0009750_256_849 195
96 3300053092 Ga0500583_0260405 Ga0500583_0260405_167_760 195
97 3300053093 Ga0500651_0012185 Ga0500651_0012185_571_1164 195
98 3300053094 Ga0500566_0083732 Ga0500566_0083732_577_1170 195
99 3300053098 Ga0500650_0238326 Ga0500650_0238326_163_756 195
100 3300053104 Ga0500556_0133884 Ga0500556_0133884_32_625 195
101 3300053118 Ga0500594_0005646 Ga0500594_0005646_1439_2032 195
102 3300053119 Ga0500595_002968 Ga0500595_002968_3979_4572 195
103 3300053130 Ga0500642_0001267 Ga0500642_0001267_3098_3691 195
104 3300053134 Ga0500658_0022246 Ga0500658_0022246_212_805 195
105 3300053134 Ga0500658_0037555 Ga0500658_0037555_608_1201 195
106 3300053134 Ga0500658_0045493 Ga0500658_0045493_107_700 195
107 3300053139 Ga0500568_0003298 Ga0500568_0003298_5405_5998 195
108 3300053142 Ga0500577_0055838 Ga0500577_0055838_336_929 195
109 3300053146 Ga0500588_0010891 Ga0500588_0010891_1393_1986 195
110 3300053151 Ga0500604_0001520 Ga0500604_0001520_5549_6142 195
111 3300053151 Ga0500604_0003598 Ga0500604_0003598_2672_3265 195
112 3300053156 Ga0500622_0265870 Ga0500622_0265870_133_726 195
113 3300053158 Ga0500627_0063096 Ga0500627_0063096_656_1252 195
114 3300053158 Ga0500627_0091907 Ga0500627_0091907_257_850 195
115 3300053177 Ga0500636_0042121 Ga0500636_0042121_268_864 195
116 3300053731 Ga0500609_000165 Ga0500609_000165_4466_5059 195
117 3300053731 Ga0500609_008548 Ga0500609_008548_401_994 195
118 3300053736 Ga0500599_002962 Ga0500599_002962_657_1250 195
119 3300046471 Ga0495650_0042202 Ga0495650_0042202_1298_1894 196
120 3300046476 Ga0495662_0007485 Ga0495662_0007485_4497_5093 196
121 3300046512 Ga0495610_0002933 Ga0495610_0002933_5060_5656 196
122 3300046522 Ga0495643_0010872 Ga0495643_0010872_2363_2959 196
123 3300046557 Ga0495622_0046582 Ga0495622_0046582_660_1256 196
124 3300046663 Ga0495635_0100316 Ga0495635_0100316_1002_1598 196
125 3300046690 Ga0495624_0251915 Ga0495624_0251915_43_639 196
126 3300046809 Ga0495600_0133438 Ga0495600_0133438_280_876 196
127 3300047317 Ga0495604_0023069 Ga0495604_0023069_1632_2228 196
128 3300047472 Ga0495686_0009855 Ga0495686_0009855_1294_1890 196
129 3300048925 Ga0496122_0065353 Ga0496122_0065353_1010_1606 196
130 3300049459 Ga0495678_025962 Ga0495678_025962_700_1296 196
131 3300053077 Ga0495601_0576069 Ga0495601_0576069_36_632 196
132 3300053085 Ga0495619_0123213 Ga0495619_0123213_97_693 196
133 3300053123 Ga0500614_077097 Ga0500614_077097_139_735 196
134 3300050492 nmdc:mga0yw44_16806_c1 nmdc:mga0yw44_16806_c1_1373_1972 197
135 iso_pu_bacteria 2844533157 2844535290 197
136 3300013250 Ga0171462_1028 Ga0171462_102881 198
137 iso_pu_bacteria 2501025502 2501079093 198
138 3300041997 Ga0439431_0132784 Ga0439431_0132784_34_639 199
139 3300049571 Ga0501034_0356441 Ga0501034_0356441_205_810 199
140 iso_pu_bacteria 2841760612 2841760882 199
141 iso_pu_bacteria 2844104063 2844106539 199
142 iso_pu_bacteria 2851182111 2851187532 199
143 iso_pu_bacteria 2851246043 2851246895 199
144 iso_pu_bacteria 2928163908 2928165695 199
145 3300046471 Ga0495650_0013435 Ga0495650_0013435_2073_2807 200
146 3300046515 Ga0495620_0068057 Ga0495620_0068057_537_1271 200
147 3300046531 Ga0495665_0017397 Ga0495665_0017397_1240_1974 200
148 3300046648 Ga0495611_0032014 Ga0495611_0032014_1224_1958 200
149 3300046665 Ga0495661_0070740 Ga0495661_0070740_1090_1824 200
150 3300046674 Ga0495588_0057911 Ga0495588_0057911_838_1467 200
151 3300046684 Ga0495669_0035420 Ga0495669_0035420_607_1341 200
152 3300046692 Ga0495671_0002512 Ga0495671_0002512_7425_8054 200
153 3300046692 Ga0495671_0127410 Ga0495671_0127410_308_1042 200
154 3300047446 Ga0495679_000023 Ga0495679_000023_140305_141039 200
155 3300047469 Ga0495673_0012722 Ga0495673_0012722_2745_3479 200
156 3300047472 Ga0495686_0029484 Ga0495686_0029484_2266_3000 200
157 3300049459 Ga0495678_036769 Ga0495678_036769_589_1323 200
158 3300050516 nmdc:mga0sz30_102517_c1 nmdc:mga0sz30_102517_c1_628_1236 200
159 3300053161 Ga0500634_0012266 Ga0500634_0012266_1633_2259 200
160 iso_pu_bacteria 2513237090 2513609112 200
161 iso_pu_bacteria 2599185301 2599937966 200
162 iso_pu_bacteria 2856364286 2856364568 200
163 iso_pu_bacteria 2857349434 2857355905 200
164 iso_pu_bacteria 2869285874 2869292759 200
165 iso_pu_bacteria 2871429161 2871429572 200
166 iso_pu_bacteria 2874146452 2874147036 200
167 iso_pu_bacteria 2874155637 2874156985 200
168 iso_pu_bacteria 2876413966 2876414424 200
169 iso_pu_bacteria 2878745973 2878746256 200
170 iso_pu_bacteria 2888350351 2888350587 200
171 iso_pu_bacteria 2889010040 2889012927 200
172 iso_pu_bacteria 2889016732 2889022202 200
173 iso_pu_bacteria 2903492973 2903500598 200
174 iso_pu_bacteria 2906308376 2906308471 200
175 iso_pu_bacteria 2906321335 2906321937 200
176 iso_pu_bacteria 2906354277 2906359390 200
177 iso_pu_bacteria 2922185730 2922192129 200
178 iso_pu_bacteria 2937813078 2937814315 200
179 iso_pu_bacteria 2958100919 2958106646 200
180 iso_pu_bacteria 2958130278 2958137348 200
181 iso_pu_bacteria 2958172287 2958179630 200
182 iso_pu_bacteria 2958179912 2958180275 200
183 iso_pu_bacteria 2961077736 2961078107 200
184 iso_pu_bacteria 2965119406 2965124457 200
185 iso_pu_bacteria 2968117919 2968118243 200
186 iso_pu_bacteria 2977843712 2977844905 200
187 iso_pu_bacteria 2977942078 2977943803 200
188 iso_pu_bacteria 2977971508 2977972870 200
189 iso_pu_bacteria 2979710463 2979713248 200
190 iso_pu_bacteria 2979742915 2979747568 200
191 iso_pu_bacteria 2987636660 2987639719 200
192 iso_pu_bacteria 2987652177 2987658449 200
193 iso_pu_bacteria 3004203850 3004207292 200
194 iso_pu_bacteria 8004387939 8004388421 200
195 iso_pu_bacteria 8004640170 8004641713 200
196 iso_pu_bacteria 8004714634 8004714727 200
197 3300009098 Ga0105245_10601577 Ga0105245_106015772 201
198 3300046455 Ga0495603_0352139 Ga0495603_0352139_11_745 201
199 3300046457 Ga0495590_0041977 Ga0495590_0041977_177_800 201
200 3300046459 Ga0495629_0000052 Ga0495629_0000052_23876_24499 201
201 3300046460 Ga0495638_0084534 Ga0495638_0084534_738_1361 201
202 3300046463 Ga0495653_0001943 Ga0495653_0001943_11712_12335 201
203 3300046472 Ga0495580_0004723 Ga0495580_0004723_3926_4549 201
204 3300046472 Ga0495580_0011040 Ga0495580_0011040_3115_3849 201
205 3300046506 Ga0495583_0059248 Ga0495583_0059248_549_1172 201
206 3300046516 Ga0495628_0038131 Ga0495628_0038131_490_1113 201
207 3300046517 Ga0495630_0008386 Ga0495630_0008386_5769_6503 201
208 3300046526 Ga0495666_0061455 Ga0495666_0061455_983_1606 201
209 3300046680 Ga0495646_0040205 Ga0495646_0040205_2019_2642 201
210 3300046690 Ga0495624_0008497 Ga0495624_0008497_3883_4506 201
211 3300046690 Ga0495624_0110496 Ga0495624_0110496_737_1471 201
212 3300047319 Ga0495674_0006941 Ga0495674_0006941_6297_6920 201
213 3300047319 Ga0495674_0072914 Ga0495674_0072914_204_938 201
214 3300047321 Ga0495676_0208297 Ga0495676_0208297_59_682 201
215 3300047443 Ga0495687_021116 Ga0495687_021116_382_1005 201
216 3300047673 Ga0495593_0160846 Ga0495593_0160846_447_1070 201
217 3300048089 Ga0495614_0095895 Ga0495614_0095895_304_927 201
218 3300048924 Ga0496121_0028418 Ga0496121_0028418_1986_2609 201
219 3300049581 Ga0501047_0219329 Ga0501047_0219329_622_1236 201
220 3300053177 Ga0500636_0102250 Ga0500636_0102250_838_1452 201
221 iso_pu_bacteria 2582581308 2585282845 201
222 iso_pu_bacteria 2615840626 2616308142 201
223 iso_pu_bacteria 2818991453 2819638345 201
224 iso_pu_bacteria 2842482326 2842483132 201
225 iso_pu_bacteria 2847670302 2847671782 201
226 iso_pu_bacteria 2847686936 2847688012 201
227 iso_pu_bacteria 2856314179 2856318488 201
228 iso_pu_bacteria 2871495908 2871498407 201
229 iso_pu_bacteria 2874102143 2874106343 201
230 iso_pu_bacteria 2876369609 2876372914 201
231 iso_pu_bacteria 2876392853 2876399520 201
232 iso_pu_bacteria 2878035449 2878037824 201
233 iso_pu_bacteria 2878760144 2878762626 201
234 iso_pu_bacteria 2878767105 2878769592 201
235 iso_pu_bacteria 2881147464 2881153611 201
236 iso_pu_bacteria 2881161766 2881162767 201
237 iso_pu_bacteria 2885305155 2885311513 201
238 iso_pu_bacteria 2885312484 2885316418 201
239 iso_pu_bacteria 2885326080 2885328643 201
240 iso_pu_bacteria 2885334103 2885338221 201
241 iso_pu_bacteria 2903540706 2903543205 201
242 iso_pu_bacteria 2904659560 2904666047 201
243 iso_pu_bacteria 2906328253 2906331178 201
244 iso_pu_bacteria 2906414383 2906418525 201
245 iso_pu_bacteria 2917699015 2917704297 201
246 iso_pu_bacteria 2922158528 2922163196 201
247 iso_pu_bacteria 2924726620 2924729659 201
248 iso_pu_bacteria 2933599457 2933604377 201
249 iso_pu_bacteria 2937891427 2937893004 201
250 iso_pu_bacteria 2937994558 2937997054 201
251 iso_pu_bacteria 2938014810 2938016489 201
252 iso_pu_bacteria 2958041894 2958042833 201
253 iso_pu_bacteria 2958115193 2958117024 201
254 iso_pu_bacteria 2958165035 2958167524 201
255 iso_pu_bacteria 2961114664 2961121390 201
256 iso_pu_bacteria 2961163497 2961165996 201
257 iso_pu_bacteria 2965018300 2965020815 201
258 iso_pu_bacteria 2968091066 2968096937 201
259 iso_pu_bacteria 2968097103 2968102351 201
260 iso_pu_bacteria 2968110612 2968117543 201
261 iso_pu_bacteria 2968128360 2968131128 201
262 iso_pu_bacteria 2968171901 2968174393 201
263 iso_pu_bacteria 2970554993 2970557484 201
264 iso_pu_bacteria 2977858184 2977861690 201
265 iso_pu_bacteria 2977864932 2977869617 201
266 iso_pu_bacteria 2979779861 2979785400 201
267 iso_pu_bacteria 2987659509 2987662003 201
268 iso_pu_bacteria 2996341866 2996347584 201
269 iso_pu_bacteria 3004188549 3004191054 201
270 iso_pu_bacteria 8004445564 8004446588 201
271 iso_pu_bacteria 8004703790 8004710906 201
272 3300046476 Ga0495662_0066222 Ga0495662_0066222_104_715 202
273 iso_pu_bacteria 2524023209 2524461370 202
274 iso_pu_bacteria 2818991448 2819610695 202
275 iso_pu_bacteria 2842298080 2842302959 202
276 iso_pu_bacteria 2842357229 2842361854 202
277 iso_pu_bacteria 2871488783 2871493893 202
278 iso_pu_bacteria 2878753008 2878756469 202
279 iso_pu_bacteria 2881155292 2881157408 202
280 iso_pu_bacteria 2881853255 2881854285 202
281 iso_pu_bacteria 2881861095 2881865086 202
282 iso_pu_bacteria 2882912400 2882917459 202
283 iso_pu_bacteria 2885342637 2885346699 202
284 iso_pu_bacteria 2885350715 2885354005 202
285 iso_pu_bacteria 2903492973 2903502603 202
286 iso_pu_bacteria 2924762789 2924764662 202
287 iso_pu_bacteria 2924784321 2924788047 202
288 iso_pu_bacteria 2937822353 2937829313 202
289 iso_pu_bacteria 2961127735 2961131666 202
290 iso_pu_bacteria 2961170736 2961172758 202
291 iso_pu_bacteria 2965062239 2965066461 202
292 iso_pu_bacteria 2967996073 2967997970 202
293 iso_pu_bacteria 2968003550 2968008621 202
294 iso_pu_bacteria 2970503327 2970505352 202
295 iso_pu_bacteria 2977821940 2977825650 202
296 iso_pu_bacteria 2977828996 2977834252 202
297 iso_pu_bacteria 2979808191 2979810073 202
298 iso_pu_bacteria 2987666974 2987667466 202
299 iso_pu_bacteria 8004374579 8004378058 202
300 iso_pu_bacteria 8005484373 8005487124 202
301 iso_pu_bacteria 8005645114 8005646522 202
302 3300002987 JGI25159J45721_1002735 JGI25159J45721_10027356 203
303 3300005262 Ga0065165_1000141 Ga0065165_100014121 203
304 3300005331 Ga0070670_100000183 Ga0070670_10000018315 203
305 3300015265 Ga0182005_1015942 Ga0182005_10159423 203
306 3300025284 Ga0209130_1000178 Ga0209130_100017821 203
307 3300025294 Ga0209025_1003835 Ga0209025_100383512 203
308 3300025925 Ga0207650_10000151 Ga0207650_1000015155 203
309 3300031548 Ga0307408_100068473 Ga0307408_1000684732 203
310 3300048926 Ga0496123_0119793 Ga0496123_0119793_190_801 203
311 iso_pu_bacteria 2984587000 2984590467 203
312 3300002741 JGI25157J39369_1000624 JGI25157J39369_10006247 204
313 3300003214 JGI25165J46597_1000028 JGI25165J46597_1000028152 204
314 3300005563 Ga0068855_100208888 Ga0068855_1002088883 204
315 3300005577 Ga0068857_100080799 Ga0068857_1000807993 204
316 3300009093 Ga0105240_10343476 Ga0105240_103434761 204
317 3300009093 Ga0105240_10916285 Ga0105240_109162852 204
318 3300009551 Ga0105238_10000866 Ga0105238_1000086627 204
319 3300025250 Ga0209026_1000120 Ga0209026_100012066 204
320 3300025256 Ga0209759_1000288 Ga0209759_100028861 204
321 3300025261 Ga0209233_1000087 Ga0209233_1000087152 204
322 3300025904 Ga0207647_10020202 Ga0207647_100202024 204
323 3300025913 Ga0207695_10579938 Ga0207695_105799382 204
324 3300025924 Ga0207694_10313535 Ga0207694_103135352 204
325 3300025949 Ga0207667_10917157 Ga0207667_109171571 204
326 3300026041 Ga0207639_10003205 Ga0207639_100032058 204
327 3300037418 Ga0395900_0028692 Ga0395900_0028692_4646_5269 204
328 3300037471 Ga0395905_0426033 Ga0395905_0426033_123_746 204
329 3300048929 Ga0496126_0723824 Ga0496126_0723824_90_713 204
330 iso_pu_bacteria 2721755686 2723577357 204
331 iso_pu_bacteria 2869162929 2869164998 204
332 iso_pu_bacteria 2882632389 2882635071 204
333 iso_pu_bacteria 2884411467 2884415377 204
334 3300003214 JGI25165J46597_1007146 JGI25165J46597_10071463 205
335 3300005262 Ga0065165_1000807 Ga0065165_100080712 205
336 3300005616 Ga0068852_100054124 Ga0068852_1000541243 205
337 3300009093 Ga0105240_10000005 Ga0105240_1000000531 205
338 3300009148 Ga0105243_10265064 Ga0105243_102650642 205
339 3300009177 Ga0105248_10337546 Ga0105248_103375462 205
340 3300009545 Ga0105237_10001070 Ga0105237_1000107021 205
341 3300010375 Ga0105239_10008784 Ga0105239_1000878419 205
342 3300013104 Ga0157370_10001758 Ga0157370_100017584 205
343 3300013105 Ga0157369_10436284 Ga0157369_104362842 205
344 3300014497 Ga0182008_10008919 Ga0182008_100089197 205
345 3300015262 Ga0182007_10009044 Ga0182007_100090444 205
346 3300015265 Ga0182005_1004056 Ga0182005_10040566 205
347 3300025253 Ga0209677_101628 Ga0209677_1016289 205
348 3300025914 Ga0207671_10001852 Ga0207671_100018528 205
349 3300025949 Ga0207667_10335716 Ga0207667_103357162 205
350 3300038443 Ga0395901_0077917 Ga0395901_0077917_2585_3211 205
351 3300048903 Ga0496100_0087129 Ga0496100_0087129_1330_1953 205
352 3300048906 Ga0496103_0021908 Ga0496103_0021908_1963_2586 205
353 3300048916 Ga0496113_0061413 Ga0496113_0061413_1102_1725 205
354 3300048919 Ga0496116_0023405 Ga0496116_0023405_1368_1991 205
355 3300048920 Ga0496117_0009500 Ga0496117_0009500_6501_7124 205
356 3300048921 Ga0496118_0001382 Ga0496118_0001382_33618_34241 205
357 3300048922 Ga0496119_0030846 Ga0496119_0030846_1600_2223 205
358 3300048923 Ga0496120_0017721 Ga0496120_0017721_1373_1996 205
359 3300048924 Ga0496121_0014149 Ga0496121_0014149_6500_7123 205
360 3300048925 Ga0496122_0068411 Ga0496122_0068411_1376_1999 205
361 3300048926 Ga0496123_0025840 Ga0496123_0025840_2426_3049 205
362 3300048927 Ga0496124_0275858 Ga0496124_0275858_443_1066 205
363 3300048928 Ga0496125_0025521 Ga0496125_0025521_1219_1842 205
364 3300002737 JGI25162J39368_1002828 JGI25162J39368_10028283 206
365 3300003214 JGI25165J46597_1000448 JGI25165J46597_100044842 206
366 3300003215 JGI25153J46596_10000123 JGI25153J46596_1000012359 206
367 3300003320 rootH2_10004296 rootH2_100042964 206
368 3300003322 rootL2_10012764 rootL2_100127647 206
369 3300003794 Ga0055531_10013761 Ga0055531_100137615 206
370 3300003856 Ga0058692_1019072 Ga0058692_10190722 206
371 3300005353 Ga0070669_100232366 Ga0070669_1002323662 206
372 3300005548 Ga0070665_100176588 Ga0070665_1001765883 206
373 3300005548 Ga0070665_100228728 Ga0070665_1002287281 206
374 3300005548 Ga0070665_100729934 Ga0070665_1007299342 206
375 3300005844 Ga0068862_100111538 Ga0068862_1001115382 206
376 3300006177 Ga0075362_10008807 Ga0075362_100088074 206
377 3300006186 Ga0075369_10022970 Ga0075369_100229702 206
378 3300025207 Ga0209760_105327 Ga0209760_1053271 206
379 3300025233 Ga0209437_100153 Ga0209437_100153157 206
380 3300025261 Ga0209233_1000175 Ga0209233_1000175146 206
381 3300025297 Ga0209758_1000471 Ga0209758_100047113 206
382 3300025298 Ga0209050_1019661 Ga0209050_10196614 206
383 3300025304 Ga0209257_1000114 Ga0209257_1000114134 206
384 3300025937 Ga0207669_10084257 Ga0207669_100842573 206
385 3300025972 Ga0207668_10328991 Ga0207668_103289911 206
386 3300025986 Ga0207658_10390741 Ga0207658_103907412 206
387 3300026067 Ga0207678_10145408 Ga0207678_101454082 206
388 3300026121 Ga0207683_10130909 Ga0207683_101309093 206
389 3300027312 Ga0209371_1003233 Ga0209371_10032339 206
390 3300028379 Ga0268266_11253757 Ga0268266_112537571 206
391 3300028380 Ga0268265_10003345 Ga0268265_100033454 206
392 3300028786 Ga0307517_10242433 Ga0307517_102424332 206
393 3300030500 Ga0268256_1002934 Ga0268256_10029344 206
394 3300045976 Ga0466967_0129115 Ga0466967_0129115_749_1375 206
395 3300046501 Ga0495607_0086371 Ga0495607_0086371_270_896 206
396 3300046512 Ga0495610_0102102 Ga0495610_0102102_294_920 206
397 3300046520 Ga0495637_0061508 Ga0495637_0061508_742_1368 206
398 3300046674 Ga0495588_0056901 Ga0495588_0056901_820_1446 206
399 3300047443 Ga0495687_065219 Ga0495687_065219_33_659 206
400 iso_pu_bacteria 2513237144 2513907769 206
401 iso_pu_bacteria 2643221634 2644192591 206
402 iso_pu_bacteria 2808606387 2808990392 206
403 iso_pu_bacteria 2885366525 2885372169 206
404 iso_pu_bacteria 2996310559 2996311538 206
405 3300025228 Ga0209672_106762 Ga0209672_1067622 207
406 iso_pu_bacteria 2989776772 2989780342 207
407 3300006038 Ga0075365_10012485 Ga0075365_100124855 208
408 3300006051 Ga0075364_10448179 Ga0075364_104481792 209
409 3300006177 Ga0075362_10015986 Ga0075362_100159862 209
410 3300006178 Ga0075367_10093173 Ga0075367_100931732 209
411 3300006186 Ga0075369_10018674 Ga0075369_100186742 209
412 3300050489 nmdc:mga03683_5981_c1 nmdc:mga03683_5981_c1_1573_2211 209
413 3300050491 nmdc:mga00v17_401100_c1 nmdc:mga00v17_401100_c1_41_676 209
414 3300053177 Ga0500636_0172199 Ga0500636_0172199_186_821 209
415 iso_pu_bacteria 2510917013 2511093492 209
416 iso_pu_bacteria 2510917022 2511135953 209
417 iso_pu_bacteria 2515154189 2516018888 209
418 iso_pu_bacteria 2582581307 2585274378 209
419 iso_pu_bacteria 2585427531 2585560827 209
420 iso_pu_bacteria 2585427609 2585903377 209
421 iso_pu_bacteria 2585428125 2587981504 209
422 3300005328 Ga0070676_10089297 Ga0070676_100892972 210
423 3300005459 Ga0068867_100041822 Ga0068867_1000418224 210
424 3300009148 Ga0105243_10095295 Ga0105243_100952953 210
425 3300011119 Ga0105246_10166829 Ga0105246_101668291 210
426 3300025935 Ga0207709_10049448 Ga0207709_100494482 210
427 3300026067 Ga0207678_10034482 Ga0207678_100344828 210
428 3300026089 Ga0207648_10096896 Ga0207648_100968962 210
429 iso_pu_bacteria 2615840698 2616556838 210
430 iso_pu_bacteria 2863421361 2863423466 210
431 3300006353 Ga0075370_10013062 Ga0075370_100130623 213
432 3300001989 JGI24739J22299_10009111 JGI24739J22299_100091113 214
433 3300003320 rootH2_10067805 rootH2_100678053 214
434 3300013105 Ga0157369_10224058 Ga0157369_102240582 214
435 3300015261 Ga0182006_1017373 Ga0182006_10173733 214
436 3300025904 Ga0207647_10002023 Ga0207647_1000202314 214
437 3300044684 Ga0466966_0069981 Ga0466966_0069981_684_1328 214
438 3300044693 Ga0466961_0064611 Ga0466961_0064611_735_1379 214
439 3300048904 Ga0496101_0482524 Ga0496101_0482524_87_731 214
440 3300048907 Ga0496104_0233231 Ga0496104_0233231_958_1602 214
441 3300048915 Ga0496112_0174840 Ga0496112_0174840_575_1219 214
442 3300048919 Ga0496116_0101763 Ga0496116_0101763_305_949 214
443 3300048920 Ga0496117_0066028 Ga0496117_0066028_853_1497 214
444 3300048921 Ga0496118_0080058 Ga0496118_0080058_783_1427 214
445 3300048924 Ga0496121_0208561 Ga0496121_0208561_375_1019 214
446 3300048925 Ga0496122_0139768 Ga0496122_0139768_37_681 214
447 3300053161 Ga0500634_0000041 Ga0500634_0000041_28078_28758 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

24

70

0.98

PF17918

TetR_C_15

Tetracyclin repressor-like, C-terminal domain

91

197

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3on4-assembly4.cif.gz_F crystal structure of tetr transcriptional regulator from legionella pneumophila 0.7915 26 197
3knw-assembly1.cif.gz_A crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.791 22 202
2zcn-assembly2.cif.gz_C crystal structure of icar, a repressor of the tetr family 0.7852 25 203
3br5-assembly2.cif.gz_E crystal structure of the complex of rhodamine 6g bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor 0.7802 24 204
3knw-assembly1.cif.gz_A crystal structure of a putative transcriptional regulator (tetr/acrr family member) from putative transcriptional regulator (tetr/acrr family) 0.7795 22 202
ID Description Score Start End Superfamily
2jj7B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.982 22 66 1.10.10.60
3whbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9817 22 66 1.10.10.60
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9787 26 66 1.10.10.60
2wv1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9776 22 66 1.10.10.60
5gpaA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9759 24 66 1.10.10.60
ID Description Score Start End GO Terms
AF-Q0B4Q4-F1-model_v4 Tetracyclin repressor SlmA-like C-terminal domain-containing protein 0.9222 83 214
AF-Q0B4Q4-F1-model_v4 Tetracyclin repressor SlmA-like C-terminal domain-containing protein 0.9088 83 214
AF-A0A4R1T1G8-F1-model_v4 deleted 0.8995 25 204
AF-A0A1N6LR40-F1-model_v4 deleted 0.8966 12 205
AF-A0A434TJS1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.8879 12 213 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
84.84 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map