F446156

General Info

Members Datasets Scaffolds Average Seq Length
448 260 448 115

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10000371|Ga0105249_1000037117
Length 125
Sequence MAGSLADWAAMAKGKKRRPRQKVATVDYTDAEGNKLTLRESLSPGTIAKLGEGPVTAATSQDDAWRRRSELLFERLAVRWEIAGLPLTEQKMLLGRYRMADALTQQWVRETIDEHLQRYIPELAG

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
123 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
200 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
257 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 9.15
Rhizosphere 86.16
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000424 3300002074 Bacteria 4707
2 JGI24034J26672_10000864 3300002239 Bacteria 3937
3 JGI24742J22300_10001949 3300002244 Bacteria 3288
4 JGI25407J50210_10003555 3300003373 Bacteria 3742
5 JGI25407J50210_10072183 3300003373 Bacteria 861
6 Ga0070676_10443795 3300005328 Bacteria 911
7 Ga0070683_100006125 3300005329 Bacteria 10085
8 Ga0070677_10000163 3300005333 Bacteria 22821
9 Ga0070677_10910541 3300005333 Bacteria 509
10 Ga0070682_100000077 3300005337 Bacteria 89055
11 Ga0070682_100193627 3300005337 Bacteria 1429
12 Ga0070689_100075918 3300005340 Bacteria 2632
13 Ga0070661_100000116 3300005344 Bacteria 66712
14 Ga0070692_10743780 3300005345 Bacteria 664
15 Ga0070668_100892596 3300005347 Unclassified 794
16 Ga0070688_100151527 3300005365 Bacteria 1586
17 Ga0070659_100009046 3300005366 Bacteria 7309
18 Ga0070667_100085406 3300005367 Bacteria 2707
19 Ga0070705_100555312 3300005440 Bacteria 881
20 Ga0070700_100252279 3300005441 Bacteria 1266
21 Ga0070694_100622786 3300005444 Unclassified 871
22 Ga0070663_100099405 3300005455 Bacteria 2169
23 Ga0070678_100001532 3300005456 Bacteria 12353
24 Ga0070678_100036225 3300005456 Bacteria 3452
25 Ga0070681_10033752 3300005458 Bacteria 5137
26 Ga0068867_100671961 3300005459 Bacteria 911
27 Ga0070685_10001592 3300005466 Bacteria 11970
28 Ga0070685_10275582 3300005466 Bacteria 1124
29 Ga0070698_101646735 3300005471 Unclassified 594
30 Ga0070679_100000487 3300005530 Bacteria 33946
31 Ga0070684_100017747 3300005535 Bacteria 5848
32 Ga0070684_100031509 3300005535 Bacteria 4515
33 Ga0070684_100108093 3300005535 Bacteria 2492
34 Ga0068853_100004202 3300005539 Bacteria 11107
35 Ga0068853_100077288 3300005539 Bacteria 2908
36 Ga0070672_100008239 3300005543 Bacteria 7123
37 Ga0070686_101772627 3300005544 Unclassified 525
38 Ga0070695_100036840 3300005545 Bacteria 3080
39 Ga0070665_100000341 3300005548 Bacteria 70565
40 Ga0070704_101076059 3300005549 Unclassified 730
41 Ga0070664_100075757 3300005564 Bacteria 2890
42 Ga0068854_100104593 3300005578 Bacteria 2127
43 Ga0068856_100011212 3300005614 Bacteria 8699
44 Ga0068856_100100573 3300005614 Bacteria 2883
45 Ga0068856_100324905 3300005614 Bacteria 1556
46 Ga0068856_101085585 3300005614 Bacteria 818
47 Ga0070702_100114066 3300005615 Bacteria 1681
48 Ga0068852_100311262 3300005616 Bacteria 1527
49 Ga0068866_10033436 3300005718 Bacteria 2495
50 Ga0068866_11239830 3300005718 Unclassified 540
51 Ga0068861_100210122 3300005719 Bacteria 1639
52 Ga0068861_100931126 3300005719 Bacteria 825
53 Ga0068851_10000248 3300005834 Bacteria 25411
54 Ga0068851_10240210 3300005834 Bacteria 1024
55 Ga0068863_100055760 3300005841 Bacteria 3742
56 Ga0068858_100000088 3300005842 Bacteria 95138
57 Ga0068858_100000251 3300005842 Bacteria 57269
58 Ga0081455_10010452 3300005937 Bacteria 9416
59 Ga0081538_10000225 3300005981 Bacteria 63512
60 Ga0081538_10000656 3300005981 Bacteria 38278
61 Ga0081538_10001069 3300005981 Bacteria 29129
62 Ga0081538_10001141 3300005981 Bacteria 28060
63 Ga0081538_10002516 3300005981 Bacteria 17850
64 Ga0081538_10105151 3300005981 Bacteria 1406
65 Ga0081538_10204785 3300005981 Bacteria 805
66 Ga0081539_10002515 3300005985 Bacteria 25631
67 Ga0081539_10025600 3300005985 Bacteria 3794
68 Ga0081539_10195210 3300005985 Bacteria 939
69 Ga0075365_10001514 3300006038 Bacteria 10618
70 Ga0075365_10324571 3300006038 Bacteria 1084
71 Ga0075365_10954997 3300006038 Unclassified 604
72 Ga0075364_10020834 3300006051 Bacteria 4127
73 Ga0075364_10266311 3300006051 Bacteria 1165
74 Ga0075364_10988539 3300006051 Bacteria 572
75 Ga0070712_100000339 3300006175 Bacteria 26368
76 Ga0097621_102083625 3300006237 Bacteria 542
77 Ga0068871_100226848 3300006358 Bacteria 1620
78 Ga0075428_100113370 3300006844 Unclassified 2954
79 Ga0075428_100134290 3300006844 Bacteria 2691
80 Ga0075428_100417263 3300006844 Bacteria 1438
81 Ga0075428_101215411 3300006844 Bacteria 794
82 Ga0075430_100211300 3300006846 Bacteria 1610
83 Ga0075430_100250974 3300006846 Bacteria 1466
84 Ga0075430_100473258 3300006846 Bacteria 1034
85 Ga0075431_100029806 3300006847 Bacteria 5618
86 Ga0075431_100032360 3300006847 Bacteria 5389
87 Ga0075431_100052790 3300006847 Bacteria 4191
88 Ga0075431_100286216 3300006847 Bacteria 1668
89 Ga0075431_100432516 3300006847 Unclassified 1314
90 Ga0075433_10000057 3300006852 Bacteria 48581
91 Ga0075433_11738839 3300006852 Unclassified 537
92 Ga0075429_100003590 3300006880 Bacteria 13221
93 Ga0075429_100017950 3300006880 Bacteria 6118
94 Ga0068865_100000019 3300006881 Bacteria 105996
95 Ga0105240_10422842 3300009093 Bacteria 1497
96 Ga0111539_10457430 3300009094 Bacteria 1486
97 Ga0111539_10533244 3300009094 Bacteria 1368
98 Ga0111539_11343820 3300009094 Unclassified 829
99 Ga0111539_11976015 3300009094 Bacteria 676
100 Ga0111539_12415713 3300009094 Unclassified 610
101 Ga0105245_10000151 3300009098 Bacteria 65950
102 Ga0105245_10009133 3300009098 Bacteria 8645
103 Ga0105245_10012189 3300009098 Bacteria 7477
104 Ga0105245_10144075 3300009098 Bacteria 2247
105 Ga0105245_10659415 3300009098 Bacteria 1077
106 Ga0105245_10727283 3300009098 Unclassified 1027
107 Ga0105247_10000204 3300009101 Bacteria 58153
108 Ga0105247_10008346 3300009101 Bacteria 6316
109 Ga0114129_10002947 3300009147 Bacteria 23806
110 Ga0114129_10221176 3300009147 Bacteria 2554
111 Ga0114129_10371251 3300009147 Unclassified 1891
112 Ga0114129_10783838 3300009147 Bacteria 1218
113 Ga0114129_11199854 3300009147 Bacteria 945
114 Ga0114129_11663623 3300009147 Bacteria 780
115 Ga0114129_12649136 3300009147 Bacteria 598
116 Ga0105241_12193735 3300009174 Unclassified 548
117 Ga0105242_10000104 3300009176 Bacteria 60125
118 Ga0105242_10299352 3300009176 Bacteria 1467
119 Ga0105248_10000126 3300009177 Bacteria 88461
120 Ga0105237_10359668 3300009545 Bacteria 1460
121 Ga0105237_10807538 3300009545 Unclassified 945
122 Ga0105238_10000172 3300009551 Bacteria 70799
123 Ga0105249_10000371 3300009553 Bacteria 44499
124 Ga0105249_10207229 3300009553 Bacteria 1922
125 Ga0105249_10830236 3300009553 Bacteria 989
126 Ga0105249_12135415 3300009553 Unclassified 633
127 Ga0105239_10161746 3300010375 Bacteria 2501
128 Ga0105239_10285209 3300010375 Bacteria 1859
129 Ga0105239_13233133 3300010375 Unclassified 530
130 Ga0105246_10207411 3300011119 Bacteria 1527
131 Ga0157338_1055693 3300012515 Bacteria 580
132 Ga0157371_10000909 3300013102 Bacteria 33337
133 Ga0157370_10007913 3300013104 Bacteria 11515
134 Ga0157370_10029815 3300013104 Bacteria 5349
135 Ga0157369_10000135 3300013105 Bacteria 105364
136 Ga0157374_10132308 3300013296 Bacteria 2415
137 Ga0157378_10042780 3300013297 Bacteria 4020
138 Ga0163162_10030535 3300013306 Bacteria 5339
139 Ga0157375_10001783 3300013308 Bacteria 18453
140 Ga0157375_10006973 3300013308 Bacteria 9865
141 Ga0163163_10310888 3300014325 Unclassified 1629
142 Ga0182008_10605085 3300014497 Bacteria 616
143 Ga0157379_10006279 3300014968 Bacteria 10235
144 Ga0163161_10040024 3300017792 Bacteria 3366
145 Ga0207656_10000105 3300025321 Bacteria 31356
146 Ga0207656_10398386 3300025321 Bacteria 692
147 Ga0207682_10003413 3300025893 Bacteria 6911
148 Ga0207682_10607670 3300025893 Bacteria 515
149 Ga0207642_10020194 3300025899 Bacteria 2595
150 Ga0207710_10000457 3300025900 Bacteria 26204
151 Ga0207643_10074924 3300025908 Bacteria 1952
152 Ga0207705_10279905 3300025909 Bacteria 1277
153 Ga0207707_10023070 3300025912 Bacteria 5444
154 Ga0207695_10243373 3300025913 Bacteria 1699
155 Ga0207671_10271497 3300025914 Bacteria 1336
156 Ga0207693_10002524 3300025915 Bacteria 15898
157 Ga0207649_10000005 3300025920 Bacteria 356179
158 Ga0207652_10000658 3300025921 Bacteria 33940
159 Ga0207694_10000004 3300025924 Bacteria 967075
160 Ga0207687_10000037 3300025927 Bacteria 120493
161 Ga0207687_10000167 3300025927 Bacteria 44044
162 Ga0207687_10004633 3300025927 Bacteria 9148
163 Ga0207687_10496179 3300025927 Bacteria 1018
164 Ga0207687_10812948 3300025927 Unclassified 797
165 Ga0207690_10052909 3300025932 Bacteria 2722
166 Ga0207690_10350217 3300025932 Bacteria 1168
167 Ga0207686_10000063 3300025934 Bacteria 96427
168 Ga0207670_10238103 3300025936 Bacteria 1401
169 Ga0207704_10000009 3300025938 Bacteria 198266
170 Ga0207704_11537124 3300025938 Bacteria 571
171 Ga0207691_10043696 3300025940 Bacteria 4128
172 Ga0207711_10000024 3300025941 Bacteria 293596
173 Ga0207661_10003140 3300025944 Bacteria 11451
174 Ga0207661_10004159 3300025944 Bacteria 10122
175 Ga0207661_10004202 3300025944 Bacteria 10071
176 Ga0207679_10056661 3300025945 Bacteria 2895
177 Ga0207712_10000037 3300025961 Bacteria 195906
178 Ga0207712_11939068 3300025961 Unclassified 527
179 Ga0207668_10350188 3300025972 Bacteria 1235
180 Ga0207668_10619670 3300025972 Bacteria 944
181 Ga0207668_11864915 3300025972 Bacteria 542
182 Ga0207640_10197106 3300025981 Bacteria 1523
183 Ga0207658_10057755 3300025986 Bacteria 2885
184 Ga0207703_10000128 3300026035 Bacteria 91359
185 Ga0207703_10000237 3300026035 Bacteria 62874
186 Ga0207703_11518816 3300026035 Bacteria 644
187 Ga0207639_10031439 3300026041 Bacteria 3902
188 Ga0207639_10109156 3300026041 Bacteria 2251
189 Ga0207678_10081698 3300026067 Bacteria 2766
190 Ga0207678_11915885 3300026067 Bacteria 517
191 Ga0207708_10105334 3300026075 Bacteria 2186
192 Ga0207708_10376523 3300026075 Bacteria 1170
193 Ga0207708_10401839 3300026075 Unclassified 1133
194 Ga0207702_10004618 3300026078 Bacteria 12202
195 Ga0207702_10009477 3300026078 Bacteria 8181
196 Ga0207641_10011355 3300026088 Bacteria 7310
197 Ga0207674_10588234 3300026116 Bacteria 1075
198 Ga0207675_100268526 3300026118 Bacteria 1655
199 Ga0207683_10004976 3300026121 Bacteria 11427
200 Ga0207698_10000009 3300026142 Bacteria 281300
201 Ga0207428_10531445 3300027907 Bacteria 852
202 Ga0268266_10000020 3300028379 Bacteria 527065
203 Ga0265337_1000126 3300028556 Bacteria 38633
204 Ga0265326_10000144 3300028558 Bacteria 37151
205 Ga0265322_10000009 3300028654 Bacteria 170768
206 Ga0265336_10001991 3300028666 Bacteria 8723
207 Ga0265324_10000389 3300029957 Bacteria 31898
208 Ga0265332_10009925 3300031238 Bacteria 4241
209 Ga0265328_10003668 3300031239 Bacteria 6766
210 Ga0265320_10000024 3300031240 Bacteria 170768
211 Ga0265329_10002956 3300031242 Bacteria 7560
212 Ga0265331_10000894 3300031250 Bacteria 24175
213 Ga0265327_10000227 3300031251 Bacteria 114777
214 Ga0307513_10200942 3300031456 Bacteria 1834
215 Ga0307408_101852647 3300031548 Unclassified 578
216 Ga0307408_102239780 3300031548 Bacteria 528
217 Ga0265313_10132788 3300031595 Unclassified 1077
218 Ga0265314_10000570 3300031711 Bacteria 46890
219 Ga0307405_10146923 3300031731 Bacteria 1653
220 Ga0307413_10579098 3300031824 Unclassified 915
221 Ga0307413_10631031 3300031824 Bacteria 881
222 Ga0307410_10013646 3300031852 Bacteria 4748
223 Ga0307410_10092719 3300031852 Bacteria 2148
224 Ga0307410_10903924 3300031852 Unclassified 756
225 Ga0307406_10017564 3300031901 Bacteria 4167
226 Ga0307406_10183620 3300031901 Unclassified 1525
227 Ga0307406_10193784 3300031901 Bacteria 1490
228 Ga0307407_10330819 3300031903 Unclassified 1072
229 Ga0307412_10237783 3300031911 Bacteria 1407
230 Ga0307409_100003787 3300031995 Bacteria 8327
231 Ga0307409_100105430 3300031995 Bacteria 2350
232 Ga0307409_100460327 3300031995 Bacteria 1230
233 Ga0307416_100043256 3300032002 Bacteria 3525
234 Ga0307416_100248201 3300032002 Bacteria 1730
235 Ga0307416_101376709 3300032002 Unclassified 811
236 Ga0307414_10203364 3300032004 Bacteria 1613
237 Ga0307414_10433424 3300032004 Bacteria 1149
238 Ga0307414_11032872 3300032004 Bacteria 757
239 Ga0307411_10035257 3300032005 Bacteria 3122
240 Ga0307415_100015759 3300032126 Bacteria 4486
241 Ga0307415_100086073 3300032126 Bacteria 2260
242 Ga0307415_100275111 3300032126 Bacteria 1381
243 Ga0307415_100417285 3300032126 Bacteria 1151
244 Ga0307415_101818131 3300032126 Bacteria 590
245 Ga0316583_10172192 3300032133 Bacteria 753
246 Ga0316583_10209663 3300032133 Bacteria 676
247 Ga0373934_0458073 3300035086 Bacteria 535
248 Ga0373955_0117970 3300035172 Bacteria 1540
249 Ga0316574_0260074 3300035398 Bacteria 1108
250 Ga0373937_0034652 3300036401 Bacteria 4592
251 Ga0373937_0694597 3300036401 Bacteria 964
252 Ga0395898_1627038 3300037466 Bacteria 570
253 Ga0316581_0050232 3300037588 Bacteria 1278
254 Ga0395901_1051708 3300038443 Unclassified 787
255 Ga0451791_1693705 3300041451 Bacteria 777
256 Ga0451807_2458407 3300041486 Bacteria 626
257 Ga0451849_0675551 3300041505 Bacteria 617
258 Ga0451849_0893674 3300041505 Bacteria 578
259 Ga0451853_1408135 3300041512 Bacteria 2024
260 Ga0451853_2463998 3300041512 Bacteria 674
261 Ga0466963_0000007 3300044694 Bacteria 79067
262 Ga0466963_0036775 3300044694 Bacteria 3194
263 Ga0466957_0000177 3300044842 Bacteria 28545
264 Ga0466957_0051133 3300044842 Bacteria 2515
265 Ga0466957_0162529 3300044842 Bacteria 1451
266 Ga0466960_0126099 3300044901 Bacteria 1346
267 Ga0466960_0610652 3300044901 Bacteria 648
268 Ga0466967_0000005 3300045976 Bacteria 149543
269 Ga0466967_0119892 3300045976 Bacteria 2429
270 Ga0466967_1791246 3300045976 Unclassified 611
271 Ga0495603_0000271 3300046455 Bacteria 27496
272 Ga0495603_0001209 3300046455 Bacteria 15085
273 Ga0495629_0009096 3300046459 Bacteria 7276
274 Ga0495629_0013866 3300046459 Bacteria 5815
275 Ga0495641_0000001 3300046461 Bacteria 485224
276 Ga0495651_0287192 3300046462 Bacteria 1109
277 Ga0495653_0031504 3300046463 Bacteria 4214
278 Ga0495582_0670165 3300046473 Bacteria 600
279 Ga0495662_0000519 3300046476 Bacteria 17584
280 Ga0495664_0183073 3300046477 Bacteria 1270
281 Ga0495584_0365696 3300046491 Bacteria 733
282 Ga0495596_0429441 3300046500 Bacteria 515
283 Ga0495608_0010249 3300046511 Bacteria 6540
284 Ga0495608_0284540 3300046511 Unclassified 1026
285 Ga0495616_0273196 3300046513 Bacteria 720
286 Ga0495620_0000747 3300046515 Bacteria 19970
287 Ga0495628_1063669 3300046516 Bacteria 554
288 Ga0495644_0000499 3300046523 Bacteria 16748
289 Ga0495663_0180621 3300046525 Bacteria 731
290 Ga0495586_0000537 3300046535 Bacteria 22120
291 Ga0495587_0012635 3300046536 Bacteria 5312
292 Ga0495598_0137730 3300046537 Unclassified 842
293 Ga0495609_0127648 3300046538 Bacteria 1091
294 Ga0495621_0000709 3300046539 Bacteria 8432
295 Ga0495645_0054401 3300046543 Bacteria 2908
296 Ga0495633_0556921 3300046558 Unclassified 516
297 Ga0495667_0000421 3300046559 Bacteria 27190
298 Ga0495656_0000196 3300046615 Bacteria 21672
299 Ga0495656_0830127 3300046615 Unclassified 500
300 Ga0495668_0397106 3300046616 Bacteria 758
301 Ga0495634_0001221 3300046642 Bacteria 23712
302 Ga0495634_0208160 3300046642 Bacteria 1212
303 Ga0495634_0238493 3300046642 Bacteria 1116
304 Ga0495646_0452025 3300046680 Bacteria 663
305 Ga0495658_0000438 3300046683 Bacteria 23210
306 Ga0495658_0692010 3300046683 Unclassified 653
307 Ga0495669_0000083 3300046684 Bacteria 62876
308 Ga0495669_0288540 3300046684 Bacteria 790
309 Ga0495613_0491745 3300046689 Unclassified 827
310 Ga0495613_1051659 3300046689 Unclassified 521
311 Ga0495670_0316295 3300046691 Bacteria 838
312 Ga0495649_0032859 3300046694 Bacteria 2857
313 Ga0495604_0000413 3300047317 Bacteria 38567
314 Ga0495676_0000752 3300047321 Bacteria 26996
315 Ga0495676_0001446 3300047321 Bacteria 20500
316 Ga0495676_0032711 3300047321 Bacteria 4387
317 Ga0495676_0295258 3300047321 Bacteria 1094
318 Ga0495680_0000599 3300047322 Bacteria 40585
319 Ga0495680_0003986 3300047322 Bacteria 14263
320 Ga0495680_0110150 3300047322 Bacteria 2041
321 Ga0495677_0392540 3300047445 Unclassified 549
322 Ga0495679_019372 3300047446 Bacteria 2392
323 Ga0495673_0089273 3300047469 Bacteria 1262
324 Ga0495593_0312083 3300047673 Unclassified 786
325 Ga0496100_0000007 3300048903 Bacteria 261266
326 Ga0496101_0000013 3300048904 Bacteria 261266
327 Ga0496102_0000045 3300048905 Bacteria 186726
328 Ga0496102_0274546 3300048905 Unclassified 1589
329 Ga0496103_0000050 3300048906 Bacteria 152034
330 Ga0496103_0198353 3300048906 Unclassified 1291
331 Ga0496104_0000002 3300048907 Bacteria 686017
332 Ga0496104_0000013 3300048907 Bacteria 397163
333 Ga0496104_1407458 3300048907 Unclassified 600
334 Ga0496105_0000001 3300048908 Bacteria 1328178
335 Ga0496105_0000006 3300048908 Bacteria 393578
336 Ga0496105_0034415 3300048908 Bacteria 4166
337 Ga0496106_0000006 3300048909 Bacteria 251855
338 Ga0496107_0000007 3300048910 Bacteria 257113
339 Ga0496107_0245994 3300048910 Bacteria 1331
340 Ga0496108_0000001 3300048911 Bacteria 919044
341 Ga0496108_0000094 3300048911 Bacteria 93075
342 Ga0496108_0001965 3300048911 Bacteria 16462
343 Ga0496108_0003686 3300048911 Bacteria 12290
344 Ga0496109_0000006 3300048912 Bacteria 325513
345 Ga0496109_0000024 3300048912 Bacteria 174723
346 Ga0496109_0000285 3300048912 Bacteria 48300
347 Ga0496109_0077493 3300048912 Bacteria 3059
348 Ga0496109_0127876 3300048912 Bacteria 2370
349 Ga0496109_0555261 3300048912 Bacteria 1083
350 Ga0496109_0726348 3300048912 Bacteria 931
351 Ga0496109_1488317 3300048912 Bacteria 612
352 Ga0496110_0000338 3300048913 Bacteria 31275
353 Ga0496110_0010361 3300048913 Bacteria 7579
354 Ga0496110_0501414 3300048913 Bacteria 1105
355 Ga0496110_0589678 3300048913 Bacteria 1009
356 Ga0496111_0000199 3300048914 Bacteria 27930
357 Ga0496111_0081106 3300048914 Bacteria 2368
358 Ga0496113_0028160 3300048916 Bacteria 4038
359 Ga0496114_0000003 3300048917 Bacteria 630981
360 Ga0496114_0116555 3300048917 Bacteria 2293
361 Ga0496114_1128978 3300048917 Bacteria 669
362 Ga0496115_0000071 3300048918 Bacteria 91922
363 Ga0496115_0000263 3300048918 Bacteria 46550
364 Ga0496119_0008717 3300048922 Bacteria 8853
365 Ga0496125_0031965 3300048928 Bacteria 4681
366 Ga0501031_0383098 3300049568 Bacteria 910
367 Ga0501032_0314907 3300049569 Bacteria 1011
368 Ga0501032_0554350 3300049569 Bacteria 733
369 Ga0501034_1222330 3300049571 Unclassified 630
370 Ga0501036_0076319 3300049572 Bacteria 2835
371 Ga0501036_0560689 3300049572 Unclassified 949
372 Ga0501036_1120145 3300049572 Bacteria 643
373 Ga0501038_0178453 3300049574 Bacteria 1715
374 Ga0501038_1254626 3300049574 Unclassified 536
375 Ga0501040_0313494 3300049576 Bacteria 1122
376 Ga0501040_0557388 3300049576 Unclassified 827
377 Ga0501041_0016687 3300049577 Bacteria 4370
378 Ga0501041_0090926 3300049577 Unclassified 1884
379 Ga0501041_0464795 3300049577 Bacteria 804
380 Ga0501042_0505592 3300049578 Unclassified 877
381 Ga0501042_0620470 3300049578 Unclassified 786
382 Ga0501042_0845259 3300049578 Bacteria 666
383 Ga0501043_1093640 3300049579 Bacteria 564
384 Ga0501046_0316812 3300049580 Bacteria 1137
385 Ga0501048_0064066 3300049582 Bacteria 2600
386 Ga0501048_1204304 3300049582 Bacteria 545
387 Ga0501067_0739723 3300049583 Bacteria 553
388 Ga0501068_0445988 3300049584 Unclassified 837
389 Ga0501068_0596304 3300049584 Bacteria 720
390 Ga0501071_0515863 3300049587 Bacteria 917
391 Ga0501071_1324083 3300049587 Bacteria 556
392 Ga0501072_0086064 3300049588 Bacteria 2494
393 Ga0501072_0205862 3300049588 Unclassified 1568
394 Ga0501073_0541682 3300049589 Bacteria 804
395 Ga0501073_1103951 3300049589 Unclassified 545
396 Ga0501075_0167775 3300049591 Bacteria 1675
397 Ga0501075_0249315 3300049591 Bacteria 1353
398 Ga0501075_0285466 3300049591 Bacteria 1257
399 Ga0501076_0104447 3300049592 Bacteria 2286
400 Ga0501076_0258419 3300049592 Bacteria 1426
401 Ga0501079_0511588 3300049741 Bacteria 944
402 Ga0501080_0335087 3300049742 Bacteria 1368
403 Ga0501080_1181302 3300049742 Bacteria 658
404 Ga0501081_0012935 3300049743 Bacteria 5491
405 Ga0501081_1048850 3300049743 Unclassified 616
406 Ga0501035_0759925 3300049822 Bacteria 777
407 Ga0501045_0071727 3300049824 Bacteria 2549
408 Ga0501045_0130160 3300049824 Bacteria 1871
409 nmdc:mga03n38_127354_c1 3300050490 Bacteria 1258
410 nmdc:mga00v17_368774_c1 3300050491 Bacteria 933
411 nmdc:mga00v17_795122_c1 3300050491 Bacteria 603
412 nmdc:mga0yw44_321694_c1 3300050492 Bacteria 1039
413 nmdc:mga0yw44_324946_c1 3300050492 Bacteria 1033
414 nmdc:mga0yw44_859725_c1 3300050492 Bacteria 615
415 nmdc:mga05p37_176910_c1 3300050507 Bacteria 2599
416 nmdc:mga05p37_2274_c1 3300050507 Bacteria 22394
417 nmdc:mga09592_250805_c1 3300050508 Bacteria 1534
418 nmdc:mga09592_46762_c1 3300050508 Bacteria 3645
419 nmdc:mga09592_8747_c1 3300050508 Bacteria 8239
420 nmdc:mga0qj67_16471_c1 3300050509 Bacteria 5608
421 nmdc:mga0qj67_22568_c1 3300050509 Bacteria 4834
422 nmdc:mga0qj67_29388_c1 3300050509 Bacteria 4269
423 nmdc:mga06r32_43951_c1 3300050510 Bacteria 4252
424 nmdc:mga06r32_581270_c1 3300050510 Unclassified 1092
425 nmdc:mga06r32_95021_c1 3300050510 Bacteria 2917
426 nmdc:mga08y16_1551619_c1 3300050511 Bacteria 621
427 nmdc:mga08y16_223384_c1 3300050511 Bacteria 1949
428 nmdc:mga08y16_439914_c1 3300050511 Bacteria 1331
429 nmdc:mga0n895_1032810_c1 3300050512 Bacteria 802
430 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
431 nmdc:mga0a205_2910_c1 3300050515 Bacteria 15147
432 Ga0495601_0000581 3300053077 Bacteria 19434
433 Ga0495601_0137921 3300053077 Bacteria 1590
434 Ga0495612_0001629 3300053078 Bacteria 9237
435 Ga0495655_0000004 3300053083 Bacteria 293683
436 Ga0495655_0000489 3300053083 Bacteria 6618
437 Ga0495619_0000042 3300053085 Bacteria 112453
438 Ga0495619_0000098 3300053085 Bacteria 64979
439 Ga0500566_0008381 3300053094 Bacteria 6112
440 Ga0500628_000004 3300053129 Bacteria 202098
441 Ga0501084_0538236 3300054114 Bacteria 987
442 Ga0501084_1111604 3300054114 Bacteria 663
443 Ga0501082_0054893 3300060353 Bacteria 3434
444 Ga0501082_0080314 3300060353 Bacteria 2814
445 Ga0501082_0779973 3300060353 Unclassified 836
446 Ga0530510_0009169 3300061734 Bacteria 6933
447 Ga0530510_0137350 3300061734 Bacteria 1800
448 Ga0530510_1406902 3300061734 Unclassified 535

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003373 JGI25407J50210_10003555 JGI25407J50210_100035552 95
2 3300005981 Ga0081538_10000656 Ga0081538_100006565 95
3 3300046500 Ga0495596_0429441 Ga0495596_0429441_103_462 101
4 3300006847 Ga0075431_100286216 Ga0075431_1002862162 102
5 3300006038 Ga0075365_10324571 Ga0075365_103245712 103
6 3300006051 Ga0075364_10988539 Ga0075364_109885392 103
7 3300006844 Ga0075428_100113370 Ga0075428_1001133702 103
8 3300006847 Ga0075431_100432516 Ga0075431_1004325162 103
9 3300006880 Ga0075429_100003590 Ga0075429_1000035907 103
10 3300009094 Ga0111539_10533244 Ga0111539_105332442 103
11 3300009147 Ga0114129_10221176 Ga0114129_102211762 103
12 3300009147 Ga0114129_10783838 Ga0114129_107838381 103
13 3300009553 Ga0105249_12135415 Ga0105249_121354152 103
14 3300025961 Ga0207712_11939068 Ga0207712_119390681 103
15 3300027907 Ga0207428_10531445 Ga0207428_105314452 103
16 3300035172 Ga0373955_0117970 Ga0373955_0117970_13_324 103
17 3300049578 Ga0501042_0620470 Ga0501042_0620470_54_368 103
18 3300049583 Ga0501067_0739723 Ga0501067_0739723_128_442 103
19 3300050491 nmdc:mga00v17_795122_c1 nmdc:mga00v17_795122_c1_159_473 103
20 3300050492 nmdc:mga0yw44_324946_c1 nmdc:mga0yw44_324946_c1_330_644 103
21 3300050507 nmdc:mga05p37_176910_c1 nmdc:mga05p37_176910_c1_1852_2166 103
22 3300050508 nmdc:mga09592_46762_c1 nmdc:mga09592_46762_c1_1445_1810 103
23 3300050509 nmdc:mga0qj67_16471_c1 nmdc:mga0qj67_16471_c1_943_1308 103
24 3300050510 nmdc:mga06r32_95021_c1 nmdc:mga06r32_95021_c1_842_1207 103
25 3300050511 nmdc:mga08y16_439914_c1 nmdc:mga08y16_439914_c1_381_695 103
26 3300054114 Ga0501084_0538236 Ga0501084_0538236_508_822 103
27 3300005344 Ga0070661_100000116 Ga0070661_10000011632 105
28 3300025920 Ga0207649_10000005 Ga0207649_10000005117 105
29 3300031548 Ga0307408_101852647 Ga0307408_1018526472 106
30 3300031824 Ga0307413_10579098 Ga0307413_105790981 106
31 3300031852 Ga0307410_10013646 Ga0307410_100136467 106
32 3300031852 Ga0307410_10903924 Ga0307410_109039242 106
33 3300032004 Ga0307414_11032872 Ga0307414_110328722 106
34 3300032126 Ga0307415_100275111 Ga0307415_1002751112 106
35 3300003373 JGI25407J50210_10072183 JGI25407J50210_100721831 107
36 3300005981 Ga0081538_10001069 Ga0081538_1000106920 107
37 3300005981 Ga0081538_10001141 Ga0081538_100011413 107
38 3300013297 Ga0157378_10042780 Ga0157378_100427804 107
39 3300005544 Ga0070686_101772627 Ga0070686_1017726272 108
40 3300005549 Ga0070704_101076059 Ga0070704_1010760592 108
41 3300009098 Ga0105245_10727283 Ga0105245_107272832 108
42 3300009174 Ga0105241_12193735 Ga0105241_121937351 108
43 3300009176 Ga0105242_10299352 Ga0105242_102993521 108
44 3300009553 Ga0105249_10830236 Ga0105249_108302362 108
45 3300025927 Ga0207687_10812948 Ga0207687_108129482 108
46 3300026067 Ga0207678_11915885 Ga0207678_119158852 108
47 3300048906 Ga0496103_0198353 Ga0496103_0198353_420_773 108
48 3300005456 Ga0070678_100001532 Ga0070678_1000015329 110
49 3300005937 Ga0081455_10010452 Ga0081455_1001045211 111
50 3300005981 Ga0081538_10000225 Ga0081538_1000022557 111
51 3300048912 Ga0496109_0726348 Ga0496109_0726348_292_630 111
52 3300049584 Ga0501068_0596304 Ga0501068_0596304_172_513 111
53 3300005981 Ga0081538_10105151 Ga0081538_101051512 112
54 3300005981 Ga0081538_10204785 Ga0081538_102047852 112
55 3300049572 Ga0501036_1120145 Ga0501036_1120145_198_545 112
56 3300049574 Ga0501038_0178453 Ga0501038_0178453_1229_1576 112
57 3300049577 Ga0501041_0090926 Ga0501041_0090926_1191_1538 112
58 3300049579 Ga0501043_1093640 Ga0501043_1093640_56_403 112
59 3300049580 Ga0501046_0316812 Ga0501046_0316812_228_575 112
60 3300049588 Ga0501072_0205862 Ga0501072_0205862_502_849 112
61 3300049743 Ga0501081_0012935 Ga0501081_0012935_4634_4981 112
62 3300049822 Ga0501035_0759925 Ga0501035_0759925_250_597 112
63 3300049824 Ga0501045_0071727 Ga0501045_0071727_1993_2340 112
64 3300054114 Ga0501084_1111604 Ga0501084_1111604_112_459 112
65 3300060353 Ga0501082_0080314 Ga0501082_0080314_2423_2770 112
66 3300061734 Ga0530510_0009169 Ga0530510_0009169_6463_6810 112
67 3300005985 Ga0081539_10195210 Ga0081539_101952102 113
68 3300009147 Ga0114129_11199854 Ga0114129_111998542 113
69 3300031901 Ga0307406_10017564 Ga0307406_100175641 113
70 3300031911 Ga0307412_10237783 Ga0307412_102377832 113
71 3300032002 Ga0307416_101376709 Ga0307416_1013767091 113
72 3300032005 Ga0307411_10035257 Ga0307411_100352571 113
73 3300032126 Ga0307415_100086073 Ga0307415_1000860732 113
74 3300032133 Ga0316583_10172192 Ga0316583_101721922 113
75 3300035398 Ga0316574_0260074 Ga0316574_0260074_510_854 113
76 3300037588 Ga0316581_0050232 Ga0316581_0050232_701_1045 113
77 3300045976 Ga0466967_1791246 Ga0466967_1791246_193_540 113
78 3300046558 Ga0495633_0556921 Ga0495633_0556921_156_500 113
79 3300049569 Ga0501032_0554350 Ga0501032_0554350_134_493 113
80 3300049571 Ga0501034_1222330 Ga0501034_1222330_131_475 113
81 3300049574 Ga0501038_1254626 Ga0501038_1254626_99_458 113
82 3300049578 Ga0501042_0845259 Ga0501042_0845259_281_640 113
83 3300049591 Ga0501075_0249315 Ga0501075_0249315_105_464 113
84 3300049741 Ga0501079_0511588 Ga0501079_0511588_223_582 113
85 3300049742 Ga0501080_1181302 Ga0501080_1181302_238_597 113
86 3300005440 Ga0070705_100555312 Ga0070705_1005553122 114
87 3300005456 Ga0070678_100036225 Ga0070678_1000362253 114
88 3300005718 Ga0068866_11239830 Ga0068866_112398301 114
89 3300005985 Ga0081539_10002515 Ga0081539_1000251529 114
90 3300006051 Ga0075364_10266311 Ga0075364_102663112 114
91 3300006844 Ga0075428_100417263 Ga0075428_1004172632 114
92 3300006846 Ga0075430_100250974 Ga0075430_1002509742 114
93 3300006847 Ga0075431_100029806 Ga0075431_1000298065 114
94 3300006847 Ga0075431_100052790 Ga0075431_1000527902 114
95 3300009553 Ga0105249_10207229 Ga0105249_102072292 114
96 3300041451 Ga0451791_1693705 Ga0451791_1693705_190_537 114
97 3300041505 Ga0451849_0675551 Ga0451849_0675551_227_574 114
98 3300046459 Ga0495629_0009096 Ga0495629_0009096_5022_5369 114
99 3300046463 Ga0495653_0031504 Ga0495653_0031504_2597_2944 114
100 3300047321 Ga0495676_0032711 Ga0495676_0032711_2463_2810 114
101 3300048910 Ga0496107_0245994 Ga0496107_0245994_504_851 114
102 3300048912 Ga0496109_0555261 Ga0496109_0555261_574_921 114
103 3300048913 Ga0496110_0501414 Ga0496110_0501414_196_543 114
104 3300048913 Ga0496110_0589678 Ga0496110_0589678_491_838 114
105 3300048914 Ga0496111_0081106 Ga0496111_0081106_1849_2196 114
106 3300048917 Ga0496114_1128978 Ga0496114_1128978_70_417 114
107 3300049576 Ga0501040_0313494 Ga0501040_0313494_168_512 114
108 3300049577 Ga0501041_0464795 Ga0501041_0464795_101_445 114
109 3300049582 Ga0501048_1204304 Ga0501048_1204304_30_380 114
110 3300050490 nmdc:mga03n38_127354_c1 nmdc:mga03n38_127354_c1_247_594 114
111 3300050510 nmdc:mga06r32_43951_c1 nmdc:mga06r32_43951_c1_2357_2701 114
112 3300050511 nmdc:mga08y16_1551619_c1 nmdc:mga08y16_1551619_c1_245_592 114
113 3300053077 Ga0495601_0137921 Ga0495601_0137921_521_868 114
114 3300002074 JGI24748J21848_1000424 JGI24748J21848_10004247 115
115 3300002239 JGI24034J26672_10000864 JGI24034J26672_100008642 115
116 3300002244 JGI24742J22300_10001949 JGI24742J22300_100019493 115
117 3300005328 Ga0070676_10443795 Ga0070676_104437951 115
118 3300005329 Ga0070683_100006125 Ga0070683_10000612511 115
119 3300005333 Ga0070677_10000163 Ga0070677_1000016318 115
120 3300005333 Ga0070677_10910541 Ga0070677_109105411 115
121 3300005337 Ga0070682_100000077 Ga0070682_10000007723 115
122 3300005337 Ga0070682_100193627 Ga0070682_1001936272 115
123 3300005340 Ga0070689_100075918 Ga0070689_1000759183 115
124 3300005345 Ga0070692_10743780 Ga0070692_107437802 115
125 3300005347 Ga0070668_100892596 Ga0070668_1008925962 115
126 3300005365 Ga0070688_100151527 Ga0070688_1001515273 115
127 3300005366 Ga0070659_100009046 Ga0070659_1000090467 115
128 3300005367 Ga0070667_100085406 Ga0070667_1000854063 115
129 3300005441 Ga0070700_100252279 Ga0070700_1002522792 115
130 3300005444 Ga0070694_100622786 Ga0070694_1006227862 115
131 3300005455 Ga0070663_100099405 Ga0070663_1000994052 115
132 3300005458 Ga0070681_10033752 Ga0070681_100337524 115
133 3300005459 Ga0068867_100671961 Ga0068867_1006719612 115
134 3300005466 Ga0070685_10001592 Ga0070685_1000159214 115
135 3300005466 Ga0070685_10275582 Ga0070685_102755823 115
136 3300005471 Ga0070698_101646735 Ga0070698_1016467351 115
137 3300005530 Ga0070679_100000487 Ga0070679_10000048723 115
138 3300005535 Ga0070684_100017747 Ga0070684_1000177476 115
139 3300005535 Ga0070684_100031509 Ga0070684_1000315092 115
140 3300005535 Ga0070684_100108093 Ga0070684_1001080933 115
141 3300005539 Ga0068853_100004202 Ga0068853_10000420212 115
142 3300005539 Ga0068853_100077288 Ga0068853_1000772884 115
143 3300005543 Ga0070672_100008239 Ga0070672_1000082395 115
144 3300005545 Ga0070695_100036840 Ga0070695_1000368404 115
145 3300005548 Ga0070665_100000341 Ga0070665_10000034144 115
146 3300005564 Ga0070664_100075757 Ga0070664_1000757575 115
147 3300005578 Ga0068854_100104593 Ga0068854_1001045934 115
148 3300005614 Ga0068856_100011212 Ga0068856_1000112123 115
149 3300005614 Ga0068856_100100573 Ga0068856_1001005735 115
150 3300005614 Ga0068856_100324905 Ga0068856_1003249051 115
151 3300005614 Ga0068856_101085585 Ga0068856_1010855852 115
152 3300005615 Ga0070702_100114066 Ga0070702_1001140662 115
153 3300005616 Ga0068852_100311262 Ga0068852_1003112622 115
154 3300005718 Ga0068866_10033436 Ga0068866_100334363 115
155 3300005719 Ga0068861_100210122 Ga0068861_1002101224 115
156 3300005719 Ga0068861_100931126 Ga0068861_1009311261 115
157 3300005834 Ga0068851_10000248 Ga0068851_1000024823 115
158 3300005834 Ga0068851_10240210 Ga0068851_102402102 115
159 3300005841 Ga0068863_100055760 Ga0068863_1000557605 115
160 3300005842 Ga0068858_100000088 Ga0068858_10000008846 115
161 3300005842 Ga0068858_100000251 Ga0068858_10000025114 115
162 3300005981 Ga0081538_10002516 Ga0081538_1000251616 115
163 3300005985 Ga0081539_10025600 Ga0081539_100256006 115
164 3300006038 Ga0075365_10001514 Ga0075365_100015143 115
165 3300006038 Ga0075365_10954997 Ga0075365_109549972 115
166 3300006051 Ga0075364_10020834 Ga0075364_100208343 115
167 3300006175 Ga0070712_100000339 Ga0070712_10000033915 115
168 3300006237 Ga0097621_102083625 Ga0097621_1020836252 115
169 3300006358 Ga0068871_100226848 Ga0068871_1002268484 115
170 3300006844 Ga0075428_100134290 Ga0075428_1001342904 115
171 3300006844 Ga0075428_101215411 Ga0075428_1012154111 115
172 3300006846 Ga0075430_100211300 Ga0075430_1002113002 115
173 3300006846 Ga0075430_100473258 Ga0075430_1004732584 115
174 3300006847 Ga0075431_100032360 Ga0075431_1000323603 115
175 3300006852 Ga0075433_10000057 Ga0075433_1000005736 115
176 3300006852 Ga0075433_11738839 Ga0075433_117388391 115
177 3300006880 Ga0075429_100017950 Ga0075429_1000179506 115
178 3300006881 Ga0068865_100000019 Ga0068865_10000001960 115
179 3300009093 Ga0105240_10422842 Ga0105240_104228423 115
180 3300009094 Ga0111539_10457430 Ga0111539_104574302 115
181 3300009094 Ga0111539_11343820 Ga0111539_113438202 115
182 3300009094 Ga0111539_11976015 Ga0111539_119760152 115
183 3300009094 Ga0111539_12415713 Ga0111539_124157131 115
184 3300009098 Ga0105245_10000151 Ga0105245_1000015132 115
185 3300009098 Ga0105245_10009133 Ga0105245_100091339 115
186 3300009098 Ga0105245_10012189 Ga0105245_100121892 115
187 3300009098 Ga0105245_10144075 Ga0105245_101440752 115
188 3300009098 Ga0105245_10659415 Ga0105245_106594152 115
189 3300009101 Ga0105247_10000204 Ga0105247_1000020434 115
190 3300009101 Ga0105247_10008346 Ga0105247_100083467 115
191 3300009147 Ga0114129_10002947 Ga0114129_100029477 115
192 3300009147 Ga0114129_10371251 Ga0114129_103712514 115
193 3300009147 Ga0114129_11663623 Ga0114129_116636232 115
194 3300009147 Ga0114129_12649136 Ga0114129_126491362 115
195 3300009176 Ga0105242_10000104 Ga0105242_1000010447 115
196 3300009177 Ga0105248_10000126 Ga0105248_1000012654 115
197 3300009545 Ga0105237_10359668 Ga0105237_103596682 115
198 3300009545 Ga0105237_10807538 Ga0105237_108075382 115
199 3300009551 Ga0105238_10000172 Ga0105238_1000017251 115
200 3300009553 Ga0105249_10000371 Ga0105249_1000037117 115
201 3300010375 Ga0105239_10161746 Ga0105239_101617463 115
202 3300010375 Ga0105239_10285209 Ga0105239_102852091 115
203 3300010375 Ga0105239_13233133 Ga0105239_132331332 115
204 3300011119 Ga0105246_10207411 Ga0105246_102074113 115
205 3300012515 Ga0157338_1055693 Ga0157338_10556931 115
206 3300013102 Ga0157371_10000909 Ga0157371_1000090919 115
207 3300013104 Ga0157370_10007913 Ga0157370_100079136 115
208 3300013104 Ga0157370_10029815 Ga0157370_100298156 115
209 3300013105 Ga0157369_10000135 Ga0157369_1000013581 115
210 3300013296 Ga0157374_10132308 Ga0157374_101323084 115
211 3300013306 Ga0163162_10030535 Ga0163162_100305352 115
212 3300013308 Ga0157375_10001783 Ga0157375_100017832 115
213 3300013308 Ga0157375_10006973 Ga0157375_100069738 115
214 3300014325 Ga0163163_10310888 Ga0163163_103108882 115
215 3300014497 Ga0182008_10605085 Ga0182008_106050852 115
216 3300014968 Ga0157379_10006279 Ga0157379_100062799 115
217 3300017792 Ga0163161_10040024 Ga0163161_100400244 115
218 3300025321 Ga0207656_10000105 Ga0207656_1000010519 115
219 3300025321 Ga0207656_10398386 Ga0207656_103983862 115
220 3300025893 Ga0207682_10003413 Ga0207682_100034134 115
221 3300025893 Ga0207682_10607670 Ga0207682_106076701 115
222 3300025899 Ga0207642_10020194 Ga0207642_100201944 115
223 3300025900 Ga0207710_10000457 Ga0207710_1000045718 115
224 3300025908 Ga0207643_10074924 Ga0207643_100749243 115
225 3300025909 Ga0207705_10279905 Ga0207705_102799053 115
226 3300025912 Ga0207707_10023070 Ga0207707_100230704 115
227 3300025913 Ga0207695_10243373 Ga0207695_102433733 115
228 3300025914 Ga0207671_10271497 Ga0207671_102714972 115
229 3300025915 Ga0207693_10002524 Ga0207693_1000252416 115
230 3300025921 Ga0207652_10000658 Ga0207652_1000065823 115
231 3300025924 Ga0207694_10000004 Ga0207694_10000004935 115
232 3300025927 Ga0207687_10000037 Ga0207687_1000003755 115
233 3300025927 Ga0207687_10000167 Ga0207687_1000016746 115
234 3300025927 Ga0207687_10004633 Ga0207687_1000463311 115
235 3300025927 Ga0207687_10496179 Ga0207687_104961792 115
236 3300025932 Ga0207690_10052909 Ga0207690_100529092 115
237 3300025932 Ga0207690_10350217 Ga0207690_103502171 115
238 3300025934 Ga0207686_10000063 Ga0207686_1000006333 115
239 3300025936 Ga0207670_10238103 Ga0207670_102381033 115
240 3300025938 Ga0207704_10000009 Ga0207704_1000000930 115
241 3300025938 Ga0207704_11537124 Ga0207704_115371241 115
242 3300025940 Ga0207691_10043696 Ga0207691_100436965 115
243 3300025941 Ga0207711_10000024 Ga0207711_10000024166 115
244 3300025944 Ga0207661_10003140 Ga0207661_1000314010 115
245 3300025944 Ga0207661_10004159 Ga0207661_100041598 115
246 3300025944 Ga0207661_10004202 Ga0207661_1000420211 115
247 3300025945 Ga0207679_10056661 Ga0207679_100566615 115
248 3300025961 Ga0207712_10000037 Ga0207712_10000037161 115
249 3300025972 Ga0207668_10350188 Ga0207668_103501882 115
250 3300025972 Ga0207668_10619670 Ga0207668_106196703 115
251 3300025972 Ga0207668_11864915 Ga0207668_118649152 115
252 3300025981 Ga0207640_10197106 Ga0207640_101971064 115
253 3300025986 Ga0207658_10057755 Ga0207658_100577554 115
254 3300026035 Ga0207703_10000128 Ga0207703_1000012839 115
255 3300026035 Ga0207703_10000237 Ga0207703_1000023760 115
256 3300026035 Ga0207703_11518816 Ga0207703_115188162 115
257 3300026041 Ga0207639_10031439 Ga0207639_100314392 115
258 3300026041 Ga0207639_10109156 Ga0207639_101091564 115
259 3300026067 Ga0207678_10081698 Ga0207678_100816983 115
260 3300026075 Ga0207708_10105334 Ga0207708_101053344 115
261 3300026075 Ga0207708_10376523 Ga0207708_103765232 115
262 3300026075 Ga0207708_10401839 Ga0207708_104018392 115
263 3300026078 Ga0207702_10004618 Ga0207702_1000461811 115
264 3300026078 Ga0207702_10009477 Ga0207702_1000947712 115
265 3300026088 Ga0207641_10011355 Ga0207641_100113554 115
266 3300026116 Ga0207674_10588234 Ga0207674_105882343 115
267 3300026118 Ga0207675_100268526 Ga0207675_1002685264 115
268 3300026121 Ga0207683_10004976 Ga0207683_1000497615 115
269 3300026142 Ga0207698_10000009 Ga0207698_1000000912 115
270 3300028379 Ga0268266_10000020 Ga0268266_10000020421 115
271 3300028556 Ga0265337_1000126 Ga0265337_10001263 115
272 3300028558 Ga0265326_10000144 Ga0265326_1000014437 115
273 3300028654 Ga0265322_10000009 Ga0265322_1000000978 115
274 3300028666 Ga0265336_10001991 Ga0265336_100019913 115
275 3300029957 Ga0265324_10000389 Ga0265324_1000038912 115
276 3300031238 Ga0265332_10009925 Ga0265332_100099254 115
277 3300031239 Ga0265328_10003668 Ga0265328_100036684 115
278 3300031240 Ga0265320_10000024 Ga0265320_1000002497 115
279 3300031242 Ga0265329_10002956 Ga0265329_100029564 115
280 3300031250 Ga0265331_10000894 Ga0265331_100008944 115
281 3300031251 Ga0265327_10000227 Ga0265327_1000022798 115
282 3300031456 Ga0307513_10200942 Ga0307513_102009422 115
283 3300031548 Ga0307408_102239780 Ga0307408_1022397801 115
284 3300031595 Ga0265313_10132788 Ga0265313_101327883 115
285 3300031711 Ga0265314_10000570 Ga0265314_1000057038 115
286 3300031731 Ga0307405_10146923 Ga0307405_101469232 115
287 3300031824 Ga0307413_10631031 Ga0307413_106310312 115
288 3300031852 Ga0307410_10092719 Ga0307410_100927192 115
289 3300031901 Ga0307406_10183620 Ga0307406_101836201 115
290 3300031901 Ga0307406_10193784 Ga0307406_101937842 115
291 3300031903 Ga0307407_10330819 Ga0307407_103308192 115
292 3300031995 Ga0307409_100003787 Ga0307409_1000037872 115
293 3300031995 Ga0307409_100105430 Ga0307409_1001054303 115
294 3300031995 Ga0307409_100460327 Ga0307409_1004603272 115
295 3300032002 Ga0307416_100043256 Ga0307416_1000432563 115
296 3300032002 Ga0307416_100248201 Ga0307416_1002482012 115
297 3300032004 Ga0307414_10203364 Ga0307414_102033642 115
298 3300032004 Ga0307414_10433424 Ga0307414_104334242 115
299 3300032126 Ga0307415_100015759 Ga0307415_1000157592 115
300 3300032126 Ga0307415_100417285 Ga0307415_1004172852 115
301 3300032126 Ga0307415_101818131 Ga0307415_1018181312 115
302 3300032133 Ga0316583_10209663 Ga0316583_102096632 115
303 3300035086 Ga0373934_0458073 Ga0373934_0458073_174_521 115
304 3300036401 Ga0373937_0034652 Ga0373937_0034652_2991_3338 115
305 3300036401 Ga0373937_0694597 Ga0373937_0694597_434_781 115
306 3300037466 Ga0395898_1627038 Ga0395898_1627038_25_384 115
307 3300038443 Ga0395901_1051708 Ga0395901_1051708_120_476 115
308 3300041486 Ga0451807_2458407 Ga0451807_2458407_87_437 115
309 3300041505 Ga0451849_0893674 Ga0451849_0893674_125_475 115
310 3300041512 Ga0451853_1408135 Ga0451853_1408135_1354_1701 115
311 3300041512 Ga0451853_2463998 Ga0451853_2463998_160_522 115
312 3300044694 Ga0466963_0000007 Ga0466963_0000007_53240_53587 115
313 3300044694 Ga0466963_0036775 Ga0466963_0036775_2115_2465 115
314 3300044842 Ga0466957_0000177 Ga0466957_0000177_17083_17433 115
315 3300044842 Ga0466957_0051133 Ga0466957_0051133_731_1081 115
316 3300044842 Ga0466957_0162529 Ga0466957_0162529_641_991 115
317 3300044901 Ga0466960_0126099 Ga0466960_0126099_519_878 115
318 3300044901 Ga0466960_0610652 Ga0466960_0610652_10_369 115
319 3300045976 Ga0466967_0000005 Ga0466967_0000005_73680_74030 115
320 3300045976 Ga0466967_0119892 Ga0466967_0119892_1067_1426 115
321 3300046455 Ga0495603_0000271 Ga0495603_0000271_7717_8070 115
322 3300046455 Ga0495603_0001209 Ga0495603_0001209_7003_7350 115
323 3300046459 Ga0495629_0013866 Ga0495629_0013866_1211_1561 115
324 3300046461 Ga0495641_0000001 Ga0495641_0000001_478904_479251 115
325 3300046462 Ga0495651_0287192 Ga0495651_0287192_689_1039 115
326 3300046473 Ga0495582_0670165 Ga0495582_0670165_164_514 115
327 3300046476 Ga0495662_0000519 Ga0495662_0000519_10600_10950 115
328 3300046477 Ga0495664_0183073 Ga0495664_0183073_477_827 115
329 3300046491 Ga0495584_0365696 Ga0495584_0365696_16_372 115
330 3300046511 Ga0495608_0010249 Ga0495608_0010249_338_685 115
331 3300046511 Ga0495608_0284540 Ga0495608_0284540_567_914 115
332 3300046513 Ga0495616_0273196 Ga0495616_0273196_41_397 115
333 3300046515 Ga0495620_0000747 Ga0495620_0000747_12342_12689 115
334 3300046516 Ga0495628_1063669 Ga0495628_1063669_84_431 115
335 3300046523 Ga0495644_0000499 Ga0495644_0000499_11986_12336 115
336 3300046525 Ga0495663_0180621 Ga0495663_0180621_147_503 115
337 3300046535 Ga0495586_0000537 Ga0495586_0000537_16365_16712 115
338 3300046536 Ga0495587_0012635 Ga0495587_0012635_4678_5028 115
339 3300046537 Ga0495598_0137730 Ga0495598_0137730_106_462 115
340 3300046538 Ga0495609_0127648 Ga0495609_0127648_414_770 115
341 3300046539 Ga0495621_0000709 Ga0495621_0000709_737_1084 115
342 3300046543 Ga0495645_0054401 Ga0495645_0054401_82_429 115
343 3300046559 Ga0495667_0000421 Ga0495667_0000421_26633_26983 115
344 3300046615 Ga0495656_0000196 Ga0495656_0000196_2414_2761 115
345 3300046615 Ga0495656_0830127 Ga0495656_0830127_64_423 115
346 3300046616 Ga0495668_0397106 Ga0495668_0397106_168_524 115
347 3300046642 Ga0495634_0001221 Ga0495634_0001221_8096_8443 115
348 3300046642 Ga0495634_0208160 Ga0495634_0208160_235_582 115
349 3300046642 Ga0495634_0238493 Ga0495634_0238493_236_583 115
350 3300046680 Ga0495646_0452025 Ga0495646_0452025_162_512 115
351 3300046683 Ga0495658_0000438 Ga0495658_0000438_18720_19070 115
352 3300046683 Ga0495658_0692010 Ga0495658_0692010_200_553 115
353 3300046684 Ga0495669_0000083 Ga0495669_0000083_40108_40455 115
354 3300046684 Ga0495669_0288540 Ga0495669_0288540_321_671 115
355 3300046689 Ga0495613_0491745 Ga0495613_0491745_37_390 115
356 3300046689 Ga0495613_1051659 Ga0495613_1051659_124_471 115
357 3300046691 Ga0495670_0316295 Ga0495670_0316295_248_607 115
358 3300046694 Ga0495649_0032859 Ga0495649_0032859_305_652 115
359 3300047317 Ga0495604_0000413 Ga0495604_0000413_14218_14565 115
360 3300047321 Ga0495676_0000752 Ga0495676_0000752_15220_15570 115
361 3300047321 Ga0495676_0001446 Ga0495676_0001446_17691_18038 115
362 3300047321 Ga0495676_0295258 Ga0495676_0295258_516_869 115
363 3300047322 Ga0495680_0000599 Ga0495680_0000599_22180_22527 115
364 3300047322 Ga0495680_0003986 Ga0495680_0003986_136_486 115
365 3300047322 Ga0495680_0110150 Ga0495680_0110150_358_708 115
366 3300047445 Ga0495677_0392540 Ga0495677_0392540_68_427 115
367 3300047446 Ga0495679_019372 Ga0495679_019372_63_410 115
368 3300047469 Ga0495673_0089273 Ga0495673_0089273_542_892 115
369 3300047673 Ga0495593_0312083 Ga0495593_0312083_50_400 115
370 3300048903 Ga0496100_0000007 Ga0496100_0000007_234788_235135 115
371 3300048904 Ga0496101_0000013 Ga0496101_0000013_234788_235135 115
372 3300048905 Ga0496102_0000045 Ga0496102_0000045_30523_30873 115
373 3300048905 Ga0496102_0274546 Ga0496102_0274546_581_931 115
374 3300048906 Ga0496103_0000050 Ga0496103_0000050_121160_121510 115
375 3300048907 Ga0496104_0000002 Ga0496104_0000002_423010_423360 115
376 3300048907 Ga0496104_0000013 Ga0496104_0000013_26222_26599 115
377 3300048907 Ga0496104_1407458 Ga0496104_1407458_118_465 115
378 3300048908 Ga0496105_0000001 Ga0496105_0000001_904819_905169 115
379 3300048908 Ga0496105_0000006 Ga0496105_0000006_370565_370942 115
380 3300048908 Ga0496105_0034415 Ga0496105_0034415_2262_2609 115
381 3300048909 Ga0496106_0000006 Ga0496106_0000006_228927_229274 115
382 3300048910 Ga0496107_0000007 Ga0496107_0000007_228929_229276 115
383 3300048911 Ga0496108_0000001 Ga0496108_0000001_37875_38222 115
384 3300048911 Ga0496108_0000094 Ga0496108_0000094_54346_54696 115
385 3300048911 Ga0496108_0001965 Ga0496108_0001965_13883_14233 115
386 3300048911 Ga0496108_0003686 Ga0496108_0003686_5631_5978 115
387 3300048912 Ga0496109_0000006 Ga0496109_0000006_37875_38222 115
388 3300048912 Ga0496109_0000024 Ga0496109_0000024_156486_156836 115
389 3300048912 Ga0496109_0000285 Ga0496109_0000285_5669_6016 115
390 3300048912 Ga0496109_0077493 Ga0496109_0077493_57_407 115
391 3300048912 Ga0496109_0127876 Ga0496109_0127876_1245_1607 115
392 3300048912 Ga0496109_1488317 Ga0496109_1488317_108_458 115
393 3300048913 Ga0496110_0000338 Ga0496110_0000338_11908_12258 115
394 3300048913 Ga0496110_0010361 Ga0496110_0010361_6277_6624 115
395 3300048914 Ga0496111_0000199 Ga0496111_0000199_15812_16162 115
396 3300048916 Ga0496113_0028160 Ga0496113_0028160_2196_2543 115
397 3300048917 Ga0496114_0000003 Ga0496114_0000003_89764_90114 115
398 3300048917 Ga0496114_0116555 Ga0496114_0116555_848_1195 115
399 3300048918 Ga0496115_0000071 Ga0496115_0000071_34178_34528 115
400 3300048918 Ga0496115_0000263 Ga0496115_0000263_29312_29662 115
401 3300048922 Ga0496119_0008717 Ga0496119_0008717_7654_8004 115
402 3300048928 Ga0496125_0031965 Ga0496125_0031965_4191_4538 115
403 3300049568 Ga0501031_0383098 Ga0501031_0383098_456_815 115
404 3300049569 Ga0501032_0314907 Ga0501032_0314907_88_447 115
405 3300049572 Ga0501036_0076319 Ga0501036_0076319_1913_2272 115
406 3300049572 Ga0501036_0560689 Ga0501036_0560689_33_386 115
407 3300049576 Ga0501040_0557388 Ga0501040_0557388_61_420 115
408 3300049577 Ga0501041_0016687 Ga0501041_0016687_1709_2068 115
409 3300049578 Ga0501042_0505592 Ga0501042_0505592_249_608 115
410 3300049582 Ga0501048_0064066 Ga0501048_0064066_213_575 115
411 3300049584 Ga0501068_0445988 Ga0501068_0445988_309_659 115
412 3300049587 Ga0501071_0515863 Ga0501071_0515863_493_840 115
413 3300049587 Ga0501071_1324083 Ga0501071_1324083_73_432 115
414 3300049588 Ga0501072_0086064 Ga0501072_0086064_381_740 115
415 3300049589 Ga0501073_0541682 Ga0501073_0541682_94_444 115
416 3300049589 Ga0501073_1103951 Ga0501073_1103951_121_474 115
417 3300049591 Ga0501075_0167775 Ga0501075_0167775_55_402 115
418 3300049591 Ga0501075_0285466 Ga0501075_0285466_206_565 115
419 3300049592 Ga0501076_0104447 Ga0501076_0104447_339_698 115
420 3300049592 Ga0501076_0258419 Ga0501076_0258419_314_667 115
421 3300049742 Ga0501080_0335087 Ga0501080_0335087_628_987 115
422 3300049743 Ga0501081_1048850 Ga0501081_1048850_207_557 115
423 3300049824 Ga0501045_0130160 Ga0501045_0130160_584_943 115
424 3300050491 nmdc:mga00v17_368774_c1 nmdc:mga00v17_368774_c1_126_485 115
425 3300050492 nmdc:mga0yw44_321694_c1 nmdc:mga0yw44_321694_c1_288_638 115
426 3300050492 nmdc:mga0yw44_859725_c1 nmdc:mga0yw44_859725_c1_179_538 115
427 3300050507 nmdc:mga05p37_2274_c1 nmdc:mga05p37_2274_c1_1073_1438 115
428 3300050508 nmdc:mga09592_250805_c1 nmdc:mga09592_250805_c1_1138_1494 115
429 3300050508 nmdc:mga09592_8747_c1 nmdc:mga09592_8747_c1_3843_4208 115
430 3300050509 nmdc:mga0qj67_22568_c1 nmdc:mga0qj67_22568_c1_2745_3110 115
431 3300050509 nmdc:mga0qj67_29388_c1 nmdc:mga0qj67_29388_c1_3681_4031 115
432 3300050510 nmdc:mga06r32_581270_c1 nmdc:mga06r32_581270_c1_372_728 115
433 3300050511 nmdc:mga08y16_223384_c1 nmdc:mga08y16_223384_c1_653_1009 115
434 3300050512 nmdc:mga0n895_1032810_c1 nmdc:mga0n895_1032810_c1_36_383 115
435 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_131056_131403 115
436 3300050515 nmdc:mga0a205_2910_c1 nmdc:mga0a205_2910_c1_12528_12875 115
437 3300053077 Ga0495601_0000581 Ga0495601_0000581_16891_17238 115
438 3300053078 Ga0495612_0001629 Ga0495612_0001629_3530_3877 115
439 3300053083 Ga0495655_0000004 Ga0495655_0000004_194524_194874 115
440 3300053083 Ga0495655_0000489 Ga0495655_0000489_4383_4733 115
441 3300053085 Ga0495619_0000042 Ga0495619_0000042_58201_58548 115
442 3300053085 Ga0495619_0000098 Ga0495619_0000098_17049_17399 115
443 3300053094 Ga0500566_0008381 Ga0500566_0008381_2404_2754 115
444 3300053129 Ga0500628_000004 Ga0500628_000004_102939_103289 115
445 3300060353 Ga0501082_0054893 Ga0501082_0054893_898_1257 115
446 3300060353 Ga0501082_0779973 Ga0501082_0779973_125_478 115
447 3300061734 Ga0530510_0137350 Ga0530510_0137350_432_791 115
448 3300061734 Ga0530510_1406902 Ga0530510_1406902_157_510 115

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gdz-assembly1.cif.gz_A-3 crystal structure of a duf4251 family protein (bacegg_02002) from bacteroides eggerthii dsm 20697 at 1.95 a resolution 0.6339 13 28
2p9p-assembly1.cif.gz_D crystal structure of bovine arp2/3 complex co-crystallized with adp 0.5702 13 29
7bi7-assembly2.cif.gz_B an unexpected p-cluster like intermediate en route to the nitrogenase femo-co 0.5689 60 86
7jma-assembly1.cif.gz_A crystal structure of the apo form of nitrogenase iron-molybdenum cofactor biosynthesis enzyme nifb from methanothermobacter thermautotrophicus 0.5689 60 86
2kgf-assembly1.cif.gz_A n-terminal domain of capsid protein from the mason-pfizer monkey virus 0.5436 14 42
ID Description Score Start End Superfamily
af_Q4E5E4_1_126_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7417 14 29 3.10.450.50
af_Q8VHL1_66_110_2.20.110.10 Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.7359 13 29 2.20.110.10
2x64A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6399 69 107 3.40.30.10
4gdzA00 Mainly Beta;Beta Barrel;Lipocalin; 0.6338 13 28 2.40.128.410
af_A0A0P0V6A3_155_242_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.5979 13 35 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A1Q7X2R3-F1-model_v4 Uncharacterized protein 0.9616 14 115
AF-A0A1Q7X2R3-F1-model_v4 Uncharacterized protein 0.9346 14 115
AF-A0A6N7YR80-F1-model_v4 Uncharacterized protein 0.9182 8 114
AF-A0A7K0QQH5-F1-model_v4 Uncharacterized protein 0.9035 11 113
AF-A0A537YLB5-F1-model_v4 TipAS antibiotic-recognition domain-containing protein 0.9016 1 115

Feature Viewer

pLDDT pTM Quality
88.33 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map