F446156
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 448 | 260 | 448 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10000371|Ga0105249_1000037117 |
| Length | 125 |
| Sequence | MAGSLADWAAMAKGKKRRPRQKVATVDYTDAEGNKLTLRESLSPGTIAKLGEGPVTAATSQDDAWRRRSELLFERLAVRWEIAGLPLTEQKMLLGRYRMADALTQQWVRETIDEHLQRYIPELAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 122 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 124 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 137 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 138 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 139 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 140 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 142 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 147 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 157 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 158 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 159 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 160 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 206 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 207 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 208 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 218 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 243 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 244 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 245 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 257 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 258 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.12 |
| Nodule | 0 |
| Rhizoplane | 9.15 |
| Rhizosphere | 86.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000424 | 3300002074 | Bacteria | 4707 |
| 2 | JGI24034J26672_10000864 | 3300002239 | Bacteria | 3937 |
| 3 | JGI24742J22300_10001949 | 3300002244 | Bacteria | 3288 |
| 4 | JGI25407J50210_10003555 | 3300003373 | Bacteria | 3742 |
| 5 | JGI25407J50210_10072183 | 3300003373 | Bacteria | 861 |
| 6 | Ga0070676_10443795 | 3300005328 | Bacteria | 911 |
| 7 | Ga0070683_100006125 | 3300005329 | Bacteria | 10085 |
| 8 | Ga0070677_10000163 | 3300005333 | Bacteria | 22821 |
| 9 | Ga0070677_10910541 | 3300005333 | Bacteria | 509 |
| 10 | Ga0070682_100000077 | 3300005337 | Bacteria | 89055 |
| 11 | Ga0070682_100193627 | 3300005337 | Bacteria | 1429 |
| 12 | Ga0070689_100075918 | 3300005340 | Bacteria | 2632 |
| 13 | Ga0070661_100000116 | 3300005344 | Bacteria | 66712 |
| 14 | Ga0070692_10743780 | 3300005345 | Bacteria | 664 |
| 15 | Ga0070668_100892596 | 3300005347 | Unclassified | 794 |
| 16 | Ga0070688_100151527 | 3300005365 | Bacteria | 1586 |
| 17 | Ga0070659_100009046 | 3300005366 | Bacteria | 7309 |
| 18 | Ga0070667_100085406 | 3300005367 | Bacteria | 2707 |
| 19 | Ga0070705_100555312 | 3300005440 | Bacteria | 881 |
| 20 | Ga0070700_100252279 | 3300005441 | Bacteria | 1266 |
| 21 | Ga0070694_100622786 | 3300005444 | Unclassified | 871 |
| 22 | Ga0070663_100099405 | 3300005455 | Bacteria | 2169 |
| 23 | Ga0070678_100001532 | 3300005456 | Bacteria | 12353 |
| 24 | Ga0070678_100036225 | 3300005456 | Bacteria | 3452 |
| 25 | Ga0070681_10033752 | 3300005458 | Bacteria | 5137 |
| 26 | Ga0068867_100671961 | 3300005459 | Bacteria | 911 |
| 27 | Ga0070685_10001592 | 3300005466 | Bacteria | 11970 |
| 28 | Ga0070685_10275582 | 3300005466 | Bacteria | 1124 |
| 29 | Ga0070698_101646735 | 3300005471 | Unclassified | 594 |
| 30 | Ga0070679_100000487 | 3300005530 | Bacteria | 33946 |
| 31 | Ga0070684_100017747 | 3300005535 | Bacteria | 5848 |
| 32 | Ga0070684_100031509 | 3300005535 | Bacteria | 4515 |
| 33 | Ga0070684_100108093 | 3300005535 | Bacteria | 2492 |
| 34 | Ga0068853_100004202 | 3300005539 | Bacteria | 11107 |
| 35 | Ga0068853_100077288 | 3300005539 | Bacteria | 2908 |
| 36 | Ga0070672_100008239 | 3300005543 | Bacteria | 7123 |
| 37 | Ga0070686_101772627 | 3300005544 | Unclassified | 525 |
| 38 | Ga0070695_100036840 | 3300005545 | Bacteria | 3080 |
| 39 | Ga0070665_100000341 | 3300005548 | Bacteria | 70565 |
| 40 | Ga0070704_101076059 | 3300005549 | Unclassified | 730 |
| 41 | Ga0070664_100075757 | 3300005564 | Bacteria | 2890 |
| 42 | Ga0068854_100104593 | 3300005578 | Bacteria | 2127 |
| 43 | Ga0068856_100011212 | 3300005614 | Bacteria | 8699 |
| 44 | Ga0068856_100100573 | 3300005614 | Bacteria | 2883 |
| 45 | Ga0068856_100324905 | 3300005614 | Bacteria | 1556 |
| 46 | Ga0068856_101085585 | 3300005614 | Bacteria | 818 |
| 47 | Ga0070702_100114066 | 3300005615 | Bacteria | 1681 |
| 48 | Ga0068852_100311262 | 3300005616 | Bacteria | 1527 |
| 49 | Ga0068866_10033436 | 3300005718 | Bacteria | 2495 |
| 50 | Ga0068866_11239830 | 3300005718 | Unclassified | 540 |
| 51 | Ga0068861_100210122 | 3300005719 | Bacteria | 1639 |
| 52 | Ga0068861_100931126 | 3300005719 | Bacteria | 825 |
| 53 | Ga0068851_10000248 | 3300005834 | Bacteria | 25411 |
| 54 | Ga0068851_10240210 | 3300005834 | Bacteria | 1024 |
| 55 | Ga0068863_100055760 | 3300005841 | Bacteria | 3742 |
| 56 | Ga0068858_100000088 | 3300005842 | Bacteria | 95138 |
| 57 | Ga0068858_100000251 | 3300005842 | Bacteria | 57269 |
| 58 | Ga0081455_10010452 | 3300005937 | Bacteria | 9416 |
| 59 | Ga0081538_10000225 | 3300005981 | Bacteria | 63512 |
| 60 | Ga0081538_10000656 | 3300005981 | Bacteria | 38278 |
| 61 | Ga0081538_10001069 | 3300005981 | Bacteria | 29129 |
| 62 | Ga0081538_10001141 | 3300005981 | Bacteria | 28060 |
| 63 | Ga0081538_10002516 | 3300005981 | Bacteria | 17850 |
| 64 | Ga0081538_10105151 | 3300005981 | Bacteria | 1406 |
| 65 | Ga0081538_10204785 | 3300005981 | Bacteria | 805 |
| 66 | Ga0081539_10002515 | 3300005985 | Bacteria | 25631 |
| 67 | Ga0081539_10025600 | 3300005985 | Bacteria | 3794 |
| 68 | Ga0081539_10195210 | 3300005985 | Bacteria | 939 |
| 69 | Ga0075365_10001514 | 3300006038 | Bacteria | 10618 |
| 70 | Ga0075365_10324571 | 3300006038 | Bacteria | 1084 |
| 71 | Ga0075365_10954997 | 3300006038 | Unclassified | 604 |
| 72 | Ga0075364_10020834 | 3300006051 | Bacteria | 4127 |
| 73 | Ga0075364_10266311 | 3300006051 | Bacteria | 1165 |
| 74 | Ga0075364_10988539 | 3300006051 | Bacteria | 572 |
| 75 | Ga0070712_100000339 | 3300006175 | Bacteria | 26368 |
| 76 | Ga0097621_102083625 | 3300006237 | Bacteria | 542 |
| 77 | Ga0068871_100226848 | 3300006358 | Bacteria | 1620 |
| 78 | Ga0075428_100113370 | 3300006844 | Unclassified | 2954 |
| 79 | Ga0075428_100134290 | 3300006844 | Bacteria | 2691 |
| 80 | Ga0075428_100417263 | 3300006844 | Bacteria | 1438 |
| 81 | Ga0075428_101215411 | 3300006844 | Bacteria | 794 |
| 82 | Ga0075430_100211300 | 3300006846 | Bacteria | 1610 |
| 83 | Ga0075430_100250974 | 3300006846 | Bacteria | 1466 |
| 84 | Ga0075430_100473258 | 3300006846 | Bacteria | 1034 |
| 85 | Ga0075431_100029806 | 3300006847 | Bacteria | 5618 |
| 86 | Ga0075431_100032360 | 3300006847 | Bacteria | 5389 |
| 87 | Ga0075431_100052790 | 3300006847 | Bacteria | 4191 |
| 88 | Ga0075431_100286216 | 3300006847 | Bacteria | 1668 |
| 89 | Ga0075431_100432516 | 3300006847 | Unclassified | 1314 |
| 90 | Ga0075433_10000057 | 3300006852 | Bacteria | 48581 |
| 91 | Ga0075433_11738839 | 3300006852 | Unclassified | 537 |
| 92 | Ga0075429_100003590 | 3300006880 | Bacteria | 13221 |
| 93 | Ga0075429_100017950 | 3300006880 | Bacteria | 6118 |
| 94 | Ga0068865_100000019 | 3300006881 | Bacteria | 105996 |
| 95 | Ga0105240_10422842 | 3300009093 | Bacteria | 1497 |
| 96 | Ga0111539_10457430 | 3300009094 | Bacteria | 1486 |
| 97 | Ga0111539_10533244 | 3300009094 | Bacteria | 1368 |
| 98 | Ga0111539_11343820 | 3300009094 | Unclassified | 829 |
| 99 | Ga0111539_11976015 | 3300009094 | Bacteria | 676 |
| 100 | Ga0111539_12415713 | 3300009094 | Unclassified | 610 |
| 101 | Ga0105245_10000151 | 3300009098 | Bacteria | 65950 |
| 102 | Ga0105245_10009133 | 3300009098 | Bacteria | 8645 |
| 103 | Ga0105245_10012189 | 3300009098 | Bacteria | 7477 |
| 104 | Ga0105245_10144075 | 3300009098 | Bacteria | 2247 |
| 105 | Ga0105245_10659415 | 3300009098 | Bacteria | 1077 |
| 106 | Ga0105245_10727283 | 3300009098 | Unclassified | 1027 |
| 107 | Ga0105247_10000204 | 3300009101 | Bacteria | 58153 |
| 108 | Ga0105247_10008346 | 3300009101 | Bacteria | 6316 |
| 109 | Ga0114129_10002947 | 3300009147 | Bacteria | 23806 |
| 110 | Ga0114129_10221176 | 3300009147 | Bacteria | 2554 |
| 111 | Ga0114129_10371251 | 3300009147 | Unclassified | 1891 |
| 112 | Ga0114129_10783838 | 3300009147 | Bacteria | 1218 |
| 113 | Ga0114129_11199854 | 3300009147 | Bacteria | 945 |
| 114 | Ga0114129_11663623 | 3300009147 | Bacteria | 780 |
| 115 | Ga0114129_12649136 | 3300009147 | Bacteria | 598 |
| 116 | Ga0105241_12193735 | 3300009174 | Unclassified | 548 |
| 117 | Ga0105242_10000104 | 3300009176 | Bacteria | 60125 |
| 118 | Ga0105242_10299352 | 3300009176 | Bacteria | 1467 |
| 119 | Ga0105248_10000126 | 3300009177 | Bacteria | 88461 |
| 120 | Ga0105237_10359668 | 3300009545 | Bacteria | 1460 |
| 121 | Ga0105237_10807538 | 3300009545 | Unclassified | 945 |
| 122 | Ga0105238_10000172 | 3300009551 | Bacteria | 70799 |
| 123 | Ga0105249_10000371 | 3300009553 | Bacteria | 44499 |
| 124 | Ga0105249_10207229 | 3300009553 | Bacteria | 1922 |
| 125 | Ga0105249_10830236 | 3300009553 | Bacteria | 989 |
| 126 | Ga0105249_12135415 | 3300009553 | Unclassified | 633 |
| 127 | Ga0105239_10161746 | 3300010375 | Bacteria | 2501 |
| 128 | Ga0105239_10285209 | 3300010375 | Bacteria | 1859 |
| 129 | Ga0105239_13233133 | 3300010375 | Unclassified | 530 |
| 130 | Ga0105246_10207411 | 3300011119 | Bacteria | 1527 |
| 131 | Ga0157338_1055693 | 3300012515 | Bacteria | 580 |
| 132 | Ga0157371_10000909 | 3300013102 | Bacteria | 33337 |
| 133 | Ga0157370_10007913 | 3300013104 | Bacteria | 11515 |
| 134 | Ga0157370_10029815 | 3300013104 | Bacteria | 5349 |
| 135 | Ga0157369_10000135 | 3300013105 | Bacteria | 105364 |
| 136 | Ga0157374_10132308 | 3300013296 | Bacteria | 2415 |
| 137 | Ga0157378_10042780 | 3300013297 | Bacteria | 4020 |
| 138 | Ga0163162_10030535 | 3300013306 | Bacteria | 5339 |
| 139 | Ga0157375_10001783 | 3300013308 | Bacteria | 18453 |
| 140 | Ga0157375_10006973 | 3300013308 | Bacteria | 9865 |
| 141 | Ga0163163_10310888 | 3300014325 | Unclassified | 1629 |
| 142 | Ga0182008_10605085 | 3300014497 | Bacteria | 616 |
| 143 | Ga0157379_10006279 | 3300014968 | Bacteria | 10235 |
| 144 | Ga0163161_10040024 | 3300017792 | Bacteria | 3366 |
| 145 | Ga0207656_10000105 | 3300025321 | Bacteria | 31356 |
| 146 | Ga0207656_10398386 | 3300025321 | Bacteria | 692 |
| 147 | Ga0207682_10003413 | 3300025893 | Bacteria | 6911 |
| 148 | Ga0207682_10607670 | 3300025893 | Bacteria | 515 |
| 149 | Ga0207642_10020194 | 3300025899 | Bacteria | 2595 |
| 150 | Ga0207710_10000457 | 3300025900 | Bacteria | 26204 |
| 151 | Ga0207643_10074924 | 3300025908 | Bacteria | 1952 |
| 152 | Ga0207705_10279905 | 3300025909 | Bacteria | 1277 |
| 153 | Ga0207707_10023070 | 3300025912 | Bacteria | 5444 |
| 154 | Ga0207695_10243373 | 3300025913 | Bacteria | 1699 |
| 155 | Ga0207671_10271497 | 3300025914 | Bacteria | 1336 |
| 156 | Ga0207693_10002524 | 3300025915 | Bacteria | 15898 |
| 157 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 158 | Ga0207652_10000658 | 3300025921 | Bacteria | 33940 |
| 159 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 160 | Ga0207687_10000037 | 3300025927 | Bacteria | 120493 |
| 161 | Ga0207687_10000167 | 3300025927 | Bacteria | 44044 |
| 162 | Ga0207687_10004633 | 3300025927 | Bacteria | 9148 |
| 163 | Ga0207687_10496179 | 3300025927 | Bacteria | 1018 |
| 164 | Ga0207687_10812948 | 3300025927 | Unclassified | 797 |
| 165 | Ga0207690_10052909 | 3300025932 | Bacteria | 2722 |
| 166 | Ga0207690_10350217 | 3300025932 | Bacteria | 1168 |
| 167 | Ga0207686_10000063 | 3300025934 | Bacteria | 96427 |
| 168 | Ga0207670_10238103 | 3300025936 | Bacteria | 1401 |
| 169 | Ga0207704_10000009 | 3300025938 | Bacteria | 198266 |
| 170 | Ga0207704_11537124 | 3300025938 | Bacteria | 571 |
| 171 | Ga0207691_10043696 | 3300025940 | Bacteria | 4128 |
| 172 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 173 | Ga0207661_10003140 | 3300025944 | Bacteria | 11451 |
| 174 | Ga0207661_10004159 | 3300025944 | Bacteria | 10122 |
| 175 | Ga0207661_10004202 | 3300025944 | Bacteria | 10071 |
| 176 | Ga0207679_10056661 | 3300025945 | Bacteria | 2895 |
| 177 | Ga0207712_10000037 | 3300025961 | Bacteria | 195906 |
| 178 | Ga0207712_11939068 | 3300025961 | Unclassified | 527 |
| 179 | Ga0207668_10350188 | 3300025972 | Bacteria | 1235 |
| 180 | Ga0207668_10619670 | 3300025972 | Bacteria | 944 |
| 181 | Ga0207668_11864915 | 3300025972 | Bacteria | 542 |
| 182 | Ga0207640_10197106 | 3300025981 | Bacteria | 1523 |
| 183 | Ga0207658_10057755 | 3300025986 | Bacteria | 2885 |
| 184 | Ga0207703_10000128 | 3300026035 | Bacteria | 91359 |
| 185 | Ga0207703_10000237 | 3300026035 | Bacteria | 62874 |
| 186 | Ga0207703_11518816 | 3300026035 | Bacteria | 644 |
| 187 | Ga0207639_10031439 | 3300026041 | Bacteria | 3902 |
| 188 | Ga0207639_10109156 | 3300026041 | Bacteria | 2251 |
| 189 | Ga0207678_10081698 | 3300026067 | Bacteria | 2766 |
| 190 | Ga0207678_11915885 | 3300026067 | Bacteria | 517 |
| 191 | Ga0207708_10105334 | 3300026075 | Bacteria | 2186 |
| 192 | Ga0207708_10376523 | 3300026075 | Bacteria | 1170 |
| 193 | Ga0207708_10401839 | 3300026075 | Unclassified | 1133 |
| 194 | Ga0207702_10004618 | 3300026078 | Bacteria | 12202 |
| 195 | Ga0207702_10009477 | 3300026078 | Bacteria | 8181 |
| 196 | Ga0207641_10011355 | 3300026088 | Bacteria | 7310 |
| 197 | Ga0207674_10588234 | 3300026116 | Bacteria | 1075 |
| 198 | Ga0207675_100268526 | 3300026118 | Bacteria | 1655 |
| 199 | Ga0207683_10004976 | 3300026121 | Bacteria | 11427 |
| 200 | Ga0207698_10000009 | 3300026142 | Bacteria | 281300 |
| 201 | Ga0207428_10531445 | 3300027907 | Bacteria | 852 |
| 202 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 203 | Ga0265337_1000126 | 3300028556 | Bacteria | 38633 |
| 204 | Ga0265326_10000144 | 3300028558 | Bacteria | 37151 |
| 205 | Ga0265322_10000009 | 3300028654 | Bacteria | 170768 |
| 206 | Ga0265336_10001991 | 3300028666 | Bacteria | 8723 |
| 207 | Ga0265324_10000389 | 3300029957 | Bacteria | 31898 |
| 208 | Ga0265332_10009925 | 3300031238 | Bacteria | 4241 |
| 209 | Ga0265328_10003668 | 3300031239 | Bacteria | 6766 |
| 210 | Ga0265320_10000024 | 3300031240 | Bacteria | 170768 |
| 211 | Ga0265329_10002956 | 3300031242 | Bacteria | 7560 |
| 212 | Ga0265331_10000894 | 3300031250 | Bacteria | 24175 |
| 213 | Ga0265327_10000227 | 3300031251 | Bacteria | 114777 |
| 214 | Ga0307513_10200942 | 3300031456 | Bacteria | 1834 |
| 215 | Ga0307408_101852647 | 3300031548 | Unclassified | 578 |
| 216 | Ga0307408_102239780 | 3300031548 | Bacteria | 528 |
| 217 | Ga0265313_10132788 | 3300031595 | Unclassified | 1077 |
| 218 | Ga0265314_10000570 | 3300031711 | Bacteria | 46890 |
| 219 | Ga0307405_10146923 | 3300031731 | Bacteria | 1653 |
| 220 | Ga0307413_10579098 | 3300031824 | Unclassified | 915 |
| 221 | Ga0307413_10631031 | 3300031824 | Bacteria | 881 |
| 222 | Ga0307410_10013646 | 3300031852 | Bacteria | 4748 |
| 223 | Ga0307410_10092719 | 3300031852 | Bacteria | 2148 |
| 224 | Ga0307410_10903924 | 3300031852 | Unclassified | 756 |
| 225 | Ga0307406_10017564 | 3300031901 | Bacteria | 4167 |
| 226 | Ga0307406_10183620 | 3300031901 | Unclassified | 1525 |
| 227 | Ga0307406_10193784 | 3300031901 | Bacteria | 1490 |
| 228 | Ga0307407_10330819 | 3300031903 | Unclassified | 1072 |
| 229 | Ga0307412_10237783 | 3300031911 | Bacteria | 1407 |
| 230 | Ga0307409_100003787 | 3300031995 | Bacteria | 8327 |
| 231 | Ga0307409_100105430 | 3300031995 | Bacteria | 2350 |
| 232 | Ga0307409_100460327 | 3300031995 | Bacteria | 1230 |
| 233 | Ga0307416_100043256 | 3300032002 | Bacteria | 3525 |
| 234 | Ga0307416_100248201 | 3300032002 | Bacteria | 1730 |
| 235 | Ga0307416_101376709 | 3300032002 | Unclassified | 811 |
| 236 | Ga0307414_10203364 | 3300032004 | Bacteria | 1613 |
| 237 | Ga0307414_10433424 | 3300032004 | Bacteria | 1149 |
| 238 | Ga0307414_11032872 | 3300032004 | Bacteria | 757 |
| 239 | Ga0307411_10035257 | 3300032005 | Bacteria | 3122 |
| 240 | Ga0307415_100015759 | 3300032126 | Bacteria | 4486 |
| 241 | Ga0307415_100086073 | 3300032126 | Bacteria | 2260 |
| 242 | Ga0307415_100275111 | 3300032126 | Bacteria | 1381 |
| 243 | Ga0307415_100417285 | 3300032126 | Bacteria | 1151 |
| 244 | Ga0307415_101818131 | 3300032126 | Bacteria | 590 |
| 245 | Ga0316583_10172192 | 3300032133 | Bacteria | 753 |
| 246 | Ga0316583_10209663 | 3300032133 | Bacteria | 676 |
| 247 | Ga0373934_0458073 | 3300035086 | Bacteria | 535 |
| 248 | Ga0373955_0117970 | 3300035172 | Bacteria | 1540 |
| 249 | Ga0316574_0260074 | 3300035398 | Bacteria | 1108 |
| 250 | Ga0373937_0034652 | 3300036401 | Bacteria | 4592 |
| 251 | Ga0373937_0694597 | 3300036401 | Bacteria | 964 |
| 252 | Ga0395898_1627038 | 3300037466 | Bacteria | 570 |
| 253 | Ga0316581_0050232 | 3300037588 | Bacteria | 1278 |
| 254 | Ga0395901_1051708 | 3300038443 | Unclassified | 787 |
| 255 | Ga0451791_1693705 | 3300041451 | Bacteria | 777 |
| 256 | Ga0451807_2458407 | 3300041486 | Bacteria | 626 |
| 257 | Ga0451849_0675551 | 3300041505 | Bacteria | 617 |
| 258 | Ga0451849_0893674 | 3300041505 | Bacteria | 578 |
| 259 | Ga0451853_1408135 | 3300041512 | Bacteria | 2024 |
| 260 | Ga0451853_2463998 | 3300041512 | Bacteria | 674 |
| 261 | Ga0466963_0000007 | 3300044694 | Bacteria | 79067 |
| 262 | Ga0466963_0036775 | 3300044694 | Bacteria | 3194 |
| 263 | Ga0466957_0000177 | 3300044842 | Bacteria | 28545 |
| 264 | Ga0466957_0051133 | 3300044842 | Bacteria | 2515 |
| 265 | Ga0466957_0162529 | 3300044842 | Bacteria | 1451 |
| 266 | Ga0466960_0126099 | 3300044901 | Bacteria | 1346 |
| 267 | Ga0466960_0610652 | 3300044901 | Bacteria | 648 |
| 268 | Ga0466967_0000005 | 3300045976 | Bacteria | 149543 |
| 269 | Ga0466967_0119892 | 3300045976 | Bacteria | 2429 |
| 270 | Ga0466967_1791246 | 3300045976 | Unclassified | 611 |
| 271 | Ga0495603_0000271 | 3300046455 | Bacteria | 27496 |
| 272 | Ga0495603_0001209 | 3300046455 | Bacteria | 15085 |
| 273 | Ga0495629_0009096 | 3300046459 | Bacteria | 7276 |
| 274 | Ga0495629_0013866 | 3300046459 | Bacteria | 5815 |
| 275 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 276 | Ga0495651_0287192 | 3300046462 | Bacteria | 1109 |
| 277 | Ga0495653_0031504 | 3300046463 | Bacteria | 4214 |
| 278 | Ga0495582_0670165 | 3300046473 | Bacteria | 600 |
| 279 | Ga0495662_0000519 | 3300046476 | Bacteria | 17584 |
| 280 | Ga0495664_0183073 | 3300046477 | Bacteria | 1270 |
| 281 | Ga0495584_0365696 | 3300046491 | Bacteria | 733 |
| 282 | Ga0495596_0429441 | 3300046500 | Bacteria | 515 |
| 283 | Ga0495608_0010249 | 3300046511 | Bacteria | 6540 |
| 284 | Ga0495608_0284540 | 3300046511 | Unclassified | 1026 |
| 285 | Ga0495616_0273196 | 3300046513 | Bacteria | 720 |
| 286 | Ga0495620_0000747 | 3300046515 | Bacteria | 19970 |
| 287 | Ga0495628_1063669 | 3300046516 | Bacteria | 554 |
| 288 | Ga0495644_0000499 | 3300046523 | Bacteria | 16748 |
| 289 | Ga0495663_0180621 | 3300046525 | Bacteria | 731 |
| 290 | Ga0495586_0000537 | 3300046535 | Bacteria | 22120 |
| 291 | Ga0495587_0012635 | 3300046536 | Bacteria | 5312 |
| 292 | Ga0495598_0137730 | 3300046537 | Unclassified | 842 |
| 293 | Ga0495609_0127648 | 3300046538 | Bacteria | 1091 |
| 294 | Ga0495621_0000709 | 3300046539 | Bacteria | 8432 |
| 295 | Ga0495645_0054401 | 3300046543 | Bacteria | 2908 |
| 296 | Ga0495633_0556921 | 3300046558 | Unclassified | 516 |
| 297 | Ga0495667_0000421 | 3300046559 | Bacteria | 27190 |
| 298 | Ga0495656_0000196 | 3300046615 | Bacteria | 21672 |
| 299 | Ga0495656_0830127 | 3300046615 | Unclassified | 500 |
| 300 | Ga0495668_0397106 | 3300046616 | Bacteria | 758 |
| 301 | Ga0495634_0001221 | 3300046642 | Bacteria | 23712 |
| 302 | Ga0495634_0208160 | 3300046642 | Bacteria | 1212 |
| 303 | Ga0495634_0238493 | 3300046642 | Bacteria | 1116 |
| 304 | Ga0495646_0452025 | 3300046680 | Bacteria | 663 |
| 305 | Ga0495658_0000438 | 3300046683 | Bacteria | 23210 |
| 306 | Ga0495658_0692010 | 3300046683 | Unclassified | 653 |
| 307 | Ga0495669_0000083 | 3300046684 | Bacteria | 62876 |
| 308 | Ga0495669_0288540 | 3300046684 | Bacteria | 790 |
| 309 | Ga0495613_0491745 | 3300046689 | Unclassified | 827 |
| 310 | Ga0495613_1051659 | 3300046689 | Unclassified | 521 |
| 311 | Ga0495670_0316295 | 3300046691 | Bacteria | 838 |
| 312 | Ga0495649_0032859 | 3300046694 | Bacteria | 2857 |
| 313 | Ga0495604_0000413 | 3300047317 | Bacteria | 38567 |
| 314 | Ga0495676_0000752 | 3300047321 | Bacteria | 26996 |
| 315 | Ga0495676_0001446 | 3300047321 | Bacteria | 20500 |
| 316 | Ga0495676_0032711 | 3300047321 | Bacteria | 4387 |
| 317 | Ga0495676_0295258 | 3300047321 | Bacteria | 1094 |
| 318 | Ga0495680_0000599 | 3300047322 | Bacteria | 40585 |
| 319 | Ga0495680_0003986 | 3300047322 | Bacteria | 14263 |
| 320 | Ga0495680_0110150 | 3300047322 | Bacteria | 2041 |
| 321 | Ga0495677_0392540 | 3300047445 | Unclassified | 549 |
| 322 | Ga0495679_019372 | 3300047446 | Bacteria | 2392 |
| 323 | Ga0495673_0089273 | 3300047469 | Bacteria | 1262 |
| 324 | Ga0495593_0312083 | 3300047673 | Unclassified | 786 |
| 325 | Ga0496100_0000007 | 3300048903 | Bacteria | 261266 |
| 326 | Ga0496101_0000013 | 3300048904 | Bacteria | 261266 |
| 327 | Ga0496102_0000045 | 3300048905 | Bacteria | 186726 |
| 328 | Ga0496102_0274546 | 3300048905 | Unclassified | 1589 |
| 329 | Ga0496103_0000050 | 3300048906 | Bacteria | 152034 |
| 330 | Ga0496103_0198353 | 3300048906 | Unclassified | 1291 |
| 331 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 332 | Ga0496104_0000013 | 3300048907 | Bacteria | 397163 |
| 333 | Ga0496104_1407458 | 3300048907 | Unclassified | 600 |
| 334 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 335 | Ga0496105_0000006 | 3300048908 | Bacteria | 393578 |
| 336 | Ga0496105_0034415 | 3300048908 | Bacteria | 4166 |
| 337 | Ga0496106_0000006 | 3300048909 | Bacteria | 251855 |
| 338 | Ga0496107_0000007 | 3300048910 | Bacteria | 257113 |
| 339 | Ga0496107_0245994 | 3300048910 | Bacteria | 1331 |
| 340 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 341 | Ga0496108_0000094 | 3300048911 | Bacteria | 93075 |
| 342 | Ga0496108_0001965 | 3300048911 | Bacteria | 16462 |
| 343 | Ga0496108_0003686 | 3300048911 | Bacteria | 12290 |
| 344 | Ga0496109_0000006 | 3300048912 | Bacteria | 325513 |
| 345 | Ga0496109_0000024 | 3300048912 | Bacteria | 174723 |
| 346 | Ga0496109_0000285 | 3300048912 | Bacteria | 48300 |
| 347 | Ga0496109_0077493 | 3300048912 | Bacteria | 3059 |
| 348 | Ga0496109_0127876 | 3300048912 | Bacteria | 2370 |
| 349 | Ga0496109_0555261 | 3300048912 | Bacteria | 1083 |
| 350 | Ga0496109_0726348 | 3300048912 | Bacteria | 931 |
| 351 | Ga0496109_1488317 | 3300048912 | Bacteria | 612 |
| 352 | Ga0496110_0000338 | 3300048913 | Bacteria | 31275 |
| 353 | Ga0496110_0010361 | 3300048913 | Bacteria | 7579 |
| 354 | Ga0496110_0501414 | 3300048913 | Bacteria | 1105 |
| 355 | Ga0496110_0589678 | 3300048913 | Bacteria | 1009 |
| 356 | Ga0496111_0000199 | 3300048914 | Bacteria | 27930 |
| 357 | Ga0496111_0081106 | 3300048914 | Bacteria | 2368 |
| 358 | Ga0496113_0028160 | 3300048916 | Bacteria | 4038 |
| 359 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 360 | Ga0496114_0116555 | 3300048917 | Bacteria | 2293 |
| 361 | Ga0496114_1128978 | 3300048917 | Bacteria | 669 |
| 362 | Ga0496115_0000071 | 3300048918 | Bacteria | 91922 |
| 363 | Ga0496115_0000263 | 3300048918 | Bacteria | 46550 |
| 364 | Ga0496119_0008717 | 3300048922 | Bacteria | 8853 |
| 365 | Ga0496125_0031965 | 3300048928 | Bacteria | 4681 |
| 366 | Ga0501031_0383098 | 3300049568 | Bacteria | 910 |
| 367 | Ga0501032_0314907 | 3300049569 | Bacteria | 1011 |
| 368 | Ga0501032_0554350 | 3300049569 | Bacteria | 733 |
| 369 | Ga0501034_1222330 | 3300049571 | Unclassified | 630 |
| 370 | Ga0501036_0076319 | 3300049572 | Bacteria | 2835 |
| 371 | Ga0501036_0560689 | 3300049572 | Unclassified | 949 |
| 372 | Ga0501036_1120145 | 3300049572 | Bacteria | 643 |
| 373 | Ga0501038_0178453 | 3300049574 | Bacteria | 1715 |
| 374 | Ga0501038_1254626 | 3300049574 | Unclassified | 536 |
| 375 | Ga0501040_0313494 | 3300049576 | Bacteria | 1122 |
| 376 | Ga0501040_0557388 | 3300049576 | Unclassified | 827 |
| 377 | Ga0501041_0016687 | 3300049577 | Bacteria | 4370 |
| 378 | Ga0501041_0090926 | 3300049577 | Unclassified | 1884 |
| 379 | Ga0501041_0464795 | 3300049577 | Bacteria | 804 |
| 380 | Ga0501042_0505592 | 3300049578 | Unclassified | 877 |
| 381 | Ga0501042_0620470 | 3300049578 | Unclassified | 786 |
| 382 | Ga0501042_0845259 | 3300049578 | Bacteria | 666 |
| 383 | Ga0501043_1093640 | 3300049579 | Bacteria | 564 |
| 384 | Ga0501046_0316812 | 3300049580 | Bacteria | 1137 |
| 385 | Ga0501048_0064066 | 3300049582 | Bacteria | 2600 |
| 386 | Ga0501048_1204304 | 3300049582 | Bacteria | 545 |
| 387 | Ga0501067_0739723 | 3300049583 | Bacteria | 553 |
| 388 | Ga0501068_0445988 | 3300049584 | Unclassified | 837 |
| 389 | Ga0501068_0596304 | 3300049584 | Bacteria | 720 |
| 390 | Ga0501071_0515863 | 3300049587 | Bacteria | 917 |
| 391 | Ga0501071_1324083 | 3300049587 | Bacteria | 556 |
| 392 | Ga0501072_0086064 | 3300049588 | Bacteria | 2494 |
| 393 | Ga0501072_0205862 | 3300049588 | Unclassified | 1568 |
| 394 | Ga0501073_0541682 | 3300049589 | Bacteria | 804 |
| 395 | Ga0501073_1103951 | 3300049589 | Unclassified | 545 |
| 396 | Ga0501075_0167775 | 3300049591 | Bacteria | 1675 |
| 397 | Ga0501075_0249315 | 3300049591 | Bacteria | 1353 |
| 398 | Ga0501075_0285466 | 3300049591 | Bacteria | 1257 |
| 399 | Ga0501076_0104447 | 3300049592 | Bacteria | 2286 |
| 400 | Ga0501076_0258419 | 3300049592 | Bacteria | 1426 |
| 401 | Ga0501079_0511588 | 3300049741 | Bacteria | 944 |
| 402 | Ga0501080_0335087 | 3300049742 | Bacteria | 1368 |
| 403 | Ga0501080_1181302 | 3300049742 | Bacteria | 658 |
| 404 | Ga0501081_0012935 | 3300049743 | Bacteria | 5491 |
| 405 | Ga0501081_1048850 | 3300049743 | Unclassified | 616 |
| 406 | Ga0501035_0759925 | 3300049822 | Bacteria | 777 |
| 407 | Ga0501045_0071727 | 3300049824 | Bacteria | 2549 |
| 408 | Ga0501045_0130160 | 3300049824 | Bacteria | 1871 |
| 409 | nmdc:mga03n38_127354_c1 | 3300050490 | Bacteria | 1258 |
| 410 | nmdc:mga00v17_368774_c1 | 3300050491 | Bacteria | 933 |
| 411 | nmdc:mga00v17_795122_c1 | 3300050491 | Bacteria | 603 |
| 412 | nmdc:mga0yw44_321694_c1 | 3300050492 | Bacteria | 1039 |
| 413 | nmdc:mga0yw44_324946_c1 | 3300050492 | Bacteria | 1033 |
| 414 | nmdc:mga0yw44_859725_c1 | 3300050492 | Bacteria | 615 |
| 415 | nmdc:mga05p37_176910_c1 | 3300050507 | Bacteria | 2599 |
| 416 | nmdc:mga05p37_2274_c1 | 3300050507 | Bacteria | 22394 |
| 417 | nmdc:mga09592_250805_c1 | 3300050508 | Bacteria | 1534 |
| 418 | nmdc:mga09592_46762_c1 | 3300050508 | Bacteria | 3645 |
| 419 | nmdc:mga09592_8747_c1 | 3300050508 | Bacteria | 8239 |
| 420 | nmdc:mga0qj67_16471_c1 | 3300050509 | Bacteria | 5608 |
| 421 | nmdc:mga0qj67_22568_c1 | 3300050509 | Bacteria | 4834 |
| 422 | nmdc:mga0qj67_29388_c1 | 3300050509 | Bacteria | 4269 |
| 423 | nmdc:mga06r32_43951_c1 | 3300050510 | Bacteria | 4252 |
| 424 | nmdc:mga06r32_581270_c1 | 3300050510 | Unclassified | 1092 |
| 425 | nmdc:mga06r32_95021_c1 | 3300050510 | Bacteria | 2917 |
| 426 | nmdc:mga08y16_1551619_c1 | 3300050511 | Bacteria | 621 |
| 427 | nmdc:mga08y16_223384_c1 | 3300050511 | Bacteria | 1949 |
| 428 | nmdc:mga08y16_439914_c1 | 3300050511 | Bacteria | 1331 |
| 429 | nmdc:mga0n895_1032810_c1 | 3300050512 | Bacteria | 802 |
| 430 | nmdc:mga0a205_1_c2 | 3300050515 | Bacteria | 266330 |
| 431 | nmdc:mga0a205_2910_c1 | 3300050515 | Bacteria | 15147 |
| 432 | Ga0495601_0000581 | 3300053077 | Bacteria | 19434 |
| 433 | Ga0495601_0137921 | 3300053077 | Bacteria | 1590 |
| 434 | Ga0495612_0001629 | 3300053078 | Bacteria | 9237 |
| 435 | Ga0495655_0000004 | 3300053083 | Bacteria | 293683 |
| 436 | Ga0495655_0000489 | 3300053083 | Bacteria | 6618 |
| 437 | Ga0495619_0000042 | 3300053085 | Bacteria | 112453 |
| 438 | Ga0495619_0000098 | 3300053085 | Bacteria | 64979 |
| 439 | Ga0500566_0008381 | 3300053094 | Bacteria | 6112 |
| 440 | Ga0500628_000004 | 3300053129 | Bacteria | 202098 |
| 441 | Ga0501084_0538236 | 3300054114 | Bacteria | 987 |
| 442 | Ga0501084_1111604 | 3300054114 | Bacteria | 663 |
| 443 | Ga0501082_0054893 | 3300060353 | Bacteria | 3434 |
| 444 | Ga0501082_0080314 | 3300060353 | Bacteria | 2814 |
| 445 | Ga0501082_0779973 | 3300060353 | Unclassified | 836 |
| 446 | Ga0530510_0009169 | 3300061734 | Bacteria | 6933 |
| 447 | Ga0530510_0137350 | 3300061734 | Bacteria | 1800 |
| 448 | Ga0530510_1406902 | 3300061734 | Unclassified | 535 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003373 | JGI25407J50210_10003555 | JGI25407J50210_100035552 | 95 |
| 2 | 3300005981 | Ga0081538_10000656 | Ga0081538_100006565 | 95 |
| 3 | 3300046500 | Ga0495596_0429441 | Ga0495596_0429441_103_462 | 101 |
| 4 | 3300006847 | Ga0075431_100286216 | Ga0075431_1002862162 | 102 |
| 5 | 3300006038 | Ga0075365_10324571 | Ga0075365_103245712 | 103 |
| 6 | 3300006051 | Ga0075364_10988539 | Ga0075364_109885392 | 103 |
| 7 | 3300006844 | Ga0075428_100113370 | Ga0075428_1001133702 | 103 |
| 8 | 3300006847 | Ga0075431_100432516 | Ga0075431_1004325162 | 103 |
| 9 | 3300006880 | Ga0075429_100003590 | Ga0075429_1000035907 | 103 |
| 10 | 3300009094 | Ga0111539_10533244 | Ga0111539_105332442 | 103 |
| 11 | 3300009147 | Ga0114129_10221176 | Ga0114129_102211762 | 103 |
| 12 | 3300009147 | Ga0114129_10783838 | Ga0114129_107838381 | 103 |
| 13 | 3300009553 | Ga0105249_12135415 | Ga0105249_121354152 | 103 |
| 14 | 3300025961 | Ga0207712_11939068 | Ga0207712_119390681 | 103 |
| 15 | 3300027907 | Ga0207428_10531445 | Ga0207428_105314452 | 103 |
| 16 | 3300035172 | Ga0373955_0117970 | Ga0373955_0117970_13_324 | 103 |
| 17 | 3300049578 | Ga0501042_0620470 | Ga0501042_0620470_54_368 | 103 |
| 18 | 3300049583 | Ga0501067_0739723 | Ga0501067_0739723_128_442 | 103 |
| 19 | 3300050491 | nmdc:mga00v17_795122_c1 | nmdc:mga00v17_795122_c1_159_473 | 103 |
| 20 | 3300050492 | nmdc:mga0yw44_324946_c1 | nmdc:mga0yw44_324946_c1_330_644 | 103 |
| 21 | 3300050507 | nmdc:mga05p37_176910_c1 | nmdc:mga05p37_176910_c1_1852_2166 | 103 |
| 22 | 3300050508 | nmdc:mga09592_46762_c1 | nmdc:mga09592_46762_c1_1445_1810 | 103 |
| 23 | 3300050509 | nmdc:mga0qj67_16471_c1 | nmdc:mga0qj67_16471_c1_943_1308 | 103 |
| 24 | 3300050510 | nmdc:mga06r32_95021_c1 | nmdc:mga06r32_95021_c1_842_1207 | 103 |
| 25 | 3300050511 | nmdc:mga08y16_439914_c1 | nmdc:mga08y16_439914_c1_381_695 | 103 |
| 26 | 3300054114 | Ga0501084_0538236 | Ga0501084_0538236_508_822 | 103 |
| 27 | 3300005344 | Ga0070661_100000116 | Ga0070661_10000011632 | 105 |
| 28 | 3300025920 | Ga0207649_10000005 | Ga0207649_10000005117 | 105 |
| 29 | 3300031548 | Ga0307408_101852647 | Ga0307408_1018526472 | 106 |
| 30 | 3300031824 | Ga0307413_10579098 | Ga0307413_105790981 | 106 |
| 31 | 3300031852 | Ga0307410_10013646 | Ga0307410_100136467 | 106 |
| 32 | 3300031852 | Ga0307410_10903924 | Ga0307410_109039242 | 106 |
| 33 | 3300032004 | Ga0307414_11032872 | Ga0307414_110328722 | 106 |
| 34 | 3300032126 | Ga0307415_100275111 | Ga0307415_1002751112 | 106 |
| 35 | 3300003373 | JGI25407J50210_10072183 | JGI25407J50210_100721831 | 107 |
| 36 | 3300005981 | Ga0081538_10001069 | Ga0081538_1000106920 | 107 |
| 37 | 3300005981 | Ga0081538_10001141 | Ga0081538_100011413 | 107 |
| 38 | 3300013297 | Ga0157378_10042780 | Ga0157378_100427804 | 107 |
| 39 | 3300005544 | Ga0070686_101772627 | Ga0070686_1017726272 | 108 |
| 40 | 3300005549 | Ga0070704_101076059 | Ga0070704_1010760592 | 108 |
| 41 | 3300009098 | Ga0105245_10727283 | Ga0105245_107272832 | 108 |
| 42 | 3300009174 | Ga0105241_12193735 | Ga0105241_121937351 | 108 |
| 43 | 3300009176 | Ga0105242_10299352 | Ga0105242_102993521 | 108 |
| 44 | 3300009553 | Ga0105249_10830236 | Ga0105249_108302362 | 108 |
| 45 | 3300025927 | Ga0207687_10812948 | Ga0207687_108129482 | 108 |
| 46 | 3300026067 | Ga0207678_11915885 | Ga0207678_119158852 | 108 |
| 47 | 3300048906 | Ga0496103_0198353 | Ga0496103_0198353_420_773 | 108 |
| 48 | 3300005456 | Ga0070678_100001532 | Ga0070678_1000015329 | 110 |
| 49 | 3300005937 | Ga0081455_10010452 | Ga0081455_1001045211 | 111 |
| 50 | 3300005981 | Ga0081538_10000225 | Ga0081538_1000022557 | 111 |
| 51 | 3300048912 | Ga0496109_0726348 | Ga0496109_0726348_292_630 | 111 |
| 52 | 3300049584 | Ga0501068_0596304 | Ga0501068_0596304_172_513 | 111 |
| 53 | 3300005981 | Ga0081538_10105151 | Ga0081538_101051512 | 112 |
| 54 | 3300005981 | Ga0081538_10204785 | Ga0081538_102047852 | 112 |
| 55 | 3300049572 | Ga0501036_1120145 | Ga0501036_1120145_198_545 | 112 |
| 56 | 3300049574 | Ga0501038_0178453 | Ga0501038_0178453_1229_1576 | 112 |
| 57 | 3300049577 | Ga0501041_0090926 | Ga0501041_0090926_1191_1538 | 112 |
| 58 | 3300049579 | Ga0501043_1093640 | Ga0501043_1093640_56_403 | 112 |
| 59 | 3300049580 | Ga0501046_0316812 | Ga0501046_0316812_228_575 | 112 |
| 60 | 3300049588 | Ga0501072_0205862 | Ga0501072_0205862_502_849 | 112 |
| 61 | 3300049743 | Ga0501081_0012935 | Ga0501081_0012935_4634_4981 | 112 |
| 62 | 3300049822 | Ga0501035_0759925 | Ga0501035_0759925_250_597 | 112 |
| 63 | 3300049824 | Ga0501045_0071727 | Ga0501045_0071727_1993_2340 | 112 |
| 64 | 3300054114 | Ga0501084_1111604 | Ga0501084_1111604_112_459 | 112 |
| 65 | 3300060353 | Ga0501082_0080314 | Ga0501082_0080314_2423_2770 | 112 |
| 66 | 3300061734 | Ga0530510_0009169 | Ga0530510_0009169_6463_6810 | 112 |
| 67 | 3300005985 | Ga0081539_10195210 | Ga0081539_101952102 | 113 |
| 68 | 3300009147 | Ga0114129_11199854 | Ga0114129_111998542 | 113 |
| 69 | 3300031901 | Ga0307406_10017564 | Ga0307406_100175641 | 113 |
| 70 | 3300031911 | Ga0307412_10237783 | Ga0307412_102377832 | 113 |
| 71 | 3300032002 | Ga0307416_101376709 | Ga0307416_1013767091 | 113 |
| 72 | 3300032005 | Ga0307411_10035257 | Ga0307411_100352571 | 113 |
| 73 | 3300032126 | Ga0307415_100086073 | Ga0307415_1000860732 | 113 |
| 74 | 3300032133 | Ga0316583_10172192 | Ga0316583_101721922 | 113 |
| 75 | 3300035398 | Ga0316574_0260074 | Ga0316574_0260074_510_854 | 113 |
| 76 | 3300037588 | Ga0316581_0050232 | Ga0316581_0050232_701_1045 | 113 |
| 77 | 3300045976 | Ga0466967_1791246 | Ga0466967_1791246_193_540 | 113 |
| 78 | 3300046558 | Ga0495633_0556921 | Ga0495633_0556921_156_500 | 113 |
| 79 | 3300049569 | Ga0501032_0554350 | Ga0501032_0554350_134_493 | 113 |
| 80 | 3300049571 | Ga0501034_1222330 | Ga0501034_1222330_131_475 | 113 |
| 81 | 3300049574 | Ga0501038_1254626 | Ga0501038_1254626_99_458 | 113 |
| 82 | 3300049578 | Ga0501042_0845259 | Ga0501042_0845259_281_640 | 113 |
| 83 | 3300049591 | Ga0501075_0249315 | Ga0501075_0249315_105_464 | 113 |
| 84 | 3300049741 | Ga0501079_0511588 | Ga0501079_0511588_223_582 | 113 |
| 85 | 3300049742 | Ga0501080_1181302 | Ga0501080_1181302_238_597 | 113 |
| 86 | 3300005440 | Ga0070705_100555312 | Ga0070705_1005553122 | 114 |
| 87 | 3300005456 | Ga0070678_100036225 | Ga0070678_1000362253 | 114 |
| 88 | 3300005718 | Ga0068866_11239830 | Ga0068866_112398301 | 114 |
| 89 | 3300005985 | Ga0081539_10002515 | Ga0081539_1000251529 | 114 |
| 90 | 3300006051 | Ga0075364_10266311 | Ga0075364_102663112 | 114 |
| 91 | 3300006844 | Ga0075428_100417263 | Ga0075428_1004172632 | 114 |
| 92 | 3300006846 | Ga0075430_100250974 | Ga0075430_1002509742 | 114 |
| 93 | 3300006847 | Ga0075431_100029806 | Ga0075431_1000298065 | 114 |
| 94 | 3300006847 | Ga0075431_100052790 | Ga0075431_1000527902 | 114 |
| 95 | 3300009553 | Ga0105249_10207229 | Ga0105249_102072292 | 114 |
| 96 | 3300041451 | Ga0451791_1693705 | Ga0451791_1693705_190_537 | 114 |
| 97 | 3300041505 | Ga0451849_0675551 | Ga0451849_0675551_227_574 | 114 |
| 98 | 3300046459 | Ga0495629_0009096 | Ga0495629_0009096_5022_5369 | 114 |
| 99 | 3300046463 | Ga0495653_0031504 | Ga0495653_0031504_2597_2944 | 114 |
| 100 | 3300047321 | Ga0495676_0032711 | Ga0495676_0032711_2463_2810 | 114 |
| 101 | 3300048910 | Ga0496107_0245994 | Ga0496107_0245994_504_851 | 114 |
| 102 | 3300048912 | Ga0496109_0555261 | Ga0496109_0555261_574_921 | 114 |
| 103 | 3300048913 | Ga0496110_0501414 | Ga0496110_0501414_196_543 | 114 |
| 104 | 3300048913 | Ga0496110_0589678 | Ga0496110_0589678_491_838 | 114 |
| 105 | 3300048914 | Ga0496111_0081106 | Ga0496111_0081106_1849_2196 | 114 |
| 106 | 3300048917 | Ga0496114_1128978 | Ga0496114_1128978_70_417 | 114 |
| 107 | 3300049576 | Ga0501040_0313494 | Ga0501040_0313494_168_512 | 114 |
| 108 | 3300049577 | Ga0501041_0464795 | Ga0501041_0464795_101_445 | 114 |
| 109 | 3300049582 | Ga0501048_1204304 | Ga0501048_1204304_30_380 | 114 |
| 110 | 3300050490 | nmdc:mga03n38_127354_c1 | nmdc:mga03n38_127354_c1_247_594 | 114 |
| 111 | 3300050510 | nmdc:mga06r32_43951_c1 | nmdc:mga06r32_43951_c1_2357_2701 | 114 |
| 112 | 3300050511 | nmdc:mga08y16_1551619_c1 | nmdc:mga08y16_1551619_c1_245_592 | 114 |
| 113 | 3300053077 | Ga0495601_0137921 | Ga0495601_0137921_521_868 | 114 |
| 114 | 3300002074 | JGI24748J21848_1000424 | JGI24748J21848_10004247 | 115 |
| 115 | 3300002239 | JGI24034J26672_10000864 | JGI24034J26672_100008642 | 115 |
| 116 | 3300002244 | JGI24742J22300_10001949 | JGI24742J22300_100019493 | 115 |
| 117 | 3300005328 | Ga0070676_10443795 | Ga0070676_104437951 | 115 |
| 118 | 3300005329 | Ga0070683_100006125 | Ga0070683_10000612511 | 115 |
| 119 | 3300005333 | Ga0070677_10000163 | Ga0070677_1000016318 | 115 |
| 120 | 3300005333 | Ga0070677_10910541 | Ga0070677_109105411 | 115 |
| 121 | 3300005337 | Ga0070682_100000077 | Ga0070682_10000007723 | 115 |
| 122 | 3300005337 | Ga0070682_100193627 | Ga0070682_1001936272 | 115 |
| 123 | 3300005340 | Ga0070689_100075918 | Ga0070689_1000759183 | 115 |
| 124 | 3300005345 | Ga0070692_10743780 | Ga0070692_107437802 | 115 |
| 125 | 3300005347 | Ga0070668_100892596 | Ga0070668_1008925962 | 115 |
| 126 | 3300005365 | Ga0070688_100151527 | Ga0070688_1001515273 | 115 |
| 127 | 3300005366 | Ga0070659_100009046 | Ga0070659_1000090467 | 115 |
| 128 | 3300005367 | Ga0070667_100085406 | Ga0070667_1000854063 | 115 |
| 129 | 3300005441 | Ga0070700_100252279 | Ga0070700_1002522792 | 115 |
| 130 | 3300005444 | Ga0070694_100622786 | Ga0070694_1006227862 | 115 |
| 131 | 3300005455 | Ga0070663_100099405 | Ga0070663_1000994052 | 115 |
| 132 | 3300005458 | Ga0070681_10033752 | Ga0070681_100337524 | 115 |
| 133 | 3300005459 | Ga0068867_100671961 | Ga0068867_1006719612 | 115 |
| 134 | 3300005466 | Ga0070685_10001592 | Ga0070685_1000159214 | 115 |
| 135 | 3300005466 | Ga0070685_10275582 | Ga0070685_102755823 | 115 |
| 136 | 3300005471 | Ga0070698_101646735 | Ga0070698_1016467351 | 115 |
| 137 | 3300005530 | Ga0070679_100000487 | Ga0070679_10000048723 | 115 |
| 138 | 3300005535 | Ga0070684_100017747 | Ga0070684_1000177476 | 115 |
| 139 | 3300005535 | Ga0070684_100031509 | Ga0070684_1000315092 | 115 |
| 140 | 3300005535 | Ga0070684_100108093 | Ga0070684_1001080933 | 115 |
| 141 | 3300005539 | Ga0068853_100004202 | Ga0068853_10000420212 | 115 |
| 142 | 3300005539 | Ga0068853_100077288 | Ga0068853_1000772884 | 115 |
| 143 | 3300005543 | Ga0070672_100008239 | Ga0070672_1000082395 | 115 |
| 144 | 3300005545 | Ga0070695_100036840 | Ga0070695_1000368404 | 115 |
| 145 | 3300005548 | Ga0070665_100000341 | Ga0070665_10000034144 | 115 |
| 146 | 3300005564 | Ga0070664_100075757 | Ga0070664_1000757575 | 115 |
| 147 | 3300005578 | Ga0068854_100104593 | Ga0068854_1001045934 | 115 |
| 148 | 3300005614 | Ga0068856_100011212 | Ga0068856_1000112123 | 115 |
| 149 | 3300005614 | Ga0068856_100100573 | Ga0068856_1001005735 | 115 |
| 150 | 3300005614 | Ga0068856_100324905 | Ga0068856_1003249051 | 115 |
| 151 | 3300005614 | Ga0068856_101085585 | Ga0068856_1010855852 | 115 |
| 152 | 3300005615 | Ga0070702_100114066 | Ga0070702_1001140662 | 115 |
| 153 | 3300005616 | Ga0068852_100311262 | Ga0068852_1003112622 | 115 |
| 154 | 3300005718 | Ga0068866_10033436 | Ga0068866_100334363 | 115 |
| 155 | 3300005719 | Ga0068861_100210122 | Ga0068861_1002101224 | 115 |
| 156 | 3300005719 | Ga0068861_100931126 | Ga0068861_1009311261 | 115 |
| 157 | 3300005834 | Ga0068851_10000248 | Ga0068851_1000024823 | 115 |
| 158 | 3300005834 | Ga0068851_10240210 | Ga0068851_102402102 | 115 |
| 159 | 3300005841 | Ga0068863_100055760 | Ga0068863_1000557605 | 115 |
| 160 | 3300005842 | Ga0068858_100000088 | Ga0068858_10000008846 | 115 |
| 161 | 3300005842 | Ga0068858_100000251 | Ga0068858_10000025114 | 115 |
| 162 | 3300005981 | Ga0081538_10002516 | Ga0081538_1000251616 | 115 |
| 163 | 3300005985 | Ga0081539_10025600 | Ga0081539_100256006 | 115 |
| 164 | 3300006038 | Ga0075365_10001514 | Ga0075365_100015143 | 115 |
| 165 | 3300006038 | Ga0075365_10954997 | Ga0075365_109549972 | 115 |
| 166 | 3300006051 | Ga0075364_10020834 | Ga0075364_100208343 | 115 |
| 167 | 3300006175 | Ga0070712_100000339 | Ga0070712_10000033915 | 115 |
| 168 | 3300006237 | Ga0097621_102083625 | Ga0097621_1020836252 | 115 |
| 169 | 3300006358 | Ga0068871_100226848 | Ga0068871_1002268484 | 115 |
| 170 | 3300006844 | Ga0075428_100134290 | Ga0075428_1001342904 | 115 |
| 171 | 3300006844 | Ga0075428_101215411 | Ga0075428_1012154111 | 115 |
| 172 | 3300006846 | Ga0075430_100211300 | Ga0075430_1002113002 | 115 |
| 173 | 3300006846 | Ga0075430_100473258 | Ga0075430_1004732584 | 115 |
| 174 | 3300006847 | Ga0075431_100032360 | Ga0075431_1000323603 | 115 |
| 175 | 3300006852 | Ga0075433_10000057 | Ga0075433_1000005736 | 115 |
| 176 | 3300006852 | Ga0075433_11738839 | Ga0075433_117388391 | 115 |
| 177 | 3300006880 | Ga0075429_100017950 | Ga0075429_1000179506 | 115 |
| 178 | 3300006881 | Ga0068865_100000019 | Ga0068865_10000001960 | 115 |
| 179 | 3300009093 | Ga0105240_10422842 | Ga0105240_104228423 | 115 |
| 180 | 3300009094 | Ga0111539_10457430 | Ga0111539_104574302 | 115 |
| 181 | 3300009094 | Ga0111539_11343820 | Ga0111539_113438202 | 115 |
| 182 | 3300009094 | Ga0111539_11976015 | Ga0111539_119760152 | 115 |
| 183 | 3300009094 | Ga0111539_12415713 | Ga0111539_124157131 | 115 |
| 184 | 3300009098 | Ga0105245_10000151 | Ga0105245_1000015132 | 115 |
| 185 | 3300009098 | Ga0105245_10009133 | Ga0105245_100091339 | 115 |
| 186 | 3300009098 | Ga0105245_10012189 | Ga0105245_100121892 | 115 |
| 187 | 3300009098 | Ga0105245_10144075 | Ga0105245_101440752 | 115 |
| 188 | 3300009098 | Ga0105245_10659415 | Ga0105245_106594152 | 115 |
| 189 | 3300009101 | Ga0105247_10000204 | Ga0105247_1000020434 | 115 |
| 190 | 3300009101 | Ga0105247_10008346 | Ga0105247_100083467 | 115 |
| 191 | 3300009147 | Ga0114129_10002947 | Ga0114129_100029477 | 115 |
| 192 | 3300009147 | Ga0114129_10371251 | Ga0114129_103712514 | 115 |
| 193 | 3300009147 | Ga0114129_11663623 | Ga0114129_116636232 | 115 |
| 194 | 3300009147 | Ga0114129_12649136 | Ga0114129_126491362 | 115 |
| 195 | 3300009176 | Ga0105242_10000104 | Ga0105242_1000010447 | 115 |
| 196 | 3300009177 | Ga0105248_10000126 | Ga0105248_1000012654 | 115 |
| 197 | 3300009545 | Ga0105237_10359668 | Ga0105237_103596682 | 115 |
| 198 | 3300009545 | Ga0105237_10807538 | Ga0105237_108075382 | 115 |
| 199 | 3300009551 | Ga0105238_10000172 | Ga0105238_1000017251 | 115 |
| 200 | 3300009553 | Ga0105249_10000371 | Ga0105249_1000037117 | 115 |
| 201 | 3300010375 | Ga0105239_10161746 | Ga0105239_101617463 | 115 |
| 202 | 3300010375 | Ga0105239_10285209 | Ga0105239_102852091 | 115 |
| 203 | 3300010375 | Ga0105239_13233133 | Ga0105239_132331332 | 115 |
| 204 | 3300011119 | Ga0105246_10207411 | Ga0105246_102074113 | 115 |
| 205 | 3300012515 | Ga0157338_1055693 | Ga0157338_10556931 | 115 |
| 206 | 3300013102 | Ga0157371_10000909 | Ga0157371_1000090919 | 115 |
| 207 | 3300013104 | Ga0157370_10007913 | Ga0157370_100079136 | 115 |
| 208 | 3300013104 | Ga0157370_10029815 | Ga0157370_100298156 | 115 |
| 209 | 3300013105 | Ga0157369_10000135 | Ga0157369_1000013581 | 115 |
| 210 | 3300013296 | Ga0157374_10132308 | Ga0157374_101323084 | 115 |
| 211 | 3300013306 | Ga0163162_10030535 | Ga0163162_100305352 | 115 |
| 212 | 3300013308 | Ga0157375_10001783 | Ga0157375_100017832 | 115 |
| 213 | 3300013308 | Ga0157375_10006973 | Ga0157375_100069738 | 115 |
| 214 | 3300014325 | Ga0163163_10310888 | Ga0163163_103108882 | 115 |
| 215 | 3300014497 | Ga0182008_10605085 | Ga0182008_106050852 | 115 |
| 216 | 3300014968 | Ga0157379_10006279 | Ga0157379_100062799 | 115 |
| 217 | 3300017792 | Ga0163161_10040024 | Ga0163161_100400244 | 115 |
| 218 | 3300025321 | Ga0207656_10000105 | Ga0207656_1000010519 | 115 |
| 219 | 3300025321 | Ga0207656_10398386 | Ga0207656_103983862 | 115 |
| 220 | 3300025893 | Ga0207682_10003413 | Ga0207682_100034134 | 115 |
| 221 | 3300025893 | Ga0207682_10607670 | Ga0207682_106076701 | 115 |
| 222 | 3300025899 | Ga0207642_10020194 | Ga0207642_100201944 | 115 |
| 223 | 3300025900 | Ga0207710_10000457 | Ga0207710_1000045718 | 115 |
| 224 | 3300025908 | Ga0207643_10074924 | Ga0207643_100749243 | 115 |
| 225 | 3300025909 | Ga0207705_10279905 | Ga0207705_102799053 | 115 |
| 226 | 3300025912 | Ga0207707_10023070 | Ga0207707_100230704 | 115 |
| 227 | 3300025913 | Ga0207695_10243373 | Ga0207695_102433733 | 115 |
| 228 | 3300025914 | Ga0207671_10271497 | Ga0207671_102714972 | 115 |
| 229 | 3300025915 | Ga0207693_10002524 | Ga0207693_1000252416 | 115 |
| 230 | 3300025921 | Ga0207652_10000658 | Ga0207652_1000065823 | 115 |
| 231 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004935 | 115 |
| 232 | 3300025927 | Ga0207687_10000037 | Ga0207687_1000003755 | 115 |
| 233 | 3300025927 | Ga0207687_10000167 | Ga0207687_1000016746 | 115 |
| 234 | 3300025927 | Ga0207687_10004633 | Ga0207687_1000463311 | 115 |
| 235 | 3300025927 | Ga0207687_10496179 | Ga0207687_104961792 | 115 |
| 236 | 3300025932 | Ga0207690_10052909 | Ga0207690_100529092 | 115 |
| 237 | 3300025932 | Ga0207690_10350217 | Ga0207690_103502171 | 115 |
| 238 | 3300025934 | Ga0207686_10000063 | Ga0207686_1000006333 | 115 |
| 239 | 3300025936 | Ga0207670_10238103 | Ga0207670_102381033 | 115 |
| 240 | 3300025938 | Ga0207704_10000009 | Ga0207704_1000000930 | 115 |
| 241 | 3300025938 | Ga0207704_11537124 | Ga0207704_115371241 | 115 |
| 242 | 3300025940 | Ga0207691_10043696 | Ga0207691_100436965 | 115 |
| 243 | 3300025941 | Ga0207711_10000024 | Ga0207711_10000024166 | 115 |
| 244 | 3300025944 | Ga0207661_10003140 | Ga0207661_1000314010 | 115 |
| 245 | 3300025944 | Ga0207661_10004159 | Ga0207661_100041598 | 115 |
| 246 | 3300025944 | Ga0207661_10004202 | Ga0207661_1000420211 | 115 |
| 247 | 3300025945 | Ga0207679_10056661 | Ga0207679_100566615 | 115 |
| 248 | 3300025961 | Ga0207712_10000037 | Ga0207712_10000037161 | 115 |
| 249 | 3300025972 | Ga0207668_10350188 | Ga0207668_103501882 | 115 |
| 250 | 3300025972 | Ga0207668_10619670 | Ga0207668_106196703 | 115 |
| 251 | 3300025972 | Ga0207668_11864915 | Ga0207668_118649152 | 115 |
| 252 | 3300025981 | Ga0207640_10197106 | Ga0207640_101971064 | 115 |
| 253 | 3300025986 | Ga0207658_10057755 | Ga0207658_100577554 | 115 |
| 254 | 3300026035 | Ga0207703_10000128 | Ga0207703_1000012839 | 115 |
| 255 | 3300026035 | Ga0207703_10000237 | Ga0207703_1000023760 | 115 |
| 256 | 3300026035 | Ga0207703_11518816 | Ga0207703_115188162 | 115 |
| 257 | 3300026041 | Ga0207639_10031439 | Ga0207639_100314392 | 115 |
| 258 | 3300026041 | Ga0207639_10109156 | Ga0207639_101091564 | 115 |
| 259 | 3300026067 | Ga0207678_10081698 | Ga0207678_100816983 | 115 |
| 260 | 3300026075 | Ga0207708_10105334 | Ga0207708_101053344 | 115 |
| 261 | 3300026075 | Ga0207708_10376523 | Ga0207708_103765232 | 115 |
| 262 | 3300026075 | Ga0207708_10401839 | Ga0207708_104018392 | 115 |
| 263 | 3300026078 | Ga0207702_10004618 | Ga0207702_1000461811 | 115 |
| 264 | 3300026078 | Ga0207702_10009477 | Ga0207702_1000947712 | 115 |
| 265 | 3300026088 | Ga0207641_10011355 | Ga0207641_100113554 | 115 |
| 266 | 3300026116 | Ga0207674_10588234 | Ga0207674_105882343 | 115 |
| 267 | 3300026118 | Ga0207675_100268526 | Ga0207675_1002685264 | 115 |
| 268 | 3300026121 | Ga0207683_10004976 | Ga0207683_1000497615 | 115 |
| 269 | 3300026142 | Ga0207698_10000009 | Ga0207698_1000000912 | 115 |
| 270 | 3300028379 | Ga0268266_10000020 | Ga0268266_10000020421 | 115 |
| 271 | 3300028556 | Ga0265337_1000126 | Ga0265337_10001263 | 115 |
| 272 | 3300028558 | Ga0265326_10000144 | Ga0265326_1000014437 | 115 |
| 273 | 3300028654 | Ga0265322_10000009 | Ga0265322_1000000978 | 115 |
| 274 | 3300028666 | Ga0265336_10001991 | Ga0265336_100019913 | 115 |
| 275 | 3300029957 | Ga0265324_10000389 | Ga0265324_1000038912 | 115 |
| 276 | 3300031238 | Ga0265332_10009925 | Ga0265332_100099254 | 115 |
| 277 | 3300031239 | Ga0265328_10003668 | Ga0265328_100036684 | 115 |
| 278 | 3300031240 | Ga0265320_10000024 | Ga0265320_1000002497 | 115 |
| 279 | 3300031242 | Ga0265329_10002956 | Ga0265329_100029564 | 115 |
| 280 | 3300031250 | Ga0265331_10000894 | Ga0265331_100008944 | 115 |
| 281 | 3300031251 | Ga0265327_10000227 | Ga0265327_1000022798 | 115 |
| 282 | 3300031456 | Ga0307513_10200942 | Ga0307513_102009422 | 115 |
| 283 | 3300031548 | Ga0307408_102239780 | Ga0307408_1022397801 | 115 |
| 284 | 3300031595 | Ga0265313_10132788 | Ga0265313_101327883 | 115 |
| 285 | 3300031711 | Ga0265314_10000570 | Ga0265314_1000057038 | 115 |
| 286 | 3300031731 | Ga0307405_10146923 | Ga0307405_101469232 | 115 |
| 287 | 3300031824 | Ga0307413_10631031 | Ga0307413_106310312 | 115 |
| 288 | 3300031852 | Ga0307410_10092719 | Ga0307410_100927192 | 115 |
| 289 | 3300031901 | Ga0307406_10183620 | Ga0307406_101836201 | 115 |
| 290 | 3300031901 | Ga0307406_10193784 | Ga0307406_101937842 | 115 |
| 291 | 3300031903 | Ga0307407_10330819 | Ga0307407_103308192 | 115 |
| 292 | 3300031995 | Ga0307409_100003787 | Ga0307409_1000037872 | 115 |
| 293 | 3300031995 | Ga0307409_100105430 | Ga0307409_1001054303 | 115 |
| 294 | 3300031995 | Ga0307409_100460327 | Ga0307409_1004603272 | 115 |
| 295 | 3300032002 | Ga0307416_100043256 | Ga0307416_1000432563 | 115 |
| 296 | 3300032002 | Ga0307416_100248201 | Ga0307416_1002482012 | 115 |
| 297 | 3300032004 | Ga0307414_10203364 | Ga0307414_102033642 | 115 |
| 298 | 3300032004 | Ga0307414_10433424 | Ga0307414_104334242 | 115 |
| 299 | 3300032126 | Ga0307415_100015759 | Ga0307415_1000157592 | 115 |
| 300 | 3300032126 | Ga0307415_100417285 | Ga0307415_1004172852 | 115 |
| 301 | 3300032126 | Ga0307415_101818131 | Ga0307415_1018181312 | 115 |
| 302 | 3300032133 | Ga0316583_10209663 | Ga0316583_102096632 | 115 |
| 303 | 3300035086 | Ga0373934_0458073 | Ga0373934_0458073_174_521 | 115 |
| 304 | 3300036401 | Ga0373937_0034652 | Ga0373937_0034652_2991_3338 | 115 |
| 305 | 3300036401 | Ga0373937_0694597 | Ga0373937_0694597_434_781 | 115 |
| 306 | 3300037466 | Ga0395898_1627038 | Ga0395898_1627038_25_384 | 115 |
| 307 | 3300038443 | Ga0395901_1051708 | Ga0395901_1051708_120_476 | 115 |
| 308 | 3300041486 | Ga0451807_2458407 | Ga0451807_2458407_87_437 | 115 |
| 309 | 3300041505 | Ga0451849_0893674 | Ga0451849_0893674_125_475 | 115 |
| 310 | 3300041512 | Ga0451853_1408135 | Ga0451853_1408135_1354_1701 | 115 |
| 311 | 3300041512 | Ga0451853_2463998 | Ga0451853_2463998_160_522 | 115 |
| 312 | 3300044694 | Ga0466963_0000007 | Ga0466963_0000007_53240_53587 | 115 |
| 313 | 3300044694 | Ga0466963_0036775 | Ga0466963_0036775_2115_2465 | 115 |
| 314 | 3300044842 | Ga0466957_0000177 | Ga0466957_0000177_17083_17433 | 115 |
| 315 | 3300044842 | Ga0466957_0051133 | Ga0466957_0051133_731_1081 | 115 |
| 316 | 3300044842 | Ga0466957_0162529 | Ga0466957_0162529_641_991 | 115 |
| 317 | 3300044901 | Ga0466960_0126099 | Ga0466960_0126099_519_878 | 115 |
| 318 | 3300044901 | Ga0466960_0610652 | Ga0466960_0610652_10_369 | 115 |
| 319 | 3300045976 | Ga0466967_0000005 | Ga0466967_0000005_73680_74030 | 115 |
| 320 | 3300045976 | Ga0466967_0119892 | Ga0466967_0119892_1067_1426 | 115 |
| 321 | 3300046455 | Ga0495603_0000271 | Ga0495603_0000271_7717_8070 | 115 |
| 322 | 3300046455 | Ga0495603_0001209 | Ga0495603_0001209_7003_7350 | 115 |
| 323 | 3300046459 | Ga0495629_0013866 | Ga0495629_0013866_1211_1561 | 115 |
| 324 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_478904_479251 | 115 |
| 325 | 3300046462 | Ga0495651_0287192 | Ga0495651_0287192_689_1039 | 115 |
| 326 | 3300046473 | Ga0495582_0670165 | Ga0495582_0670165_164_514 | 115 |
| 327 | 3300046476 | Ga0495662_0000519 | Ga0495662_0000519_10600_10950 | 115 |
| 328 | 3300046477 | Ga0495664_0183073 | Ga0495664_0183073_477_827 | 115 |
| 329 | 3300046491 | Ga0495584_0365696 | Ga0495584_0365696_16_372 | 115 |
| 330 | 3300046511 | Ga0495608_0010249 | Ga0495608_0010249_338_685 | 115 |
| 331 | 3300046511 | Ga0495608_0284540 | Ga0495608_0284540_567_914 | 115 |
| 332 | 3300046513 | Ga0495616_0273196 | Ga0495616_0273196_41_397 | 115 |
| 333 | 3300046515 | Ga0495620_0000747 | Ga0495620_0000747_12342_12689 | 115 |
| 334 | 3300046516 | Ga0495628_1063669 | Ga0495628_1063669_84_431 | 115 |
| 335 | 3300046523 | Ga0495644_0000499 | Ga0495644_0000499_11986_12336 | 115 |
| 336 | 3300046525 | Ga0495663_0180621 | Ga0495663_0180621_147_503 | 115 |
| 337 | 3300046535 | Ga0495586_0000537 | Ga0495586_0000537_16365_16712 | 115 |
| 338 | 3300046536 | Ga0495587_0012635 | Ga0495587_0012635_4678_5028 | 115 |
| 339 | 3300046537 | Ga0495598_0137730 | Ga0495598_0137730_106_462 | 115 |
| 340 | 3300046538 | Ga0495609_0127648 | Ga0495609_0127648_414_770 | 115 |
| 341 | 3300046539 | Ga0495621_0000709 | Ga0495621_0000709_737_1084 | 115 |
| 342 | 3300046543 | Ga0495645_0054401 | Ga0495645_0054401_82_429 | 115 |
| 343 | 3300046559 | Ga0495667_0000421 | Ga0495667_0000421_26633_26983 | 115 |
| 344 | 3300046615 | Ga0495656_0000196 | Ga0495656_0000196_2414_2761 | 115 |
| 345 | 3300046615 | Ga0495656_0830127 | Ga0495656_0830127_64_423 | 115 |
| 346 | 3300046616 | Ga0495668_0397106 | Ga0495668_0397106_168_524 | 115 |
| 347 | 3300046642 | Ga0495634_0001221 | Ga0495634_0001221_8096_8443 | 115 |
| 348 | 3300046642 | Ga0495634_0208160 | Ga0495634_0208160_235_582 | 115 |
| 349 | 3300046642 | Ga0495634_0238493 | Ga0495634_0238493_236_583 | 115 |
| 350 | 3300046680 | Ga0495646_0452025 | Ga0495646_0452025_162_512 | 115 |
| 351 | 3300046683 | Ga0495658_0000438 | Ga0495658_0000438_18720_19070 | 115 |
| 352 | 3300046683 | Ga0495658_0692010 | Ga0495658_0692010_200_553 | 115 |
| 353 | 3300046684 | Ga0495669_0000083 | Ga0495669_0000083_40108_40455 | 115 |
| 354 | 3300046684 | Ga0495669_0288540 | Ga0495669_0288540_321_671 | 115 |
| 355 | 3300046689 | Ga0495613_0491745 | Ga0495613_0491745_37_390 | 115 |
| 356 | 3300046689 | Ga0495613_1051659 | Ga0495613_1051659_124_471 | 115 |
| 357 | 3300046691 | Ga0495670_0316295 | Ga0495670_0316295_248_607 | 115 |
| 358 | 3300046694 | Ga0495649_0032859 | Ga0495649_0032859_305_652 | 115 |
| 359 | 3300047317 | Ga0495604_0000413 | Ga0495604_0000413_14218_14565 | 115 |
| 360 | 3300047321 | Ga0495676_0000752 | Ga0495676_0000752_15220_15570 | 115 |
| 361 | 3300047321 | Ga0495676_0001446 | Ga0495676_0001446_17691_18038 | 115 |
| 362 | 3300047321 | Ga0495676_0295258 | Ga0495676_0295258_516_869 | 115 |
| 363 | 3300047322 | Ga0495680_0000599 | Ga0495680_0000599_22180_22527 | 115 |
| 364 | 3300047322 | Ga0495680_0003986 | Ga0495680_0003986_136_486 | 115 |
| 365 | 3300047322 | Ga0495680_0110150 | Ga0495680_0110150_358_708 | 115 |
| 366 | 3300047445 | Ga0495677_0392540 | Ga0495677_0392540_68_427 | 115 |
| 367 | 3300047446 | Ga0495679_019372 | Ga0495679_019372_63_410 | 115 |
| 368 | 3300047469 | Ga0495673_0089273 | Ga0495673_0089273_542_892 | 115 |
| 369 | 3300047673 | Ga0495593_0312083 | Ga0495593_0312083_50_400 | 115 |
| 370 | 3300048903 | Ga0496100_0000007 | Ga0496100_0000007_234788_235135 | 115 |
| 371 | 3300048904 | Ga0496101_0000013 | Ga0496101_0000013_234788_235135 | 115 |
| 372 | 3300048905 | Ga0496102_0000045 | Ga0496102_0000045_30523_30873 | 115 |
| 373 | 3300048905 | Ga0496102_0274546 | Ga0496102_0274546_581_931 | 115 |
| 374 | 3300048906 | Ga0496103_0000050 | Ga0496103_0000050_121160_121510 | 115 |
| 375 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_423010_423360 | 115 |
| 376 | 3300048907 | Ga0496104_0000013 | Ga0496104_0000013_26222_26599 | 115 |
| 377 | 3300048907 | Ga0496104_1407458 | Ga0496104_1407458_118_465 | 115 |
| 378 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_904819_905169 | 115 |
| 379 | 3300048908 | Ga0496105_0000006 | Ga0496105_0000006_370565_370942 | 115 |
| 380 | 3300048908 | Ga0496105_0034415 | Ga0496105_0034415_2262_2609 | 115 |
| 381 | 3300048909 | Ga0496106_0000006 | Ga0496106_0000006_228927_229274 | 115 |
| 382 | 3300048910 | Ga0496107_0000007 | Ga0496107_0000007_228929_229276 | 115 |
| 383 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_37875_38222 | 115 |
| 384 | 3300048911 | Ga0496108_0000094 | Ga0496108_0000094_54346_54696 | 115 |
| 385 | 3300048911 | Ga0496108_0001965 | Ga0496108_0001965_13883_14233 | 115 |
| 386 | 3300048911 | Ga0496108_0003686 | Ga0496108_0003686_5631_5978 | 115 |
| 387 | 3300048912 | Ga0496109_0000006 | Ga0496109_0000006_37875_38222 | 115 |
| 388 | 3300048912 | Ga0496109_0000024 | Ga0496109_0000024_156486_156836 | 115 |
| 389 | 3300048912 | Ga0496109_0000285 | Ga0496109_0000285_5669_6016 | 115 |
| 390 | 3300048912 | Ga0496109_0077493 | Ga0496109_0077493_57_407 | 115 |
| 391 | 3300048912 | Ga0496109_0127876 | Ga0496109_0127876_1245_1607 | 115 |
| 392 | 3300048912 | Ga0496109_1488317 | Ga0496109_1488317_108_458 | 115 |
| 393 | 3300048913 | Ga0496110_0000338 | Ga0496110_0000338_11908_12258 | 115 |
| 394 | 3300048913 | Ga0496110_0010361 | Ga0496110_0010361_6277_6624 | 115 |
| 395 | 3300048914 | Ga0496111_0000199 | Ga0496111_0000199_15812_16162 | 115 |
| 396 | 3300048916 | Ga0496113_0028160 | Ga0496113_0028160_2196_2543 | 115 |
| 397 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_89764_90114 | 115 |
| 398 | 3300048917 | Ga0496114_0116555 | Ga0496114_0116555_848_1195 | 115 |
| 399 | 3300048918 | Ga0496115_0000071 | Ga0496115_0000071_34178_34528 | 115 |
| 400 | 3300048918 | Ga0496115_0000263 | Ga0496115_0000263_29312_29662 | 115 |
| 401 | 3300048922 | Ga0496119_0008717 | Ga0496119_0008717_7654_8004 | 115 |
| 402 | 3300048928 | Ga0496125_0031965 | Ga0496125_0031965_4191_4538 | 115 |
| 403 | 3300049568 | Ga0501031_0383098 | Ga0501031_0383098_456_815 | 115 |
| 404 | 3300049569 | Ga0501032_0314907 | Ga0501032_0314907_88_447 | 115 |
| 405 | 3300049572 | Ga0501036_0076319 | Ga0501036_0076319_1913_2272 | 115 |
| 406 | 3300049572 | Ga0501036_0560689 | Ga0501036_0560689_33_386 | 115 |
| 407 | 3300049576 | Ga0501040_0557388 | Ga0501040_0557388_61_420 | 115 |
| 408 | 3300049577 | Ga0501041_0016687 | Ga0501041_0016687_1709_2068 | 115 |
| 409 | 3300049578 | Ga0501042_0505592 | Ga0501042_0505592_249_608 | 115 |
| 410 | 3300049582 | Ga0501048_0064066 | Ga0501048_0064066_213_575 | 115 |
| 411 | 3300049584 | Ga0501068_0445988 | Ga0501068_0445988_309_659 | 115 |
| 412 | 3300049587 | Ga0501071_0515863 | Ga0501071_0515863_493_840 | 115 |
| 413 | 3300049587 | Ga0501071_1324083 | Ga0501071_1324083_73_432 | 115 |
| 414 | 3300049588 | Ga0501072_0086064 | Ga0501072_0086064_381_740 | 115 |
| 415 | 3300049589 | Ga0501073_0541682 | Ga0501073_0541682_94_444 | 115 |
| 416 | 3300049589 | Ga0501073_1103951 | Ga0501073_1103951_121_474 | 115 |
| 417 | 3300049591 | Ga0501075_0167775 | Ga0501075_0167775_55_402 | 115 |
| 418 | 3300049591 | Ga0501075_0285466 | Ga0501075_0285466_206_565 | 115 |
| 419 | 3300049592 | Ga0501076_0104447 | Ga0501076_0104447_339_698 | 115 |
| 420 | 3300049592 | Ga0501076_0258419 | Ga0501076_0258419_314_667 | 115 |
| 421 | 3300049742 | Ga0501080_0335087 | Ga0501080_0335087_628_987 | 115 |
| 422 | 3300049743 | Ga0501081_1048850 | Ga0501081_1048850_207_557 | 115 |
| 423 | 3300049824 | Ga0501045_0130160 | Ga0501045_0130160_584_943 | 115 |
| 424 | 3300050491 | nmdc:mga00v17_368774_c1 | nmdc:mga00v17_368774_c1_126_485 | 115 |
| 425 | 3300050492 | nmdc:mga0yw44_321694_c1 | nmdc:mga0yw44_321694_c1_288_638 | 115 |
| 426 | 3300050492 | nmdc:mga0yw44_859725_c1 | nmdc:mga0yw44_859725_c1_179_538 | 115 |
| 427 | 3300050507 | nmdc:mga05p37_2274_c1 | nmdc:mga05p37_2274_c1_1073_1438 | 115 |
| 428 | 3300050508 | nmdc:mga09592_250805_c1 | nmdc:mga09592_250805_c1_1138_1494 | 115 |
| 429 | 3300050508 | nmdc:mga09592_8747_c1 | nmdc:mga09592_8747_c1_3843_4208 | 115 |
| 430 | 3300050509 | nmdc:mga0qj67_22568_c1 | nmdc:mga0qj67_22568_c1_2745_3110 | 115 |
| 431 | 3300050509 | nmdc:mga0qj67_29388_c1 | nmdc:mga0qj67_29388_c1_3681_4031 | 115 |
| 432 | 3300050510 | nmdc:mga06r32_581270_c1 | nmdc:mga06r32_581270_c1_372_728 | 115 |
| 433 | 3300050511 | nmdc:mga08y16_223384_c1 | nmdc:mga08y16_223384_c1_653_1009 | 115 |
| 434 | 3300050512 | nmdc:mga0n895_1032810_c1 | nmdc:mga0n895_1032810_c1_36_383 | 115 |
| 435 | 3300050515 | nmdc:mga0a205_1_c2 | nmdc:mga0a205_1_c2_131056_131403 | 115 |
| 436 | 3300050515 | nmdc:mga0a205_2910_c1 | nmdc:mga0a205_2910_c1_12528_12875 | 115 |
| 437 | 3300053077 | Ga0495601_0000581 | Ga0495601_0000581_16891_17238 | 115 |
| 438 | 3300053078 | Ga0495612_0001629 | Ga0495612_0001629_3530_3877 | 115 |
| 439 | 3300053083 | Ga0495655_0000004 | Ga0495655_0000004_194524_194874 | 115 |
| 440 | 3300053083 | Ga0495655_0000489 | Ga0495655_0000489_4383_4733 | 115 |
| 441 | 3300053085 | Ga0495619_0000042 | Ga0495619_0000042_58201_58548 | 115 |
| 442 | 3300053085 | Ga0495619_0000098 | Ga0495619_0000098_17049_17399 | 115 |
| 443 | 3300053094 | Ga0500566_0008381 | Ga0500566_0008381_2404_2754 | 115 |
| 444 | 3300053129 | Ga0500628_000004 | Ga0500628_000004_102939_103289 | 115 |
| 445 | 3300060353 | Ga0501082_0054893 | Ga0501082_0054893_898_1257 | 115 |
| 446 | 3300060353 | Ga0501082_0779973 | Ga0501082_0779973_125_478 | 115 |
| 447 | 3300061734 | Ga0530510_0137350 | Ga0530510_0137350_432_791 | 115 |
| 448 | 3300061734 | Ga0530510_1406902 | Ga0530510_1406902_157_510 | 115 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gdz-assembly1.cif.gz_A-3 | crystal structure of a duf4251 family protein (bacegg_02002) from bacteroides eggerthii dsm 20697 at 1.95 a resolution | 0.6339 | 13 | 28 |
| 2p9p-assembly1.cif.gz_D | crystal structure of bovine arp2/3 complex co-crystallized with adp | 0.5702 | 13 | 29 |
| 7bi7-assembly2.cif.gz_B | an unexpected p-cluster like intermediate en route to the nitrogenase femo-co | 0.5689 | 60 | 86 |
| 7jma-assembly1.cif.gz_A | crystal structure of the apo form of nitrogenase iron-molybdenum cofactor biosynthesis enzyme nifb from methanothermobacter thermautotrophicus | 0.5689 | 60 | 86 |
| 2kgf-assembly1.cif.gz_A | n-terminal domain of capsid protein from the mason-pfizer monkey virus | 0.5436 | 14 | 42 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4E5E4_1_126_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7417 | 14 | 29 | 3.10.450.50 |
| af_Q8VHL1_66_110_2.20.110.10 | Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain | 0.7359 | 13 | 29 | 2.20.110.10 |
| 2x64A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.6399 | 69 | 107 | 3.40.30.10 |
| 4gdzA00 | Mainly Beta;Beta Barrel;Lipocalin; | 0.6338 | 13 | 28 | 2.40.128.410 |
| af_A0A0P0V6A3_155_242_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.5979 | 13 | 35 | 2.30.42.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7X2R3-F1-model_v4 | Uncharacterized protein | 0.9616 | 14 | 115 |
|
| AF-A0A1Q7X2R3-F1-model_v4 | Uncharacterized protein | 0.9346 | 14 | 115 |
|
| AF-A0A6N7YR80-F1-model_v4 | Uncharacterized protein | 0.9182 | 8 | 114 |
|
| AF-A0A7K0QQH5-F1-model_v4 | Uncharacterized protein | 0.9035 | 11 | 113 |
|
| AF-A0A537YLB5-F1-model_v4 | TipAS antibiotic-recognition domain-containing protein | 0.9016 | 1 | 115 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar