F446157

General Info

Members Datasets Scaffolds Average Seq Length
448 226 896 189

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10032921|Ga0105239_100329213
Length 231
Sequence MATLSGKKVAIITENGFEESELTSPKKALEEAGAQVDIISPQQQKVKAWDHDHWSIELPVNVNIDMAKPEDYDALVIPGGVMNPDQMRMNTKCVEFAQRFLEEGKPIAAICHGPQLLIETGLINGRTMTSYWSLKTDLQNAGVDWVDKEVVVDNGLVTSRSPKDLPAFNKKMIEEIKEGTHAPSGVHSFAKTLAIELIPVSRSVRAGFFLVFFDFFEIIIRFYSCVKKFTG

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
156 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
163 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
164 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
195 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
196 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
199 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
200 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
201 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
202 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
203 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
204 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
205 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
206 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
207 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
208 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
211 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
212 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
213 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
214 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
219 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
220 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 1.79
Rhizosphere 96.21
Stem 0
Stem Tuber 0
Unclassified 10.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10032921 3300010375 Bacteria 5695
2 MBSR1b_contig_12999027 2162886012 Unclassified 1679
3 MBSR1b_contig_13755480 2162886012 Unclassified 1204
4 ARcpr5yngRDRAFT_c003720 3300000043 Bacteria 1477
5 JGI24744J21845_10014815 3300002077 Bacteria 1562
6 rootL2_10101186 3300003322 Bacteria 5598
7 rootH1_10239146 3300003323 Bacteria 3256
8 Ga0065714_10016476 3300005288 Unclassified 1761
9 Ga0065715_10009925 3300005293 Bacteria 2550
10 Ga0070676_10000701 3300005328 Bacteria 16349
11 Ga0070683_100000327 3300005329 Bacteria 32861
12 Ga0070683_100025753 3300005329 Bacteria 5288
13 Ga0070683_100170865 3300005329 Bacteria 2063
14 Ga0070683_100424926 3300005329 Bacteria 1268
15 Ga0070683_100989393 3300005329 Bacteria 807
16 Ga0070690_100007060 3300005330 Bacteria 6408
17 Ga0070690_100288837 3300005330 Unclassified 1172
18 Ga0070670_100188351 3300005331 Bacteria 1792
19 Ga0070670_100563728 3300005331 Unclassified 1017
20 Ga0070670_100645097 3300005331 Bacteria 949
21 Ga0068869_100126241 3300005334 Bacteria 1962
22 Ga0068869_100141896 3300005334 Unclassified 1855
23 Ga0068869_100150615 3300005334 Bacteria 1804
24 Ga0068869_100388073 3300005334 Bacteria 1146
25 Ga0068869_100848410 3300005334 Bacteria 788
26 Ga0070666_10000571 3300005335 Bacteria 22346
27 Ga0070666_10003150 3300005335 Bacteria 10017
28 Ga0070666_10227166 3300005335 Bacteria 1318
29 Ga0070666_10340500 3300005335 Unclassified 1072
30 Ga0070682_100146006 3300005337 Bacteria 1618
31 Ga0068868_100000112 3300005338 Bacteria 50817
32 Ga0068868_100054664 3300005338 Bacteria 3147
33 Ga0068868_100064855 3300005338 Unclassified 2900
34 Ga0068868_100122970 3300005338 Bacteria 2117
35 Ga0068868_100163318 3300005338 Bacteria 1841
36 Ga0070660_100316253 3300005339 Bacteria 1282
37 Ga0070660_100350986 3300005339 Bacteria 1215
38 Ga0070689_100050956 3300005340 Bacteria 3198
39 Ga0070689_100561548 3300005340 Bacteria 984
40 Ga0070689_100819019 3300005340 Bacteria 820
41 Ga0070661_100001786 3300005344 Bacteria 14912
42 Ga0070661_100039375 3300005344 Bacteria 3444
43 Ga0070661_100059364 3300005344 Bacteria 2804
44 Ga0070661_100208146 3300005344 Bacteria 1496
45 Ga0070661_100315772 3300005344 Bacteria 1219
46 Ga0070668_100000110 3300005347 Bacteria 50766
47 Ga0070668_100606509 3300005347 Unclassified 958
48 Ga0070669_100165782 3300005353 Unclassified 1720
49 Ga0070675_100056010 3300005354 Bacteria 3247
50 Ga0070675_100060469 3300005354 Bacteria 3128
51 Ga0070675_100137926 3300005354 Bacteria 2083
52 Ga0070675_101007685 3300005354 Bacteria 765
53 Ga0070671_100022762 3300005355 Bacteria 5119
54 Ga0070671_100167619 3300005355 Bacteria 1857
55 Ga0070671_100736866 3300005355 Bacteria 856
56 Ga0070671_100896941 3300005355 Bacteria 774
57 Ga0070674_100046613 3300005356 Bacteria 2966
58 Ga0070674_100273104 3300005356 Bacteria 1337
59 Ga0070674_100988157 3300005356 Bacteria 738
60 Ga0070673_100001374 3300005364 Bacteria 14221
61 Ga0070673_100015009 3300005364 Bacteria 5421
62 Ga0070673_100049647 3300005364 Unclassified 3277
63 Ga0070673_100968070 3300005364 Unclassified 791
64 Ga0070688_100003958 3300005365 Bacteria 7681
65 Ga0070688_100241515 3300005365 Unclassified 1282
66 Ga0070659_100012802 3300005366 Bacteria 6228
67 Ga0070659_100023860 3300005366 Bacteria 4685
68 Ga0070659_100419250 3300005366 Bacteria 1132
69 Ga0070667_100011085 3300005367 Bacteria 7457
70 Ga0070667_100018912 3300005367 Bacteria 5712
71 Ga0070667_100217478 3300005367 Bacteria 1700
72 Ga0070667_100218342 3300005367 Bacteria 1696
73 Ga0070663_100176331 3300005455 Bacteria 1655
74 Ga0070663_100364528 3300005455 Bacteria 1173
75 Ga0070678_100014347 3300005456 Bacteria 4997
76 Ga0070678_100167177 3300005456 Bacteria 1788
77 Ga0070662_100000209 3300005457 Bacteria 34168
78 Ga0070662_100018140 3300005457 Bacteria 4757
79 Ga0070662_100022389 3300005457 Bacteria 4327
80 Ga0070662_100023895 3300005457 Bacteria 4205
81 Ga0070662_100187419 3300005457 Bacteria 1634
82 Ga0070662_100482828 3300005457 Bacteria 1032
83 Ga0070681_11043683 3300005458 Bacteria 738
84 Ga0068867_100000620 3300005459 Bacteria 23485
85 Ga0068867_100320573 3300005459 Bacteria 1284
86 Ga0068867_100981269 3300005459 Bacteria 765
87 Ga0070685_10004060 3300005466 Bacteria 7394
88 Ga0070685_10077042 3300005466 Unclassified 1990
89 Ga0070685_10092852 3300005466 Bacteria 1829
90 Ga0070679_100264055 3300005530 Bacteria 1677
91 Ga0070684_100000290 3300005535 Bacteria 34902
92 Ga0070684_100093509 3300005535 Bacteria 2676
93 Ga0070684_100169563 3300005535 Bacteria 1982
94 Ga0070684_100186628 3300005535 Bacteria 1886
95 Ga0070684_100960463 3300005535 Bacteria 801
96 Ga0068853_100021273 3300005539 Bacteria 5406
97 Ga0068853_100083007 3300005539 Bacteria 2807
98 Ga0068853_100153499 3300005539 Bacteria 2074
99 Ga0068853_101216190 3300005539 Bacteria 727
100 Ga0070672_100000020 3300005543 Bacteria 69277
101 Ga0070672_100043662 3300005543 Bacteria 3458
102 Ga0070672_100124319 3300005543 Unclassified 2115
103 Ga0070686_100091651 3300005544 Bacteria 2034
104 Ga0070693_100349389 3300005547 Bacteria 1012
105 Ga0070665_100000014 3300005548 Bacteria 484881
106 Ga0070665_100000318 3300005548 Bacteria 74326
107 Ga0070665_100271077 3300005548 Bacteria 1699
108 Ga0068855_100010786 3300005563 Bacteria 11030
109 Ga0068855_100031935 3300005563 Bacteria 6286
110 Ga0068855_100362439 3300005563 Bacteria 1595
111 Ga0068855_101430697 3300005563 Bacteria 712
112 Ga0070664_100012786 3300005564 Bacteria 6830
113 Ga0070664_100134416 3300005564 Bacteria 2174
114 Ga0070664_100197350 3300005564 Bacteria 1794
115 Ga0070664_100231230 3300005564 Bacteria 1657
116 Ga0070664_100388211 3300005564 Bacteria 1275
117 Ga0070664_100495029 3300005564 Unclassified 1126
118 Ga0068857_100004228 3300005577 Bacteria 12096
119 Ga0068857_100008029 3300005577 Bacteria 9102
120 Ga0068857_100056109 3300005577 Bacteria 3496
121 Ga0068854_100053998 3300005578 Bacteria 2888
122 Ga0068854_100486619 3300005578 Unclassified 1037
123 Ga0068856_100009293 3300005614 Bacteria 9549
124 Ga0068856_100061491 3300005614 Bacteria 3710
125 Ga0070702_100259391 3300005615 Bacteria 1183
126 Ga0068852_100003299 3300005616 Bacteria 11269
127 Ga0068852_100084310 3300005616 Bacteria 2828
128 Ga0068852_100442285 3300005616 Bacteria 1286
129 Ga0068852_100872321 3300005616 Bacteria 916
130 Ga0068859_100039445 3300005617 Bacteria 4737
131 Ga0068859_100145631 3300005617 Unclassified 2443
132 Ga0068859_100293037 3300005617 Bacteria 1720
133 Ga0068859_100411300 3300005617 Bacteria 1449
134 Ga0068859_100431885 3300005617 Bacteria 1413
135 Ga0068864_100000934 3300005618 Bacteria 24494
136 Ga0068864_100023861 3300005618 Bacteria 5140
137 Ga0068866_10031831 3300005718 Bacteria 2545
138 Ga0068861_100020234 3300005719 Bacteria 4762
139 Ga0068861_100170740 3300005719 Bacteria 1802
140 Ga0068851_10000510 3300005834 Bacteria 17001
141 Ga0068851_10270415 3300005834 Bacteria 969
142 Ga0068851_10292552 3300005834 Bacteria 934
143 Ga0068863_100000678 3300005841 Bacteria 34425
144 Ga0068863_100096527 3300005841 Bacteria 2806
145 Ga0068863_100540921 3300005841 Bacteria 1149
146 Ga0068858_100000342 3300005842 Bacteria 49465
147 Ga0068858_100054812 3300005842 Bacteria 3687
148 Ga0068858_100569470 3300005842 Unclassified 1097
149 Ga0068860_100003056 3300005843 Bacteria 17285
150 Ga0068862_100366946 3300005844 Bacteria 1339
151 Ga0068862_100691905 3300005844 Bacteria 987
152 Ga0081539_10010219 3300005985 Bacteria 7676
153 Ga0075366_10028230 3300006195 Bacteria 3293
154 Ga0097621_100052713 3300006237 Bacteria 3314
155 Ga0097621_100064430 3300006237 Bacteria 3014
156 Ga0097621_100218883 3300006237 Bacteria 1658
157 Ga0068871_100007230 3300006358 Bacteria 7920
158 Ga0068871_100121703 3300006358 Unclassified 2205
159 Ga0068871_100123599 3300006358 Bacteria 2188
160 Ga0068871_100149551 3300006358 Bacteria 1990
161 Ga0068871_101157837 3300006358 Bacteria 724
162 Ga0068865_100000289 3300006881 Bacteria 27735
163 Ga0097620_100039443 3300006931 Bacteria 4737
164 Ga0097620_100145632 3300006931 Unclassified 2443
165 Ga0097620_100284907 3300006931 Bacteria 1745
166 Ga0097620_100293056 3300006931 Bacteria 1720
167 Ga0097620_100411277 3300006931 Bacteria 1449
168 Ga0097620_100431876 3300006931 Bacteria 1413
169 Ga0105240_10603071 3300009093 Bacteria 1209
170 Ga0105240_11388710 3300009093 Bacteria 739
171 Ga0105247_10207909 3300009101 Bacteria 1319
172 Ga0114129_10004318 3300009147 Bacteria 20100
173 Ga0105243_10030859 3300009148 Bacteria 4130
174 Ga0105241_10235376 3300009174 Bacteria 1546
175 Ga0105248_10833132 3300009177 Bacteria 1041
176 Ga0105237_10016185 3300009545 Bacteria 7756
177 Ga0105237_10104778 3300009545 Bacteria 2820
178 Ga0105238_10042310 3300009551 Bacteria 4614
179 Ga0105238_10084634 3300009551 Bacteria 3161
180 Ga0105249_10021219 3300009553 Bacteria 5815
181 Ga0105249_10077703 3300009553 Bacteria 3079
182 Ga0105239_10056067 3300010375 Bacteria 4322
183 Ga0105239_10072285 3300010375 Bacteria 3791
184 Ga0105239_10695295 3300010375 Unclassified 1162
185 Ga0105246_10075512 3300011119 Bacteria 2386
186 Ga0157373_10014397 3300013100 Bacteria 5798
187 Ga0157373_10168447 3300013100 Bacteria 1542
188 Ga0157373_10495992 3300013100 Bacteria 882
189 Ga0157371_10105000 3300013102 Bacteria 2004
190 Ga0157371_10337681 3300013102 Bacteria 1095
191 Ga0157369_10148752 3300013105 Bacteria 2475
192 Ga0157369_10605526 3300013105 Bacteria 1131
193 Ga0157374_10000745 3300013296 Bacteria 28347
194 Ga0157374_10002159 3300013296 Bacteria 16586
195 Ga0157374_10028707 3300013296 Bacteria 5028
196 Ga0157374_10040401 3300013296 Bacteria 4296
197 Ga0157374_10652400 3300013296 Bacteria 1064
198 Ga0157378_10022980 3300013297 Bacteria 5489
199 Ga0157378_10042681 3300013297 Bacteria 4025
200 Ga0157378_10081940 3300013297 Bacteria 2917
201 Ga0157378_10237762 3300013297 Unclassified 1739
202 Ga0163162_10000544 3300013306 Bacteria 34854
203 Ga0163162_10001237 3300013306 Bacteria 23878
204 Ga0163162_10005247 3300013306 Bacteria 12489
205 Ga0163162_10010645 3300013306 Bacteria 8945
206 Ga0163162_10023789 3300013306 Bacteria 6046
207 Ga0163162_10146250 3300013306 Bacteria 2480
208 Ga0163162_10210054 3300013306 Bacteria 2076
209 Ga0163162_10530671 3300013306 Bacteria 1306
210 Ga0157372_10115180 3300013307 Bacteria 3082
211 Ga0157372_10168419 3300013307 Bacteria 2534
212 Ga0157375_10000821 3300013308 Bacteria 27183
213 Ga0157375_10019807 3300013308 Bacteria 6131
214 Ga0157375_10023937 3300013308 Bacteria 5643
215 Ga0157375_10076269 3300013308 Bacteria 3379
216 Ga0157375_10354455 3300013308 Bacteria 1633
217 Ga0157375_10454802 3300013308 Unclassified 1446
218 Ga0157375_10823093 3300013308 Bacteria 1076
219 Ga0157375_11203075 3300013308 Bacteria 889
220 Ga0163163_10000963 3300014325 Bacteria 24470
221 Ga0163163_10001217 3300014325 Bacteria 21766
222 Ga0163163_10240113 3300014325 Bacteria 1861
223 Ga0157380_10029165 3300014326 Bacteria 4216
224 Ga0157377_10025646 3300014745 Bacteria 3146
225 Ga0157379_10000115 3300014968 Bacteria 55499
226 Ga0157379_10028680 3300014968 Bacteria 4950
227 Ga0157379_10044130 3300014968 Bacteria 3980
228 Ga0157376_10001273 3300014969 Bacteria 16559
229 Ga0157376_11106447 3300014969 Bacteria 818
230 Ga0157376_11394480 3300014969 Bacteria 732
231 Ga0163161_10011605 3300017792 Bacteria 6117
232 Ga0163161_10020617 3300017792 Bacteria 4628
233 Ga0163161_10024139 3300017792 Bacteria 4294
234 Ga0163161_10149103 3300017792 Bacteria 1776
235 Ga0206355_1678078 3300020076 Bacteria 621
236 Ga0206352_10149106 3300020078 Bacteria 1070
237 Ga0207697_10035782 3300025315 Bacteria 2033
238 Ga0207656_10001238 3300025321 Bacteria 8444
239 Ga0207656_10308247 3300025321 Bacteria 784
240 Ga0207642_10253825 3300025899 Bacteria 999
241 Ga0207710_10130731 3300025900 Bacteria 1205
242 Ga0207688_10757733 3300025901 Bacteria 615
243 Ga0207680_10001588 3300025903 Bacteria 10724
244 Ga0207680_10024314 3300025903 Bacteria 3323
245 Ga0207647_10071936 3300025904 Unclassified 2086
246 Ga0207685_10131319 3300025905 Bacteria 1112
247 Ga0207645_10001661 3300025907 Bacteria 18125
248 Ga0207645_10006830 3300025907 Bacteria 8141
249 Ga0207643_10214809 3300025908 Bacteria 1175
250 Ga0207705_10003873 3300025909 Bacteria 11386
251 Ga0207705_10322352 3300025909 Bacteria 1187
252 Ga0207654_10350379 3300025911 Unclassified 1016
253 Ga0207695_10301536 3300025913 Bacteria 1493
254 Ga0207695_10997690 3300025913 Bacteria 717
255 Ga0207660_10100766 3300025917 Bacteria 2157
256 Ga0207657_10002187 3300025919 Bacteria 21179
257 Ga0207657_10224135 3300025919 Bacteria 1505
258 Ga0207649_10007347 3300025920 Bacteria 5996
259 Ga0207649_10172413 3300025920 Bacteria 1508
260 Ga0207649_10269816 3300025920 Bacteria 1233
261 Ga0207649_10444796 3300025920 Bacteria 977
262 Ga0207649_10948991 3300025920 Bacteria 676
263 Ga0207652_10021029 3300025921 Bacteria 5382
264 Ga0207681_10144216 3300025923 Unclassified 1777
265 Ga0207650_10556579 3300025925 Bacteria 962
266 Ga0207650_10733809 3300025925 Bacteria 835
267 Ga0207659_10066736 3300025926 Bacteria 2612
268 Ga0207659_10085336 3300025926 Unclassified 2346
269 Ga0207659_10395306 3300025926 Bacteria 1155
270 Ga0207659_10798363 3300025926 Bacteria 811
271 Ga0207644_10168073 3300025931 Bacteria 1710
272 Ga0207644_10186050 3300025931 Bacteria 1631
273 Ga0207644_10857209 3300025931 Bacteria 761
274 Ga0207690_10028866 3300025932 Bacteria 3520
275 Ga0207690_10040164 3300025932 Bacteria 3057
276 Ga0207706_10002357 3300025933 Bacteria 18449
277 Ga0207706_10003474 3300025933 Bacteria 15037
278 Ga0207706_10012403 3300025933 Bacteria 7765
279 Ga0207706_10031091 3300025933 Bacteria 4758
280 Ga0207706_10057463 3300025933 Bacteria 3428
281 Ga0207706_10323498 3300025933 Bacteria 1342
282 Ga0207709_10062070 3300025935 Bacteria 2337
283 Ga0207670_10046308 3300025936 Bacteria 2889
284 Ga0207670_10355752 3300025936 Bacteria 1161
285 Ga0207669_10183411 3300025937 Bacteria 1503
286 Ga0207704_10068755 3300025938 Bacteria 2234
287 Ga0207691_10000322 3300025940 Bacteria 47690
288 Ga0207691_10104485 3300025940 Bacteria 2524
289 Ga0207689_10000843 3300025942 Bacteria 29516
290 Ga0207689_10024937 3300025942 Bacteria 5012
291 Ga0207689_10047264 3300025942 Bacteria 3555
292 Ga0207661_10000411 3300025944 Bacteria 27626
293 Ga0207661_10113795 3300025944 Bacteria 2293
294 Ga0207661_10270276 3300025944 Bacteria 1517
295 Ga0207679_10000297 3300025945 Bacteria 37427
296 Ga0207679_10000800 3300025945 Bacteria 20460
297 Ga0207679_10197769 3300025945 Bacteria 1677
298 Ga0207679_10362139 3300025945 Bacteria 1267
299 Ga0207667_10059429 3300025949 Bacteria 4004
300 Ga0207667_10225165 3300025949 Bacteria 1921
301 Ga0207667_10452703 3300025949 Bacteria 1304
302 Ga0207667_10623450 3300025949 Bacteria 1086
303 Ga0207651_10000542 3300025960 Bacteria 15834
304 Ga0207651_10105635 3300025960 Bacteria 2101
305 Ga0207651_10126978 3300025960 Bacteria 1945
306 Ga0207712_10003158 3300025961 Bacteria 10509
307 Ga0207712_10115036 3300025961 Bacteria 2024
308 Ga0207712_10225069 3300025961 Bacteria 1502
309 Ga0207668_10000344 3300025972 Bacteria 30213
310 Ga0207640_10374820 3300025981 Bacteria 1151
311 Ga0207658_10001922 3300025986 Bacteria 15507
312 Ga0207658_10149441 3300025986 Bacteria 1901
313 Ga0207658_10201360 3300025986 Bacteria 1662
314 Ga0207677_10000816 3300026023 Bacteria 17807
315 Ga0207677_10000848 3300026023 Bacteria 17486
316 Ga0207703_10002680 3300026035 Bacteria 15290
317 Ga0207639_10131486 3300026041 Bacteria 2072
318 Ga0207678_10057790 3300026067 Bacteria 3338
319 Ga0207708_10265347 3300026075 Bacteria 1387
320 Ga0207702_10028070 3300026078 Bacteria 4676
321 Ga0207702_10157602 3300026078 Unclassified 2071
322 Ga0207702_10381288 3300026078 Bacteria 1356
323 Ga0207641_10003266 3300026088 Bacteria 14436
324 Ga0207641_10081272 3300026088 Bacteria 2814
325 Ga0207648_10002849 3300026089 Bacteria 18310
326 Ga0207648_10017663 3300026089 Bacteria 6479
327 Ga0207648_10131586 3300026089 Bacteria 2202
328 Ga0207648_10196939 3300026089 Bacteria 1786
329 Ga0207648_10453554 3300026089 Unclassified 1168
330 Ga0207676_10004554 3300026095 Bacteria 9814
331 Ga0207676_10132493 3300026095 Bacteria 2121
332 Ga0207676_10241621 3300026095 Bacteria 1620
333 Ga0207674_10010469 3300026116 Bacteria 10500
334 Ga0207674_10036670 3300026116 Bacteria 5105
335 Ga0207674_10768469 3300026116 Unclassified 930
336 Ga0207675_100030222 3300026118 Bacteria 5045
337 Ga0207675_100170440 3300026118 Bacteria 2080
338 Ga0207675_100228396 3300026118 Bacteria 1795
339 Ga0207675_101308034 3300026118 Unclassified 745
340 Ga0207683_10045179 3300026121 Bacteria 3851
341 Ga0207683_10816341 3300026121 Bacteria 866
342 Ga0207698_10042140 3300026142 Bacteria 3408
343 Ga0207698_10405895 3300026142 Bacteria 1303
344 Ga0207698_11004020 3300026142 Bacteria 845
345 Ga0268266_10000068 3300028379 Bacteria 241100
346 Ga0268266_10442499 3300028379 Bacteria 1234
347 Ga0268264_10001597 3300028381 Bacteria 20969
348 Ga0268264_10132515 3300028381 Bacteria 2212
349 Ga0268264_11289523 3300028381 Bacteria 740
350 Ga0307408_100152060 3300031548 Bacteria 1828
351 Ga0307413_10012537 3300031824 Bacteria 4223
352 Ga0307410_10294264 3300031852 Bacteria 1279
353 Ga0307406_10071038 3300031901 Bacteria 2281
354 Ga0307407_10068208 3300031903 Bacteria 2106
355 Ga0307409_100122558 3300031995 Bacteria 2205
356 Ga0307416_100002426 3300032002 Bacteria 10699
357 Ga0307414_10142426 3300032004 Unclassified 1879
358 Ga0307415_100009221 3300032126 Bacteria 5516
359 Ga0373943_0119379 3300035170 Unclassified 1400
360 Ga0373933_0597127 3300035724 Bacteria 725
361 Ga0373947_0281659 3300035725 Bacteria 1105
362 Ga0373937_0075608 3300036401 Bacteria 3110
363 Ga0373937_0254094 3300036401 Bacteria 1657
364 Ga0439466_0118144 3300041411 Bacteria 820
365 Ga0451793_1613459 3300041452 Bacteria 793
366 Ga0451807_2096905 3300041486 Unclassified 2034
367 Ga0439431_0098794 3300041997 Unclassified 801
368 Ga0439433_0050230 3300041999 Unclassified 982
369 Ga0439445_0015735 3300042004 Bacteria 1856
370 Ga0439432_024415 3300042006 Bacteria 1987
371 Ga0439457_057114 3300042014 Bacteria 881
372 Ga0450894_001329 3300042131 Bacteria 3586
373 Ga0450898_015679 3300042134 Bacteria 1286
374 Ga0466969_0000272 3300044656 Bacteria 28299
375 Ga0466966_0003376 3300044684 Bacteria 10522
376 Ga0466961_0067208 3300044693 Bacteria 2277
377 Ga0466968_0138719 3300044735 Bacteria 1111
378 Ga0466957_0000084 3300044842 Bacteria 37711
379 Ga0466959_0000035 3300045049 Bacteria 108669
380 Ga0466967_0351470 3300045976 Bacteria 1427
381 Ga0495638_0073639 3300046460 Unclassified 2084
382 Ga0495580_0081256 3300046472 Bacteria 2259
383 Ga0495664_0512642 3300046477 Unclassified 716
384 Ga0495630_0035066 3300046517 Bacteria 3750
385 Ga0495648_0004762 3300046524 Bacteria 11487
386 Ga0495652_0449950 3300046529 Bacteria 902
387 Ga0495586_0101882 3300046535 Bacteria 1594
388 Ga0495633_0096307 3300046558 Bacteria 1375
389 Ga0495667_0233578 3300046559 Bacteria 1172
390 Ga0495668_0001009 3300046616 Bacteria 30239
391 Ga0495668_0002730 3300046616 Bacteria 14136
392 Ga0495611_0023055 3300046648 Unclassified 2698
393 Ga0495611_0242061 3300046648 Bacteria 837
394 Ga0495635_0272902 3300046663 Bacteria 1137
395 Ga0495657_0329232 3300046675 Bacteria 907
396 Ga0495647_0166544 3300046681 Bacteria 952
397 Ga0495670_0129687 3300046691 Bacteria 1314
398 Ga0495684_0570236 3300047471 Unclassified 768
399 Ga0495602_0486720 3300048088 Bacteria 865
400 Ga0496106_0945410 3300048909 Unclassified 679
401 Ga0496108_0068293 3300048911 Bacteria 2999
402 Ga0496109_0020712 3300048912 Bacteria 5808
403 Ga0496110_0041814 3300048913 Bacteria 4001
404 Ga0496110_0470326 3300048913 Bacteria 1145
405 Ga0496115_0316653 3300048918 Bacteria 1277
406 Ga0501290_018791 3300049513 Bacteria 934
407 Ga0501292_005148 3300049515 Bacteria 1813
408 Ga0501298_004839 3300049521 Bacteria 2141
409 Ga0501034_0000007 3300049571 Bacteria 357805
410 Ga0501198_003948 3300049649 Bacteria 2047
411 Ga0501201_001790 3300049651 Bacteria 1990
412 Ga0501201_002348 3300049651 Bacteria 1732
413 Ga0501202_000359 3300049652 Bacteria 6357
414 Ga0501202_005281 3300049652 Bacteria 2288
415 Ga0501206_015383 3300049653 Unclassified 1058
416 Ga0501207_004502 3300049654 Bacteria 1898
417 Ga0501217_000190 3300049661 Bacteria 9148
418 Ga0501217_054965 3300049661 Unclassified 1050
419 Ga0501222_000546 3300049662 Bacteria 5580
420 Ga0501223_001006 3300049663 Bacteria 6666
421 Ga0501223_011271 3300049663 Bacteria 1794
422 Ga0501223_062350 3300049663 Bacteria 729
423 Ga0501224_023425 3300049664 Bacteria 922
424 Ga0501227_036874 3300049665 Bacteria 1195
425 Ga0501233_005667 3300049668 Bacteria 2321
426 Ga0501235_008871 3300049669 Bacteria 2193
427 Ga0501235_009105 3300049669 Bacteria 2169
428 Ga0501235_099344 3300049669 Viruses 709
429 Ga0501242_003418 3300049674 Unclassified 1717
430 Ga0501243_000818 3300049675 Bacteria 4320
431 Ga0501250_013190 3300049680 Bacteria 988
432 Ga0501253_046499 3300049683 Unclassified 895
433 Ga0501261_001267 3300049690 Bacteria 3101
434 Ga0501221_000013 3300049704 Bacteria 22152
435 Ga0501221_040815 3300049704 Unclassified 1011
436 Ga0501225_0001754 3300049705 Bacteria 6799
437 Ga0501225_0003389 3300049705 Bacteria 4841
438 Ga0501080_0371098 3300049742 Bacteria 1290
439 Ga0501263_008395 3300049760 Bacteria 1232
440 Ga0501273_011393 3300049770 Unclassified 1107
441 Ga0501212_000331 3300049851 Bacteria 4411
442 nmdc:mga0k408_191753_c1 3300050493 Unclassified 1219
443 nmdc:mga05p37_16679_c1 3300050507 Bacteria 7131
444 Ga0500583_0001086 3300053092 Bacteria 7766
445 Ga0500568_0000335 3300053139 Bacteria 37064
446 Ga0500568_0171066 3300053139 Bacteria 800
447 Ga0500622_0000398 3300053156 Bacteria 41643
448 Ga0500611_000003 3300053727 Bacteria 333431
449 Ga0105239_10032921
450 MBSR1b_contig_12999027
451 MBSR1b_contig_13755480
452 ARcpr5yngRDRAFT_c003720
453 JGI24744J21845_10014815
454 rootL2_10101186
455 rootH1_10239146
456 Ga0065714_10016476
457 Ga0065715_10009925
458 Ga0070676_10000701
459 Ga0070683_100000327
460 Ga0070683_100025753
461 Ga0070683_100170865
462 Ga0070683_100424926
463 Ga0070683_100989393
464 Ga0070690_100007060
465 Ga0070690_100288837
466 Ga0070670_100188351
467 Ga0070670_100563728
468 Ga0070670_100645097
469 Ga0068869_100126241
470 Ga0068869_100141896
471 Ga0068869_100150615
472 Ga0068869_100388073
473 Ga0068869_100848410
474 Ga0070666_10000571
475 Ga0070666_10003150
476 Ga0070666_10227166
477 Ga0070666_10340500
478 Ga0070682_100146006
479 Ga0068868_100000112
480 Ga0068868_100054664
481 Ga0068868_100064855
482 Ga0068868_100122970
483 Ga0068868_100163318
484 Ga0070660_100316253
485 Ga0070660_100350986
486 Ga0070689_100050956
487 Ga0070689_100561548
488 Ga0070689_100819019
489 Ga0070661_100001786
490 Ga0070661_100039375
491 Ga0070661_100059364
492 Ga0070661_100208146
493 Ga0070661_100315772
494 Ga0070668_100000110
495 Ga0070668_100606509
496 Ga0070669_100165782
497 Ga0070675_100056010
498 Ga0070675_100060469
499 Ga0070675_100137926
500 Ga0070675_101007685
501 Ga0070671_100022762
502 Ga0070671_100167619
503 Ga0070671_100736866
504 Ga0070671_100896941
505 Ga0070674_100046613
506 Ga0070674_100273104
507 Ga0070674_100988157
508 Ga0070673_100001374
509 Ga0070673_100015009
510 Ga0070673_100049647
511 Ga0070673_100968070
512 Ga0070688_100003958
513 Ga0070688_100241515
514 Ga0070659_100012802
515 Ga0070659_100023860
516 Ga0070659_100419250
517 Ga0070667_100011085
518 Ga0070667_100018912
519 Ga0070667_100217478
520 Ga0070667_100218342
521 Ga0070663_100176331
522 Ga0070663_100364528
523 Ga0070678_100014347
524 Ga0070678_100167177
525 Ga0070662_100000209
526 Ga0070662_100018140
527 Ga0070662_100022389
528 Ga0070662_100023895
529 Ga0070662_100187419
530 Ga0070662_100482828
531 Ga0070681_11043683
532 Ga0068867_100000620
533 Ga0068867_100320573
534 Ga0068867_100981269
535 Ga0070685_10004060
536 Ga0070685_10077042
537 Ga0070685_10092852
538 Ga0070679_100264055
539 Ga0070684_100000290
540 Ga0070684_100093509
541 Ga0070684_100169563
542 Ga0070684_100186628
543 Ga0070684_100960463
544 Ga0068853_100021273
545 Ga0068853_100083007
546 Ga0068853_100153499
547 Ga0068853_101216190
548 Ga0070672_100000020
549 Ga0070672_100043662
550 Ga0070672_100124319
551 Ga0070686_100091651
552 Ga0070693_100349389
553 Ga0070665_100000014
554 Ga0070665_100000318
555 Ga0070665_100271077
556 Ga0068855_100010786
557 Ga0068855_100031935
558 Ga0068855_100362439
559 Ga0068855_101430697
560 Ga0070664_100012786
561 Ga0070664_100134416
562 Ga0070664_100197350
563 Ga0070664_100231230
564 Ga0070664_100388211
565 Ga0070664_100495029
566 Ga0068857_100004228
567 Ga0068857_100008029
568 Ga0068857_100056109
569 Ga0068854_100053998
570 Ga0068854_100486619
571 Ga0068856_100009293
572 Ga0068856_100061491
573 Ga0070702_100259391
574 Ga0068852_100003299
575 Ga0068852_100084310
576 Ga0068852_100442285
577 Ga0068852_100872321
578 Ga0068859_100039445
579 Ga0068859_100145631
580 Ga0068859_100293037
581 Ga0068859_100411300
582 Ga0068859_100431885
583 Ga0068864_100000934
584 Ga0068864_100023861
585 Ga0068866_10031831
586 Ga0068861_100020234
587 Ga0068861_100170740
588 Ga0068851_10000510
589 Ga0068851_10270415
590 Ga0068851_10292552
591 Ga0068863_100000678
592 Ga0068863_100096527
593 Ga0068863_100540921
594 Ga0068858_100000342
595 Ga0068858_100054812
596 Ga0068858_100569470
597 Ga0068860_100003056
598 Ga0068862_100366946
599 Ga0068862_100691905
600 Ga0081539_10010219
601 Ga0075366_10028230
602 Ga0097621_100052713
603 Ga0097621_100064430
604 Ga0097621_100218883
605 Ga0068871_100007230
606 Ga0068871_100121703
607 Ga0068871_100123599
608 Ga0068871_100149551
609 Ga0068871_101157837
610 Ga0068865_100000289
611 Ga0097620_100039443
612 Ga0097620_100145632
613 Ga0097620_100284907
614 Ga0097620_100293056
615 Ga0097620_100411277
616 Ga0097620_100431876
617 Ga0105240_10603071
618 Ga0105240_11388710
619 Ga0105247_10207909
620 Ga0114129_10004318
621 Ga0105243_10030859
622 Ga0105241_10235376
623 Ga0105248_10833132
624 Ga0105237_10016185
625 Ga0105237_10104778
626 Ga0105238_10042310
627 Ga0105238_10084634
628 Ga0105249_10021219
629 Ga0105249_10077703
630 Ga0105239_10056067
631 Ga0105239_10072285
632 Ga0105239_10695295
633 Ga0105246_10075512
634 Ga0157373_10014397
635 Ga0157373_10168447
636 Ga0157373_10495992
637 Ga0157371_10105000
638 Ga0157371_10337681
639 Ga0157369_10148752
640 Ga0157369_10605526
641 Ga0157374_10000745
642 Ga0157374_10002159
643 Ga0157374_10028707
644 Ga0157374_10040401
645 Ga0157374_10652400
646 Ga0157378_10022980
647 Ga0157378_10042681
648 Ga0157378_10081940
649 Ga0157378_10237762
650 Ga0163162_10000544
651 Ga0163162_10001237
652 Ga0163162_10005247
653 Ga0163162_10010645
654 Ga0163162_10023789
655 Ga0163162_10146250
656 Ga0163162_10210054
657 Ga0163162_10530671
658 Ga0157372_10115180
659 Ga0157372_10168419
660 Ga0157375_10000821
661 Ga0157375_10019807
662 Ga0157375_10023937
663 Ga0157375_10076269
664 Ga0157375_10354455
665 Ga0157375_10454802
666 Ga0157375_10823093
667 Ga0157375_11203075
668 Ga0163163_10000963
669 Ga0163163_10001217
670 Ga0163163_10240113
671 Ga0157380_10029165
672 Ga0157377_10025646
673 Ga0157379_10000115
674 Ga0157379_10028680
675 Ga0157379_10044130
676 Ga0157376_10001273
677 Ga0157376_11106447
678 Ga0157376_11394480
679 Ga0163161_10011605
680 Ga0163161_10020617
681 Ga0163161_10024139
682 Ga0163161_10149103
683 Ga0206355_1678078
684 Ga0206352_10149106
685 Ga0207697_10035782
686 Ga0207656_10001238
687 Ga0207656_10308247
688 Ga0207642_10253825
689 Ga0207710_10130731
690 Ga0207688_10757733
691 Ga0207680_10001588
692 Ga0207680_10024314
693 Ga0207647_10071936
694 Ga0207685_10131319
695 Ga0207645_10001661
696 Ga0207645_10006830
697 Ga0207643_10214809
698 Ga0207705_10003873
699 Ga0207705_10322352
700 Ga0207654_10350379
701 Ga0207695_10301536
702 Ga0207695_10997690
703 Ga0207660_10100766
704 Ga0207657_10002187
705 Ga0207657_10224135
706 Ga0207649_10007347
707 Ga0207649_10172413
708 Ga0207649_10269816
709 Ga0207649_10444796
710 Ga0207649_10948991
711 Ga0207652_10021029
712 Ga0207681_10144216
713 Ga0207650_10556579
714 Ga0207650_10733809
715 Ga0207659_10066736
716 Ga0207659_10085336
717 Ga0207659_10395306
718 Ga0207659_10798363
719 Ga0207644_10168073
720 Ga0207644_10186050
721 Ga0207644_10857209
722 Ga0207690_10028866
723 Ga0207690_10040164
724 Ga0207706_10002357
725 Ga0207706_10003474
726 Ga0207706_10012403
727 Ga0207706_10031091
728 Ga0207706_10057463
729 Ga0207706_10323498
730 Ga0207709_10062070
731 Ga0207670_10046308
732 Ga0207670_10355752
733 Ga0207669_10183411
734 Ga0207704_10068755
735 Ga0207691_10000322
736 Ga0207691_10104485
737 Ga0207689_10000843
738 Ga0207689_10024937
739 Ga0207689_10047264
740 Ga0207661_10000411
741 Ga0207661_10113795
742 Ga0207661_10270276
743 Ga0207679_10000297
744 Ga0207679_10000800
745 Ga0207679_10197769
746 Ga0207679_10362139
747 Ga0207667_10059429
748 Ga0207667_10225165
749 Ga0207667_10452703
750 Ga0207667_10623450
751 Ga0207651_10000542
752 Ga0207651_10105635
753 Ga0207651_10126978
754 Ga0207712_10003158
755 Ga0207712_10115036
756 Ga0207712_10225069
757 Ga0207668_10000344
758 Ga0207640_10374820
759 Ga0207658_10001922
760 Ga0207658_10149441
761 Ga0207658_10201360
762 Ga0207677_10000816
763 Ga0207677_10000848
764 Ga0207703_10002680
765 Ga0207639_10131486
766 Ga0207678_10057790
767 Ga0207708_10265347
768 Ga0207702_10028070
769 Ga0207702_10157602
770 Ga0207702_10381288
771 Ga0207641_10003266
772 Ga0207641_10081272
773 Ga0207648_10002849
774 Ga0207648_10017663
775 Ga0207648_10131586
776 Ga0207648_10196939
777 Ga0207648_10453554
778 Ga0207676_10004554
779 Ga0207676_10132493
780 Ga0207676_10241621
781 Ga0207674_10010469
782 Ga0207674_10036670
783 Ga0207674_10768469
784 Ga0207675_100030222
785 Ga0207675_100170440
786 Ga0207675_100228396
787 Ga0207675_101308034
788 Ga0207683_10045179
789 Ga0207683_10816341
790 Ga0207698_10042140
791 Ga0207698_10405895
792 Ga0207698_11004020
793 Ga0268266_10000068
794 Ga0268266_10442499
795 Ga0268264_10001597
796 Ga0268264_10132515
797 Ga0268264_11289523
798 Ga0307408_100152060
799 Ga0307413_10012537
800 Ga0307410_10294264
801 Ga0307406_10071038
802 Ga0307407_10068208
803 Ga0307409_100122558
804 Ga0307416_100002426
805 Ga0307414_10142426
806 Ga0307415_100009221
807 Ga0373943_0119379
808 Ga0373933_0597127
809 Ga0373947_0281659
810 Ga0373937_0075608
811 Ga0373937_0254094
812 Ga0439466_0118144
813 Ga0451793_1613459
814 Ga0451807_2096905
815 Ga0439431_0098794
816 Ga0439433_0050230
817 Ga0439445_0015735
818 Ga0439432_024415
819 Ga0439457_057114
820 Ga0450894_001329
821 Ga0450898_015679
822 Ga0466969_0000272
823 Ga0466966_0003376
824 Ga0466961_0067208
825 Ga0466968_0138719
826 Ga0466957_0000084
827 Ga0466959_0000035
828 Ga0466967_0351470
829 Ga0495638_0073639
830 Ga0495580_0081256
831 Ga0495664_0512642
832 Ga0495630_0035066
833 Ga0495648_0004762
834 Ga0495652_0449950
835 Ga0495586_0101882
836 Ga0495633_0096307
837 Ga0495667_0233578
838 Ga0495668_0001009
839 Ga0495668_0002730
840 Ga0495611_0023055
841 Ga0495611_0242061
842 Ga0495635_0272902
843 Ga0495657_0329232
844 Ga0495647_0166544
845 Ga0495670_0129687
846 Ga0495684_0570236
847 Ga0495602_0486720
848 Ga0496106_0945410
849 Ga0496108_0068293
850 Ga0496109_0020712
851 Ga0496110_0041814
852 Ga0496110_0470326
853 Ga0496115_0316653
854 Ga0501290_018791
855 Ga0501292_005148
856 Ga0501298_004839
857 Ga0501034_0000007
858 Ga0501198_003948
859 Ga0501201_001790
860 Ga0501201_002348
861 Ga0501202_000359
862 Ga0501202_005281
863 Ga0501206_015383
864 Ga0501207_004502
865 Ga0501217_000190
866 Ga0501217_054965
867 Ga0501222_000546
868 Ga0501223_001006
869 Ga0501223_011271
870 Ga0501223_062350
871 Ga0501224_023425
872 Ga0501227_036874
873 Ga0501233_005667
874 Ga0501235_008871
875 Ga0501235_009105
876 Ga0501235_099344
877 Ga0501242_003418
878 Ga0501243_000818
879 Ga0501250_013190
880 Ga0501253_046499
881 Ga0501261_001267
882 Ga0501221_000013
883 Ga0501221_040815
884 Ga0501225_0001754
885 Ga0501225_0003389
886 Ga0501080_0371098
887 Ga0501263_008395
888 Ga0501273_011393
889 Ga0501212_000331
890 nmdc:mga0k408_191753_c1
891 nmdc:mga05p37_16679_c1
892 Ga0500583_0001086
893 Ga0500568_0000335
894 Ga0500568_0171066
895 Ga0500622_0000398
896 Ga0500611_000003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

7

175

0.98

PF00117

GATase

Glutamine amidotransferase class-I

17

178

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.981 4 181
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.975 8 174
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9747 8 174
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9725 6 175
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.966 8 175
ID Description Score Start End Superfamily
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.975 8 174 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9737 4 181 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9583 7 175 3.40.50.880
4y1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9518 6 175 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9462 8 174 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A3R8PL51-F1-model_v4 deleted 0.9998 60 182
AF-A0A4Q1D4P3-F1-model_v4 Type 1 glutamine amidotransferase 0.9975 1 182 GO:0016740
AF-A0A7V9QL38-F1-model_v4 DJ-1/PfpI family protein 0.9967 88 182
AF-A0A133ZEE5-F1-model_v4 Intracellular protease 1 domain protein 0.9957 79 181 GO:0006508
GO:0008233
AF-A0A3N1PQS0-F1-model_v4 Protease I 0.9921 2 185 GO:0006508
GO:0008233

Map