F446199

General Info

Members Datasets Scaffolds Average Seq Length
448 188 896 130

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10513204|Ga0307410_105132042
Length 158
Sequence MDLSVKKAFHPFRAGKMREEATTTGEDAEPKQPRLLLVDDEPALAEFIASVARECGLDPVLTSDDRQFRDRFVEDRPDMVALDLGMPGMDGVELLRFLADQQFAAPVLIISGFDRRVLDSAFRLGEALGLSMAGPLEKPVRLQELEELLYRLKPTLTA

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
161 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
162 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
163 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
164 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
165 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.12
Rhizosphere 98.88
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10513204 3300031852 Bacteria 988
2 JGI24739J22299_10000747 3300001989 Bacteria 11825
3 JGI24737J22298_10000070 3300001990 Bacteria 30186
4 JGI24737J22298_10037358 3300001990 Bacteria 1497
5 JGI24737J22298_10135624 3300001990 Bacteria 727
6 JGI24735J21928_10020087 3300002067 Bacteria 2048
7 JGI24745J21846_1009809 3300002073 Bacteria 1087
8 JGI24738J21930_10002454 3300002075 Bacteria 4848
9 JGI24742J22300_10033285 3300002244 Bacteria 905
10 Ga0065715_10141584 3300005293 Bacteria 1846
11 Ga0070658_10118266 3300005327 Bacteria 2200
12 Ga0070658_10155007 3300005327 Bacteria 1920
13 Ga0070658_10620473 3300005327 Bacteria 938
14 Ga0070658_10990642 3300005327 Bacteria 731
15 Ga0070676_10012651 3300005328 Bacteria 4614
16 Ga0070676_10387163 3300005328 Bacteria 970
17 Ga0070683_100726623 3300005329 Bacteria 951
18 Ga0070690_100012991 3300005330 Bacteria 4911
19 Ga0070670_100158556 3300005331 Bacteria 1961
20 Ga0068869_100005977 3300005334 Bacteria 7693
21 Ga0070666_10061455 3300005335 Bacteria 2543
22 Ga0070680_100077190 3300005336 Bacteria 2744
23 Ga0070680_100509195 3300005336 Bacteria 1030
24 Ga0070680_101570932 3300005336 Bacteria 570
25 Ga0070682_100276993 3300005337 Bacteria 1221
26 Ga0068868_100000652 3300005338 Bacteria 23360
27 Ga0068868_100248023 3300005338 Bacteria 1498
28 Ga0070660_100004598 3300005339 Bacteria 9545
29 Ga0070660_100016705 3300005339 Bacteria 5335
30 Ga0070660_100074934 3300005339 Bacteria 2649
31 Ga0070660_100158184 3300005339 Bacteria 1825
32 Ga0070689_100151099 3300005340 Bacteria 1873
33 Ga0070661_100058234 3300005344 Bacteria 2831
34 Ga0070661_100070457 3300005344 Bacteria 2571
35 Ga0070661_100239573 3300005344 Bacteria 1396
36 Ga0070661_100388714 3300005344 Bacteria 1101
37 Ga0070692_10040958 3300005345 Bacteria 2371
38 Ga0070692_10101671 3300005345 Bacteria 1577
39 Ga0070668_100671462 3300005347 Bacteria 912
40 Ga0070668_101311447 3300005347 Bacteria 658
41 Ga0070669_100001264 3300005353 Bacteria 18340
42 Ga0070669_100455739 3300005353 Bacteria 1055
43 Ga0070669_100844261 3300005353 Bacteria 780
44 Ga0070675_100008244 3300005354 Bacteria 8083
45 Ga0070675_100352047 3300005354 Unclassified 1306
46 Ga0070671_100034068 3300005355 Bacteria 4215
47 Ga0070673_100000119 3300005364 Bacteria 36566
48 Ga0070688_100099470 3300005365 Bacteria 1915
49 Ga0070659_100005323 3300005366 Bacteria 9234
50 Ga0070659_100014584 3300005366 Bacteria 5876
51 Ga0070659_100193606 3300005366 Bacteria 1672
52 Ga0070659_100310546 3300005366 Bacteria 1316
53 Ga0070659_100337229 3300005366 Bacteria 1262
54 Ga0070659_100413636 3300005366 Bacteria 1140
55 Ga0070667_100000520 3300005367 Bacteria 38650
56 Ga0070714_101707397 3300005435 Bacteria 615
57 Ga0070694_100073463 3300005444 Bacteria 2362
58 Ga0070663_100005191 3300005455 Bacteria 7713
59 Ga0070663_100387830 3300005455 Unclassified 1139
60 Ga0070663_100577775 3300005455 Bacteria 942
61 Ga0070663_101127573 3300005455 Bacteria 687
62 Ga0070662_100001228 3300005457 Bacteria 15751
63 Ga0070662_100480772 3300005457 Bacteria 1034
64 Ga0070681_10026918 3300005458 Bacteria 5782
65 Ga0070681_10559954 3300005458 Bacteria 1057
66 Ga0070681_10691003 3300005458 Unclassified 936
67 Ga0068867_100003540 3300005459 Bacteria 10977
68 Ga0068867_100008272 3300005459 Bacteria 7346
69 Ga0070679_100123045 3300005530 Bacteria 2578
70 Ga0070679_100210640 3300005530 Bacteria 1907
71 Ga0070679_100297764 3300005530 Bacteria 1564
72 Ga0070679_102210011 3300005530 Bacteria 500
73 Ga0068853_100002954 3300005539 Bacteria 12942
74 Ga0068853_100023524 3300005539 Bacteria 5159
75 Ga0068853_100503272 3300005539 Bacteria 1144
76 Ga0068853_100525640 3300005539 Bacteria 1119
77 Ga0068853_101543639 3300005539 Bacteria 643
78 Ga0070686_100471322 3300005544 Bacteria 969
79 Ga0070695_100109308 3300005545 Bacteria 1874
80 Ga0070696_100020710 3300005546 Bacteria 4456
81 Ga0070693_100072798 3300005547 Bacteria 2028
82 Ga0070693_100468869 3300005547 Bacteria 887
83 Ga0070665_100220961 3300005548 Bacteria 1895
84 Ga0070665_101661569 3300005548 Bacteria 646
85 Ga0068855_100038760 3300005563 Bacteria 5661
86 Ga0068855_101012969 3300005563 Bacteria 872
87 Ga0068855_101074151 3300005563 Bacteria 843
88 Ga0070664_100031466 3300005564 Bacteria 4434
89 Ga0070664_100146483 3300005564 Bacteria 2083
90 Ga0070664_100265441 3300005564 Bacteria 1545
91 Ga0068857_100002348 3300005577 Bacteria 15407
92 Ga0068857_100117415 3300005577 Bacteria 2394
93 Ga0068857_100535444 3300005577 Bacteria 1102
94 Ga0068857_101012962 3300005577 Bacteria 800
95 Ga0068854_100005296 3300005578 Bacteria 8141
96 Ga0068854_100060737 3300005578 Bacteria 2736
97 Ga0068854_100227938 3300005578 Bacteria 1477
98 Ga0068854_100340546 3300005578 Bacteria 1225
99 Ga0068854_100732739 3300005578 Bacteria 856
100 Ga0068856_100015956 3300005614 Bacteria 7262
101 Ga0068856_100407793 3300005614 Bacteria 1379
102 Ga0068856_100442393 3300005614 Bacteria 1320
103 Ga0068856_102408809 3300005614 Unclassified 534
104 Ga0068852_100001300 3300005616 Bacteria 16700
105 Ga0068852_100035064 3300005616 Bacteria 4180
106 Ga0068852_101375104 3300005616 Unclassified 728
107 Ga0068859_101356675 3300005617 Bacteria 784
108 Ga0068864_100312545 3300005618 Bacteria 1473
109 Ga0068866_10038032 3300005718 Bacteria 2367
110 Ga0068851_10033213 3300005834 Bacteria 2571
111 Ga0068870_10306423 3300005840 Bacteria 1004
112 Ga0068863_100000871 3300005841 Bacteria 30229
113 Ga0068863_100093925 3300005841 Bacteria 2846
114 Ga0068858_100005148 3300005842 Bacteria 12812
115 Ga0068858_100140360 3300005842 Bacteria 2268
116 Ga0068860_100001576 3300005843 Bacteria 24578
117 Ga0068862_100098724 3300005844 Bacteria 2551
118 Ga0068862_100118211 3300005844 Bacteria 2334
119 Ga0068862_100180814 3300005844 Bacteria 1892
120 Ga0068862_102210949 3300005844 Unclassified 561
121 Ga0081540_1092062 3300005983 Bacteria 1331
122 Ga0081539_10018027 3300005985 Bacteria 4921
123 Ga0097621_100101338 3300006237 Bacteria 2423
124 Ga0068871_101269267 3300006358 Bacteria 692
125 Ga0068865_100004405 3300006881 Bacteria 8486
126 Ga0068865_100997536 3300006881 Bacteria 733
127 Ga0097620_101357151 3300006931 Bacteria 784
128 Ga0105240_10853627 3300009093 Bacteria 982
129 Ga0111539_10037796 3300009094 Bacteria 5826
130 Ga0105245_10000657 3300009098 Bacteria 31348
131 Ga0105243_10099657 3300009148 Bacteria 2409
132 Ga0105241_10003321 3300009174 Bacteria 11971
133 Ga0105242_10642904 3300009176 Bacteria 1030
134 Ga0105248_10000394 3300009177 Bacteria 50466
135 Ga0105237_11638478 3300009545 Bacteria 650
136 Ga0105238_10104645 3300009551 Bacteria 2811
137 Ga0105238_10458788 3300009551 Bacteria 1272
138 Ga0105238_10523230 3300009551 Bacteria 1189
139 Ga0105249_10153888 3300009553 Bacteria 2216
140 Ga0105239_10007868 3300010375 Bacteria 12184
141 Ga0105246_10012486 3300011119 Bacteria 5304
142 Ga0157373_10001442 3300013100 Bacteria 18155
143 Ga0157373_10008637 3300013100 Bacteria 7557
144 Ga0157373_10361030 3300013100 Bacteria 1037
145 Ga0157371_10002891 3300013102 Bacteria 16063
146 Ga0157371_10063718 3300013102 Bacteria 2613
147 Ga0157371_10207890 3300013102 Bacteria 1404
148 Ga0157371_11234798 3300013102 Bacteria 577
149 Ga0157370_10093432 3300013104 Bacteria 2823
150 Ga0157370_10779432 3300013104 Unclassified 870
151 Ga0157369_10344785 3300013105 Bacteria 1547
152 Ga0157369_10710194 3300013105 Bacteria 1035
153 Ga0157374_10221666 3300013296 Bacteria 1856
154 Ga0157374_10370364 3300013296 Bacteria 1426
155 Ga0157378_10001591 3300013297 Bacteria 20531
156 Ga0157378_10777212 3300013297 Bacteria 982
157 Ga0157372_10029632 3300013307 Bacteria 5979
158 Ga0157372_10136310 3300013307 Bacteria 2827
159 Ga0157372_11339755 3300013307 Bacteria 826
160 Ga0157372_11988975 3300013307 Bacteria 668
161 Ga0157380_11193395 3300014326 Bacteria 804
162 Ga0157377_10209490 3300014745 Bacteria 1242
163 Ga0206354_10669789 3300020081 Bacteria 1616
164 Ga0206353_11262890 3300020082 Bacteria 1320
165 Ga0207673_1003470 3300025290 Bacteria 1846
166 Ga0207697_10000056 3300025315 Bacteria 45867
167 Ga0207656_10003427 3300025321 Bacteria 5449
168 Ga0207656_10047253 3300025321 Bacteria 1849
169 Ga0207642_10148523 3300025899 Bacteria 1244
170 Ga0207688_10001342 3300025901 Bacteria 12786
171 Ga0207680_10069257 3300025903 Bacteria 2179
172 Ga0207647_10000579 3300025904 Bacteria 28504
173 Ga0207647_10198482 3300025904 Bacteria 1161
174 Ga0207645_10023137 3300025907 Bacteria 4039
175 Ga0207645_10354410 3300025907 Bacteria 982
176 Ga0207645_10476713 3300025907 Bacteria 843
177 Ga0207643_10322366 3300025908 Bacteria 965
178 Ga0207705_10022465 3300025909 Bacteria 4497
179 Ga0207705_10023115 3300025909 Bacteria 4434
180 Ga0207705_10033411 3300025909 Bacteria 3674
181 Ga0207705_10099093 3300025909 Bacteria 2142
182 Ga0207705_10130039 3300025909 Bacteria 1873
183 Ga0207705_10181457 3300025909 Bacteria 1589
184 Ga0207705_10195151 3300025909 Bacteria 1532
185 Ga0207705_10201172 3300025909 Bacteria 1509
186 Ga0207705_10366026 3300025909 Bacteria 1112
187 Ga0207705_10410126 3300025909 Bacteria 1048
188 Ga0207705_10739540 3300025909 Bacteria 764
189 Ga0207707_10025684 3300025912 Bacteria 5152
190 Ga0207707_10296545 3300025912 Bacteria 1399
191 Ga0207707_10380471 3300025912 Bacteria 1213
192 Ga0207707_10389858 3300025912 Bacteria 1197
193 Ga0207707_10502854 3300025912 Bacteria 1033
194 Ga0207707_10728695 3300025912 Bacteria 831
195 Ga0207695_10047392 3300025913 Bacteria 4549
196 Ga0207695_11252538 3300025913 Bacteria 622
197 Ga0207660_10000012 3300025917 Bacteria 84167
198 Ga0207660_10000776 3300025917 Bacteria 21236
199 Ga0207660_10111957 3300025917 Bacteria 2055
200 Ga0207660_10127207 3300025917 Bacteria 1936
201 Ga0207660_10194821 3300025917 Bacteria 1580
202 Ga0207660_10358639 3300025917 Bacteria 1169
203 Ga0207660_10372596 3300025917 Bacteria 1147
204 Ga0207660_11069669 3300025917 Bacteria 658
205 Ga0207657_10003078 3300025919 Bacteria 17842
206 Ga0207657_10004573 3300025919 Bacteria 14626
207 Ga0207657_10043664 3300025919 Bacteria 3946
208 Ga0207657_10292245 3300025919 Bacteria 1292
209 Ga0207657_10350080 3300025919 Bacteria 1165
210 Ga0207657_10988593 3300025919 Bacteria 646
211 Ga0207649_10037572 3300025920 Bacteria 2926
212 Ga0207649_10051989 3300025920 Bacteria 2540
213 Ga0207649_10078010 3300025920 Bacteria 2136
214 Ga0207649_10133427 3300025920 Bacteria 1690
215 Ga0207652_10204389 3300025921 Bacteria 1778
216 Ga0207652_10208833 3300025921 Bacteria 1758
217 Ga0207652_10348193 3300025921 Bacteria 1337
218 Ga0207652_10367884 3300025921 Bacteria 1298
219 Ga0207652_10415965 3300025921 Bacteria 1213
220 Ga0207652_10458302 3300025921 Bacteria 1149
221 Ga0207652_10901274 3300025921 Bacteria 781
222 Ga0207652_11223231 3300025921 Bacteria 653
223 Ga0207681_10032774 3300025923 Bacteria 3403
224 Ga0207681_10361485 3300025923 Bacteria 1164
225 Ga0207681_10559500 3300025923 Bacteria 942
226 Ga0207681_11303674 3300025923 Bacteria 610
227 Ga0207694_10185202 3300025924 Bacteria 1690
228 Ga0207694_10427460 3300025924 Bacteria 1104
229 Ga0207650_10113351 3300025925 Bacteria 2102
230 Ga0207659_10291682 3300025926 Bacteria 1337
231 Ga0207659_10590424 3300025926 Bacteria 946
232 Ga0207687_10019996 3300025927 Bacteria 4440
233 Ga0207664_10931778 3300025929 Bacteria 779
234 Ga0207664_11823585 3300025929 Unclassified 531
235 Ga0207644_10018882 3300025931 Bacteria 4672
236 Ga0207690_10006438 3300025932 Bacteria 6960
237 Ga0207690_10047599 3300025932 Bacteria 2847
238 Ga0207690_10052300 3300025932 Bacteria 2735
239 Ga0207690_10087209 3300025932 Bacteria 2196
240 Ga0207690_10139019 3300025932 Bacteria 1787
241 Ga0207690_10262060 3300025932 Bacteria 1340
242 Ga0207690_10539540 3300025932 Bacteria 947
243 Ga0207706_10000619 3300025933 Bacteria 37719
244 Ga0207706_10079700 3300025933 Bacteria 2879
245 Ga0207706_10179209 3300025933 Bacteria 1861
246 Ga0207709_10048746 3300025935 Bacteria 2582
247 Ga0207670_10043783 3300025936 Bacteria 2959
248 Ga0207669_10626904 3300025937 Bacteria 877
249 Ga0207704_10260066 3300025938 Bacteria 1308
250 Ga0207711_10007131 3300025941 Bacteria 9365
251 Ga0207689_10000104 3300025942 Bacteria 69092
252 Ga0207689_10029213 3300025942 Bacteria 4606
253 Ga0207661_10319012 3300025944 Bacteria 1396
254 Ga0207661_10602103 3300025944 Unclassified 1009
255 Ga0207679_10099947 3300025945 Bacteria 2266
256 Ga0207679_10126810 3300025945 Bacteria 2041
257 Ga0207679_10214591 3300025945 Bacteria 1616
258 Ga0207679_10323398 3300025945 Bacteria 1336
259 Ga0207679_10464335 3300025945 Bacteria 1124
260 Ga0207679_11225430 3300025945 Bacteria 689
261 Ga0207679_11380329 3300025945 Bacteria 646
262 Ga0207679_11804938 3300025945 Unclassified 559
263 Ga0207667_10104067 3300025949 Bacteria 2928
264 Ga0207667_10223708 3300025949 Bacteria 1928
265 Ga0207667_10398056 3300025949 Bacteria 1402
266 Ga0207667_10884809 3300025949 Bacteria 886
267 Ga0207667_11053585 3300025949 Bacteria 798
268 Ga0207651_10000128 3300025960 Bacteria 32485
269 Ga0207712_10045825 3300025961 Bacteria 3029
270 Ga0207668_10015311 3300025972 Bacteria 4762
271 Ga0207668_10051128 3300025972 Bacteria 2853
272 Ga0207668_10946260 3300025972 Bacteria 768
273 Ga0207640_10053632 3300025981 Bacteria 2633
274 Ga0207640_10110649 3300025981 Bacteria 1946
275 Ga0207640_10122524 3300025981 Bacteria 1866
276 Ga0207640_10262184 3300025981 Bacteria 1347
277 Ga0207658_10003642 3300025986 Bacteria 10876
278 Ga0207677_10040003 3300026023 Bacteria 3087
279 Ga0207703_10005880 3300026035 Bacteria 9830
280 Ga0207703_10223163 3300026035 Bacteria 1686
281 Ga0207639_10038930 3300026041 Bacteria 3540
282 Ga0207639_10053352 3300026041 Bacteria 3084
283 Ga0207639_10090298 3300026041 Bacteria 2450
284 Ga0207639_10338718 3300026041 Bacteria 1340
285 Ga0207639_10926685 3300026041 Bacteria 815
286 Ga0207678_10041871 3300026067 Bacteria 3970
287 Ga0207678_10044994 3300026067 Bacteria 3817
288 Ga0207678_10059188 3300026067 Bacteria 3296
289 Ga0207678_10151194 3300026067 Bacteria 1982
290 Ga0207678_10474424 3300026067 Bacteria 1089
291 Ga0207678_10538134 3300026067 Bacteria 1021
292 Ga0207678_10605688 3300026067 Bacteria 960
293 Ga0207678_11028431 3300026067 Bacteria 729
294 Ga0207702_10006964 3300026078 Bacteria 9681
295 Ga0207702_10254748 3300026078 Bacteria 1650
296 Ga0207702_10381194 3300026078 Bacteria 1356
297 Ga0207702_10410177 3300026078 Bacteria 1308
298 Ga0207702_10828614 3300026078 Unclassified 915
299 Ga0207702_11485912 3300026078 Unclassified 671
300 Ga0207702_11708491 3300026078 Bacteria 622
301 Ga0207641_10013246 3300026088 Bacteria 6762
302 Ga0207641_10077310 3300026088 Bacteria 2880
303 Ga0207648_10000141 3300026089 Bacteria 71670
304 Ga0207648_10002387 3300026089 Bacteria 20217
305 Ga0207676_10007872 3300026095 Bacteria 7578
306 Ga0207674_10000714 3300026116 Bacteria 43427
307 Ga0207674_10017372 3300026116 Bacteria 7850
308 Ga0207674_10027615 3300026116 Bacteria 6001
309 Ga0207675_100025500 3300026118 Bacteria 5503
310 Ga0207683_10091574 3300026121 Bacteria 2709
311 Ga0207698_10004042 3300026142 Bacteria 8905
312 Ga0207698_10004175 3300026142 Bacteria 8787
313 Ga0207698_10011048 3300026142 Bacteria 5838
314 Ga0207698_10029430 3300026142 Bacteria 3934
315 Ga0207698_10036792 3300026142 Bacteria 3598
316 Ga0207698_10203682 3300026142 Bacteria 1774
317 Ga0207698_10267432 3300026142 Bacteria 1574
318 Ga0207698_10506534 3300026142 Bacteria 1176
319 Ga0207698_10725913 3300026142 Bacteria 990
320 Ga0268266_10520610 3300028379 Bacteria 1137
321 Ga0268266_11083724 3300028379 Bacteria 775
322 Ga0268265_10062797 3300028380 Bacteria 2855
323 Ga0268265_10141709 3300028380 Bacteria 2013
324 Ga0268265_10243180 3300028380 Bacteria 1589
325 Ga0268264_10006232 3300028381 Bacteria 10065
326 Ga0316182_1248735 3300030745 Bacteria 787
327 Ga0307408_100308992 3300031548 Bacteria 1327
328 Ga0307405_10147385 3300031731 Bacteria 1650
329 Ga0307413_10722619 3300031824 Bacteria 830
330 Ga0307413_10951285 3300031824 Bacteria 733
331 Ga0307410_10021186 3300031852 Bacteria 3994
332 Ga0307410_10112540 3300031852 Bacteria 1971
333 Ga0307410_10159623 3300031852 Bacteria 1688
334 Ga0307410_10607895 3300031852 Bacteria 912
335 Ga0307410_11811101 3300031852 Bacteria 542
336 Ga0307406_10084791 3300031901 Bacteria 2116
337 Ga0307406_10338984 3300031901 Unclassified 1170
338 Ga0307407_10197893 3300031903 Bacteria 1344
339 Ga0307412_10061858 3300031911 Bacteria 2518
340 Ga0307412_10239020 3300031911 Bacteria 1404
341 Ga0307412_11088993 3300031911 Bacteria 710
342 Ga0307412_11575691 3300031911 Bacteria 599
343 Ga0307409_100150012 3300031995 Bacteria 2022
344 Ga0307409_100263942 3300031995 Bacteria 1582
345 Ga0307409_100438952 3300031995 Bacteria 1257
346 Ga0307409_100747125 3300031995 Bacteria 982
347 Ga0307416_100174527 3300032002 Bacteria 2006
348 Ga0307416_100473958 3300032002 Bacteria 1310
349 Ga0307416_100608593 3300032002 Bacteria 1173
350 Ga0307416_101842815 3300032002 Bacteria 709
351 Ga0307414_10143869 3300032004 Bacteria 1871
352 Ga0307414_10145157 3300032004 Bacteria 1863
353 Ga0307414_10885976 3300032004 Bacteria 817
354 Ga0307414_12222719 3300032004 Bacteria 512
355 Ga0307411_10117105 3300032005 Bacteria 1919
356 Ga0307411_10348504 3300032005 Bacteria 1206
357 Ga0307411_10351797 3300032005 Bacteria 1201
358 Ga0307411_10444710 3300032005 Unclassified 1083
359 Ga0307411_10581782 3300032005 Bacteria 960
360 Ga0307411_11495000 3300032005 Bacteria 620
361 Ga0307411_12307832 3300032005 Bacteria 505
362 Ga0307415_100051544 3300032126 Bacteria 2793
363 Ga0307415_100156404 3300032126 Bacteria 1761
364 Ga0307415_100220145 3300032126 Bacteria 1521
365 Ga0307415_100262558 3300032126 Bacteria 1410
366 Ga0307415_100473313 3300032126 Bacteria 1089
367 Ga0307415_101344819 3300032126 Bacteria 678
368 Ga0307415_101448224 3300032126 Bacteria 655
369 Ga0373929_0023769 3300035085 Bacteria 1261
370 Ga0395899_0108521 3300037312 Bacteria 1997
371 Ga0395899_0180240 3300037312 Bacteria 1483
372 Ga0395899_0297190 3300037312 Bacteria 1094
373 Ga0395899_0352570 3300037312 Bacteria 984
374 Ga0395900_0009277 3300037418 Bacteria 10089
375 Ga0395900_0106238 3300037418 Bacteria 2884
376 Ga0395900_0139595 3300037418 Bacteria 2482
377 Ga0395900_0141871 3300037418 Bacteria 2459
378 Ga0395900_0211235 3300037418 Bacteria 1959
379 Ga0395900_0337204 3300037418 Bacteria 1484
380 Ga0395900_0370238 3300037418 Bacteria 1403
381 Ga0395900_0465333 3300037418 Bacteria 1218
382 Ga0395900_1257760 3300037418 Unclassified 655
383 Ga0395900_1558759 3300037418 Unclassified 572
384 Ga0395898_0062819 3300037466 Bacteria 3605
385 Ga0395898_0380806 3300037466 Bacteria 1345
386 Ga0395898_0630245 3300037466 Unclassified 1015
387 Ga0395905_0116413 3300037471 Bacteria 2512
388 Ga0395905_0138359 3300037471 Bacteria 2291
389 Ga0395905_0735065 3300037471 Bacteria 889
390 Ga0395905_1093498 3300037471 Unclassified 700
391 Ga0395905_1845652 3300037471 Unclassified 510
392 Ga0395901_0000268 3300038443 Bacteria 64837
393 Ga0395901_0092527 3300038443 Bacteria 3165
394 Ga0395901_0135757 3300038443 Bacteria 2586
395 Ga0395901_0143633 3300038443 Bacteria 2508
396 Ga0395901_0307734 3300038443 Bacteria 1642
397 Ga0395901_0324697 3300038443 Bacteria 1592
398 Ga0395901_0353672 3300038443 Bacteria 1516
399 Ga0395901_0563334 3300038443 Bacteria 1153
400 Ga0395901_0651433 3300038443 Bacteria 1056
401 Ga0395901_1961903 3300038443 Bacteria 532
402 Ga0439438_064041 3300041405 Bacteria 917
403 Ga0439442_152366 3300042002 Bacteria 515
404 Ga0450914_000140 3300042118 Bacteria 2474
405 Ga0450917_002638 3300042120 Bacteria 1286
406 Ga0450905_000757 3300042142 Bacteria 3971
407 Ga0450889_003954 3300042144 Bacteria 1463
408 Ga0466969_0086653 3300044656 Bacteria 1488
409 Ga0466969_0093483 3300044656 Bacteria 1422
410 Ga0466966_0017969 3300044684 Bacteria 4669
411 Ga0466966_0020580 3300044684 Bacteria 4336
412 Ga0466961_0007049 3300044693 Bacteria 7151
413 Ga0466961_0013095 3300044693 Bacteria 5307
414 Ga0466961_0028834 3300044693 Bacteria 3570
415 Ga0466961_0945069 3300044693 Bacteria 513
416 Ga0466963_0078691 3300044694 Bacteria 2229
417 Ga0466964_0076159 3300044706 Bacteria 1430
418 Ga0466964_0166360 3300044706 Bacteria 1035
419 Ga0466971_0003209 3300044719 Bacteria 6972
420 Ga0466971_0233793 3300044719 Bacteria 873
421 Ga0466970_0006122 3300044765 Bacteria 5993
422 Ga0466957_0002791 3300044842 Bacteria 9444
423 Ga0466959_0064620 3300045049 Bacteria 2657
424 Ga0466959_0110645 3300045049 Bacteria 1960
425 Ga0466958_0010434 3300045836 Bacteria 5203
426 Ga0466958_0061835 3300045836 Bacteria 2282
427 Ga0466958_0206099 3300045836 Bacteria 1252
428 Ga0466958_0293218 3300045836 Bacteria 1044
429 Ga0466967_0031471 3300045976 Bacteria 4466
430 Ga0466967_0044592 3300045976 Bacteria 3847
431 Ga0466967_0142523 3300045976 Bacteria 2233
432 Ga0466967_0611607 3300045976 Bacteria 1076
433 Ga0466967_1282336 3300045976 Unclassified 730
434 Ga0466967_1710675 3300045976 Bacteria 626
435 Ga0495663_0101628 3300046525 Bacteria 947
436 Ga0495677_0097862 3300047445 Bacteria 1109
437 Ga0495685_075812 3300047447 Bacteria 1123
438 Ga0496101_0376772 3300048904 Bacteria 1116
439 Ga0496104_0421496 3300048907 Bacteria 1247
440 Ga0496111_0081894 3300048914 Bacteria 2356
441 Ga0496112_0072264 3300048915 Bacteria 3410
442 Ga0496113_0098152 3300048916 Bacteria 2267
443 Ga0501067_0058130 3300049583 Bacteria 2142
444 Ga0501068_0080305 3300049584 Bacteria 2001
445 Ga0501068_0320811 3300049584 Bacteria 993
446 nmdc:mga08y16_249453_c1 3300050511 Bacteria 1834
447 Ga0466962_0009213 3300061719 Bacteria 4730
448 Ga0466962_0073034 3300061719 Bacteria 1639
449 Ga0307410_10513204
450 JGI24739J22299_10000747
451 JGI24737J22298_10000070
452 JGI24737J22298_10037358
453 JGI24737J22298_10135624
454 JGI24735J21928_10020087
455 JGI24745J21846_1009809
456 JGI24738J21930_10002454
457 JGI24742J22300_10033285
458 Ga0065715_10141584
459 Ga0070658_10118266
460 Ga0070658_10155007
461 Ga0070658_10620473
462 Ga0070658_10990642
463 Ga0070676_10012651
464 Ga0070676_10387163
465 Ga0070683_100726623
466 Ga0070690_100012991
467 Ga0070670_100158556
468 Ga0068869_100005977
469 Ga0070666_10061455
470 Ga0070680_100077190
471 Ga0070680_100509195
472 Ga0070680_101570932
473 Ga0070682_100276993
474 Ga0068868_100000652
475 Ga0068868_100248023
476 Ga0070660_100004598
477 Ga0070660_100016705
478 Ga0070660_100074934
479 Ga0070660_100158184
480 Ga0070689_100151099
481 Ga0070661_100058234
482 Ga0070661_100070457
483 Ga0070661_100239573
484 Ga0070661_100388714
485 Ga0070692_10040958
486 Ga0070692_10101671
487 Ga0070668_100671462
488 Ga0070668_101311447
489 Ga0070669_100001264
490 Ga0070669_100455739
491 Ga0070669_100844261
492 Ga0070675_100008244
493 Ga0070675_100352047
494 Ga0070671_100034068
495 Ga0070673_100000119
496 Ga0070688_100099470
497 Ga0070659_100005323
498 Ga0070659_100014584
499 Ga0070659_100193606
500 Ga0070659_100310546
501 Ga0070659_100337229
502 Ga0070659_100413636
503 Ga0070667_100000520
504 Ga0070714_101707397
505 Ga0070694_100073463
506 Ga0070663_100005191
507 Ga0070663_100387830
508 Ga0070663_100577775
509 Ga0070663_101127573
510 Ga0070662_100001228
511 Ga0070662_100480772
512 Ga0070681_10026918
513 Ga0070681_10559954
514 Ga0070681_10691003
515 Ga0068867_100003540
516 Ga0068867_100008272
517 Ga0070679_100123045
518 Ga0070679_100210640
519 Ga0070679_100297764
520 Ga0070679_102210011
521 Ga0068853_100002954
522 Ga0068853_100023524
523 Ga0068853_100503272
524 Ga0068853_100525640
525 Ga0068853_101543639
526 Ga0070686_100471322
527 Ga0070695_100109308
528 Ga0070696_100020710
529 Ga0070693_100072798
530 Ga0070693_100468869
531 Ga0070665_100220961
532 Ga0070665_101661569
533 Ga0068855_100038760
534 Ga0068855_101012969
535 Ga0068855_101074151
536 Ga0070664_100031466
537 Ga0070664_100146483
538 Ga0070664_100265441
539 Ga0068857_100002348
540 Ga0068857_100117415
541 Ga0068857_100535444
542 Ga0068857_101012962
543 Ga0068854_100005296
544 Ga0068854_100060737
545 Ga0068854_100227938
546 Ga0068854_100340546
547 Ga0068854_100732739
548 Ga0068856_100015956
549 Ga0068856_100407793
550 Ga0068856_100442393
551 Ga0068856_102408809
552 Ga0068852_100001300
553 Ga0068852_100035064
554 Ga0068852_101375104
555 Ga0068859_101356675
556 Ga0068864_100312545
557 Ga0068866_10038032
558 Ga0068851_10033213
559 Ga0068870_10306423
560 Ga0068863_100000871
561 Ga0068863_100093925
562 Ga0068858_100005148
563 Ga0068858_100140360
564 Ga0068860_100001576
565 Ga0068862_100098724
566 Ga0068862_100118211
567 Ga0068862_100180814
568 Ga0068862_102210949
569 Ga0081540_1092062
570 Ga0081539_10018027
571 Ga0097621_100101338
572 Ga0068871_101269267
573 Ga0068865_100004405
574 Ga0068865_100997536
575 Ga0097620_101357151
576 Ga0105240_10853627
577 Ga0111539_10037796
578 Ga0105245_10000657
579 Ga0105243_10099657
580 Ga0105241_10003321
581 Ga0105242_10642904
582 Ga0105248_10000394
583 Ga0105237_11638478
584 Ga0105238_10104645
585 Ga0105238_10458788
586 Ga0105238_10523230
587 Ga0105249_10153888
588 Ga0105239_10007868
589 Ga0105246_10012486
590 Ga0157373_10001442
591 Ga0157373_10008637
592 Ga0157373_10361030
593 Ga0157371_10002891
594 Ga0157371_10063718
595 Ga0157371_10207890
596 Ga0157371_11234798
597 Ga0157370_10093432
598 Ga0157370_10779432
599 Ga0157369_10344785
600 Ga0157369_10710194
601 Ga0157374_10221666
602 Ga0157374_10370364
603 Ga0157378_10001591
604 Ga0157378_10777212
605 Ga0157372_10029632
606 Ga0157372_10136310
607 Ga0157372_11339755
608 Ga0157372_11988975
609 Ga0157380_11193395
610 Ga0157377_10209490
611 Ga0206354_10669789
612 Ga0206353_11262890
613 Ga0207673_1003470
614 Ga0207697_10000056
615 Ga0207656_10003427
616 Ga0207656_10047253
617 Ga0207642_10148523
618 Ga0207688_10001342
619 Ga0207680_10069257
620 Ga0207647_10000579
621 Ga0207647_10198482
622 Ga0207645_10023137
623 Ga0207645_10354410
624 Ga0207645_10476713
625 Ga0207643_10322366
626 Ga0207705_10022465
627 Ga0207705_10023115
628 Ga0207705_10033411
629 Ga0207705_10099093
630 Ga0207705_10130039
631 Ga0207705_10181457
632 Ga0207705_10195151
633 Ga0207705_10201172
634 Ga0207705_10366026
635 Ga0207705_10410126
636 Ga0207705_10739540
637 Ga0207707_10025684
638 Ga0207707_10296545
639 Ga0207707_10380471
640 Ga0207707_10389858
641 Ga0207707_10502854
642 Ga0207707_10728695
643 Ga0207695_10047392
644 Ga0207695_11252538
645 Ga0207660_10000012
646 Ga0207660_10000776
647 Ga0207660_10111957
648 Ga0207660_10127207
649 Ga0207660_10194821
650 Ga0207660_10358639
651 Ga0207660_10372596
652 Ga0207660_11069669
653 Ga0207657_10003078
654 Ga0207657_10004573
655 Ga0207657_10043664
656 Ga0207657_10292245
657 Ga0207657_10350080
658 Ga0207657_10988593
659 Ga0207649_10037572
660 Ga0207649_10051989
661 Ga0207649_10078010
662 Ga0207649_10133427
663 Ga0207652_10204389
664 Ga0207652_10208833
665 Ga0207652_10348193
666 Ga0207652_10367884
667 Ga0207652_10415965
668 Ga0207652_10458302
669 Ga0207652_10901274
670 Ga0207652_11223231
671 Ga0207681_10032774
672 Ga0207681_10361485
673 Ga0207681_10559500
674 Ga0207681_11303674
675 Ga0207694_10185202
676 Ga0207694_10427460
677 Ga0207650_10113351
678 Ga0207659_10291682
679 Ga0207659_10590424
680 Ga0207687_10019996
681 Ga0207664_10931778
682 Ga0207664_11823585
683 Ga0207644_10018882
684 Ga0207690_10006438
685 Ga0207690_10047599
686 Ga0207690_10052300
687 Ga0207690_10087209
688 Ga0207690_10139019
689 Ga0207690_10262060
690 Ga0207690_10539540
691 Ga0207706_10000619
692 Ga0207706_10079700
693 Ga0207706_10179209
694 Ga0207709_10048746
695 Ga0207670_10043783
696 Ga0207669_10626904
697 Ga0207704_10260066
698 Ga0207711_10007131
699 Ga0207689_10000104
700 Ga0207689_10029213
701 Ga0207661_10319012
702 Ga0207661_10602103
703 Ga0207679_10099947
704 Ga0207679_10126810
705 Ga0207679_10214591
706 Ga0207679_10323398
707 Ga0207679_10464335
708 Ga0207679_11225430
709 Ga0207679_11380329
710 Ga0207679_11804938
711 Ga0207667_10104067
712 Ga0207667_10223708
713 Ga0207667_10398056
714 Ga0207667_10884809
715 Ga0207667_11053585
716 Ga0207651_10000128
717 Ga0207712_10045825
718 Ga0207668_10015311
719 Ga0207668_10051128
720 Ga0207668_10946260
721 Ga0207640_10053632
722 Ga0207640_10110649
723 Ga0207640_10122524
724 Ga0207640_10262184
725 Ga0207658_10003642
726 Ga0207677_10040003
727 Ga0207703_10005880
728 Ga0207703_10223163
729 Ga0207639_10038930
730 Ga0207639_10053352
731 Ga0207639_10090298
732 Ga0207639_10338718
733 Ga0207639_10926685
734 Ga0207678_10041871
735 Ga0207678_10044994
736 Ga0207678_10059188
737 Ga0207678_10151194
738 Ga0207678_10474424
739 Ga0207678_10538134
740 Ga0207678_10605688
741 Ga0207678_11028431
742 Ga0207702_10006964
743 Ga0207702_10254748
744 Ga0207702_10381194
745 Ga0207702_10410177
746 Ga0207702_10828614
747 Ga0207702_11485912
748 Ga0207702_11708491
749 Ga0207641_10013246
750 Ga0207641_10077310
751 Ga0207648_10000141
752 Ga0207648_10002387
753 Ga0207676_10007872
754 Ga0207674_10000714
755 Ga0207674_10017372
756 Ga0207674_10027615
757 Ga0207675_100025500
758 Ga0207683_10091574
759 Ga0207698_10004042
760 Ga0207698_10004175
761 Ga0207698_10011048
762 Ga0207698_10029430
763 Ga0207698_10036792
764 Ga0207698_10203682
765 Ga0207698_10267432
766 Ga0207698_10506534
767 Ga0207698_10725913
768 Ga0268266_10520610
769 Ga0268266_11083724
770 Ga0268265_10062797
771 Ga0268265_10141709
772 Ga0268265_10243180
773 Ga0268264_10006232
774 Ga0316182_1248735
775 Ga0307408_100308992
776 Ga0307405_10147385
777 Ga0307413_10722619
778 Ga0307413_10951285
779 Ga0307410_10021186
780 Ga0307410_10112540
781 Ga0307410_10159623
782 Ga0307410_10607895
783 Ga0307410_11811101
784 Ga0307406_10084791
785 Ga0307406_10338984
786 Ga0307407_10197893
787 Ga0307412_10061858
788 Ga0307412_10239020
789 Ga0307412_11088993
790 Ga0307412_11575691
791 Ga0307409_100150012
792 Ga0307409_100263942
793 Ga0307409_100438952
794 Ga0307409_100747125
795 Ga0307416_100174527
796 Ga0307416_100473958
797 Ga0307416_100608593
798 Ga0307416_101842815
799 Ga0307414_10143869
800 Ga0307414_10145157
801 Ga0307414_10885976
802 Ga0307414_12222719
803 Ga0307411_10117105
804 Ga0307411_10348504
805 Ga0307411_10351797
806 Ga0307411_10444710
807 Ga0307411_10581782
808 Ga0307411_11495000
809 Ga0307411_12307832
810 Ga0307415_100051544
811 Ga0307415_100156404
812 Ga0307415_100220145
813 Ga0307415_100262558
814 Ga0307415_100473313
815 Ga0307415_101344819
816 Ga0307415_101448224
817 Ga0373929_0023769
818 Ga0395899_0108521
819 Ga0395899_0180240
820 Ga0395899_0297190
821 Ga0395899_0352570
822 Ga0395900_0009277
823 Ga0395900_0106238
824 Ga0395900_0139595
825 Ga0395900_0141871
826 Ga0395900_0211235
827 Ga0395900_0337204
828 Ga0395900_0370238
829 Ga0395900_0465333
830 Ga0395900_1257760
831 Ga0395900_1558759
832 Ga0395898_0062819
833 Ga0395898_0380806
834 Ga0395898_0630245
835 Ga0395905_0116413
836 Ga0395905_0138359
837 Ga0395905_0735065
838 Ga0395905_1093498
839 Ga0395905_1845652
840 Ga0395901_0000268
841 Ga0395901_0092527
842 Ga0395901_0135757
843 Ga0395901_0143633
844 Ga0395901_0307734
845 Ga0395901_0324697
846 Ga0395901_0353672
847 Ga0395901_0563334
848 Ga0395901_0651433
849 Ga0395901_1961903
850 Ga0439438_064041
851 Ga0439442_152366
852 Ga0450914_000140
853 Ga0450917_002638
854 Ga0450905_000757
855 Ga0450889_003954
856 Ga0466969_0086653
857 Ga0466969_0093483
858 Ga0466966_0017969
859 Ga0466966_0020580
860 Ga0466961_0007049
861 Ga0466961_0013095
862 Ga0466961_0028834
863 Ga0466961_0945069
864 Ga0466963_0078691
865 Ga0466964_0076159
866 Ga0466964_0166360
867 Ga0466971_0003209
868 Ga0466971_0233793
869 Ga0466970_0006122
870 Ga0466957_0002791
871 Ga0466959_0064620
872 Ga0466959_0110645
873 Ga0466958_0010434
874 Ga0466958_0061835
875 Ga0466958_0206099
876 Ga0466958_0293218
877 Ga0466967_0031471
878 Ga0466967_0044592
879 Ga0466967_0142523
880 Ga0466967_0611607
881 Ga0466967_1282336
882 Ga0466967_1710675
883 Ga0495663_0101628
884 Ga0495677_0097862
885 Ga0495685_075812
886 Ga0496101_0376772
887 Ga0496104_0421496
888 Ga0496111_0081894
889 Ga0496112_0072264
890 Ga0496113_0098152
891 Ga0501067_0058130
892 Ga0501068_0080305
893 Ga0501068_0320811
894 nmdc:mga08y16_249453_c1
895 Ga0466962_0009213
896 Ga0466962_0073034

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

35

150

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l4u-assembly1.cif.gz_A-2 crystal structure of construct containing a. aeolicus ntrc1 receiver, central and dna binding domains 0.9002 16 141
5m7n-assembly1.cif.gz_B crystal structure of ntrx from brucella abortus in complex with atp processed with the crystaldirect automated mounting and cryo-cooling technology 0.8979 16 141
1mb3-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ 0.8906 17 136
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.8906 17 136
1m5u-assembly1.cif.gz_A crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form 0.889 17 136
ID Description Score Start End Superfamily
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9336 18 95 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.929 18 93 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9211 16 95 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9203 17 95 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9124 16 95 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A516IU41-F1-model_v4 Response regulator 0.9943 16 140 GO:0000160
AF-A0A0Q8QZA0-F1-model_v4 Response regulatory domain-containing protein 0.9822 18 139 GO:0000160
AF-A0A5C7NNY3-F1-model_v4 deleted 0.9817 17 139
AF-A0A5C7NNC9-F1-model_v4 deleted 0.9803 17 137
AF-A0A2G4YSF2-F1-model_v4 Diguanylate phosphodiesterase 0.9798 16 134 GO:0000160
GO:0071111

Map