F446223

General Info

Members Datasets Scaffolds Average Seq Length
448 211 896 155

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0549235|Ga0466957_0549235_278_769
Length 155
Sequence MRRHIFEAMMPAHEHQLHEGDALLSAARGRLTGQGEQWTEMRAAVFEALAGFDKPASAYDVAEAVSRKQDRRVAANSVYRILARRVESANAYIANAHPDCLHDCIFLICDRCGQAVHIDDDRLSSGIREAAKKAGFSAPRPVIEVRGTCGDCDEG

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
163 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
207 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
208 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
211 2739367865 Novosphingobium sp. GV013 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.89
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 4.24
Rhizosphere 91.07
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0549235 3300044842 Bacteria 805
2 JGI24740J21852_10008605 3300001979 Bacteria 4054
3 JGI24739J22299_10064366 3300001989 Bacteria 1152
4 JGI24739J22299_10090181 3300001989 Bacteria 934
5 JGI24735J21928_10059666 3300002067 Bacteria 1096
6 JGI24735J21928_10072222 3300002067 Bacteria 988
7 JGI24034J26672_10059551 3300002239 Bacteria 668
8 rootL2_10123961 3300003322 Bacteria 1618
9 Ga0065165_1001921 3300005262 Bacteria 19835
10 Ga0065712_10094237 3300005290 Bacteria 2247
11 Ga0070658_10048736 3300005327 Bacteria 3430
12 Ga0070658_10289540 3300005327 Bacteria 1395
13 Ga0070658_10615509 3300005327 Bacteria 941
14 Ga0070658_11154646 3300005327 Bacteria 673
15 Ga0070676_10019824 3300005328 Bacteria 3746
16 Ga0070683_100059595 3300005329 Bacteria 3546
17 Ga0070670_100001034 3300005331 Bacteria 22016
18 Ga0070666_10175324 3300005335 Bacteria 1503
19 Ga0070666_10188818 3300005335 Bacteria 1447
20 Ga0070666_11341649 3300005335 Bacteria 534
21 Ga0070680_100017636 3300005336 Bacteria 5631
22 Ga0070680_100222129 3300005336 Bacteria 1595
23 Ga0070682_100053399 3300005337 Bacteria 2532
24 Ga0070682_100412958 3300005337 Bacteria 1024
25 Ga0068868_100040920 3300005338 Bacteria 3609
26 Ga0068868_100158504 3300005338 Bacteria 1868
27 Ga0070660_100000493 3300005339 Bacteria 26295
28 Ga0070660_100007352 3300005339 Bacteria 7673
29 Ga0070660_100019247 3300005339 Bacteria 4999
30 Ga0070660_100036808 3300005339 Bacteria 3709
31 Ga0070660_100113511 3300005339 Bacteria 2157
32 Ga0070660_100352866 3300005339 Bacteria 1211
33 Ga0070660_100515296 3300005339 Bacteria 996
34 Ga0070691_10006375 3300005341 Bacteria 5393
35 Ga0070661_100013982 3300005344 Bacteria 5643
36 Ga0070661_100044664 3300005344 Bacteria 3237
37 Ga0070661_100060656 3300005344 Bacteria 2775
38 Ga0070661_100116348 3300005344 Bacteria 2000
39 Ga0070661_100365665 3300005344 Bacteria 1134
40 Ga0070692_10019550 3300005345 Bacteria 3270
41 Ga0070692_10031674 3300005345 Bacteria 2653
42 Ga0070668_100276052 3300005347 Bacteria 1402
43 Ga0070669_100195425 3300005353 Bacteria 1589
44 Ga0070675_100013986 3300005354 Bacteria 6319
45 Ga0070675_100036496 3300005354 Bacteria 4000
46 Ga0070671_100023793 3300005355 Bacteria 5014
47 Ga0070671_100121534 3300005355 Bacteria 2198
48 Ga0070674_100155714 3300005356 Bacteria 1729
49 Ga0070674_100407773 3300005356 Bacteria 1112
50 Ga0070674_100853039 3300005356 Bacteria 790
51 Ga0070673_100002512 3300005364 Bacteria 11196
52 Ga0070673_100024928 3300005364 Bacteria 4393
53 Ga0070673_100052467 3300005364 Bacteria 3199
54 Ga0070673_100664441 3300005364 Bacteria 955
55 Ga0070659_100000034 3300005366 Bacteria 115416
56 Ga0070659_100065110 3300005366 Bacteria 2886
57 Ga0070659_100317045 3300005366 Bacteria 1303
58 Ga0070667_100005333 3300005367 Bacteria 10739
59 Ga0070667_100279128 3300005367 Bacteria 1500
60 Ga0070667_101174893 3300005367 Bacteria 718
61 Ga0070714_100010037 3300005435 Bacteria 7471
62 Ga0070714_100098392 3300005435 Bacteria 2574
63 Ga0070713_100005994 3300005436 Bacteria 8365
64 Ga0070713_100078826 3300005436 Bacteria 2805
65 Ga0070713_101697878 3300005436 Bacteria 613
66 Ga0070663_100029451 3300005455 Bacteria 3752
67 Ga0070663_100084574 3300005455 Bacteria 2339
68 Ga0070663_100161809 3300005455 Bacteria 1723
69 Ga0070663_100766216 3300005455 Bacteria 825
70 Ga0070678_100032582 3300005456 Bacteria 3608
71 Ga0070678_100424803 3300005456 Bacteria 1159
72 Ga0070678_100564541 3300005456 Bacteria 1012
73 Ga0070662_100001652 3300005457 Bacteria 13715
74 Ga0070662_100006322 3300005457 Bacteria 7629
75 Ga0070662_100014307 3300005457 Bacteria 5298
76 Ga0070662_100076316 3300005457 Bacteria 2484
77 Ga0070662_100154175 3300005457 Bacteria 1792
78 Ga0070662_100197714 3300005457 Bacteria 1593
79 Ga0070681_10093694 3300005458 Bacteria 2952
80 Ga0070681_10402016 3300005458 Bacteria 1281
81 Ga0068867_100187656 3300005459 Bacteria 1648
82 Ga0070685_10309034 3300005466 Bacteria 1068
83 Ga0070679_100334993 3300005530 Bacteria 1461
84 Ga0070684_100007275 3300005535 Bacteria 8605
85 Ga0070684_100057990 3300005535 Bacteria 3382
86 Ga0070684_100549818 3300005535 Bacteria 1071
87 Ga0068853_100011622 3300005539 Bacteria 7156
88 Ga0068853_100099668 3300005539 Bacteria 2567
89 Ga0068853_100370587 3300005539 Bacteria 1336
90 Ga0068853_100510600 3300005539 Bacteria 1135
91 Ga0068853_100733794 3300005539 Bacteria 943
92 Ga0070672_100022888 3300005543 Bacteria 4598
93 Ga0070686_100000140 3300005544 Bacteria 49544
94 Ga0070665_100000105 3300005548 Bacteria 157734
95 Ga0070665_100000155 3300005548 Bacteria 125017
96 Ga0070665_100005893 3300005548 Bacteria 12557
97 Ga0070665_100044781 3300005548 Bacteria 4442
98 Ga0070665_100167811 3300005548 Bacteria 2197
99 Ga0070665_101515203 3300005548 Bacteria 679
100 Ga0070704_100628374 3300005549 Bacteria 946
101 Ga0068855_101958046 3300005563 Bacteria 593
102 Ga0070664_100014497 3300005564 Bacteria 6427
103 Ga0070664_100060424 3300005564 Bacteria 3227
104 Ga0070664_100311923 3300005564 Bacteria 1424
105 Ga0070664_100329228 3300005564 Bacteria 1385
106 Ga0068857_100028109 3300005577 Bacteria 4961
107 Ga0068857_100078813 3300005577 Bacteria 2940
108 Ga0068857_100623649 3300005577 Bacteria 1020
109 Ga0068854_100043828 3300005578 Bacteria 3173
110 Ga0068854_100065463 3300005578 Bacteria 2642
111 Ga0068854_100071352 3300005578 Bacteria 2540
112 Ga0068854_100311205 3300005578 Bacteria 1277
113 Ga0068854_100541639 3300005578 Bacteria 986
114 Ga0068856_100321116 3300005614 Bacteria 1565
115 Ga0068852_100217235 3300005616 Bacteria 1817
116 Ga0068852_100316603 3300005616 Bacteria 1514
117 Ga0068852_100371451 3300005616 Bacteria 1401
118 Ga0068852_100585612 3300005616 Bacteria 1119
119 Ga0068852_100651850 3300005616 Bacteria 1060
120 Ga0068859_100037542 3300005617 Bacteria 4862
121 Ga0068859_100078102 3300005617 Bacteria 3351
122 Ga0068859_101683006 3300005617 Bacteria 701
123 Ga0068861_100013143 3300005719 Bacteria 5790
124 Ga0068851_10046728 3300005834 Bacteria 2191
125 Ga0068870_10400966 3300005840 Bacteria 892
126 Ga0068863_100025159 3300005841 Bacteria 5676
127 Ga0068863_100033328 3300005841 Bacteria 4907
128 Ga0068858_100003225 3300005842 Bacteria 16284
129 Ga0068858_100162227 3300005842 Bacteria 2105
130 Ga0068860_100004562 3300005843 Bacteria 14135
131 Ga0068860_100051361 3300005843 Bacteria 3923
132 Ga0068862_100284718 3300005844 Bacteria 1516
133 Ga0070717_10470975 3300006028 Bacteria 1134
134 Ga0097621_100307297 3300006237 Bacteria 1402
135 Ga0068871_100238088 3300006358 Bacteria 1581
136 Ga0075430_100645589 3300006846 Bacteria 873
137 Ga0075434_100299844 3300006871 Bacteria 1628
138 Ga0068865_100083711 3300006881 Bacteria 2297
139 Ga0097620_100037542 3300006931 Bacteria 4862
140 Ga0097620_100078099 3300006931 Bacteria 3351
141 Ga0097620_101682938 3300006931 Bacteria 701
142 Ga0075435_101486991 3300007076 Bacteria 594
143 Ga0105240_10071890 3300009093 Bacteria 4277
144 Ga0105240_10119591 3300009093 Bacteria 3173
145 Ga0105245_10418496 3300009098 Bacteria 1343
146 Ga0105243_12150079 3300009148 Bacteria 594
147 Ga0105241_11581925 3300009174 Bacteria 633
148 Ga0105242_10514128 3300009176 Bacteria 1141
149 Ga0105248_10004580 3300009177 Bacteria 15309
150 Ga0105248_10122482 3300009177 Bacteria 2934
151 Ga0105248_10992173 3300009177 Bacteria 949
152 Ga0105248_12154195 3300009177 Bacteria 634
153 Ga0105237_10059044 3300009545 Bacteria 3838
154 Ga0105238_10150477 3300009551 Bacteria 2303
155 Ga0105238_10151906 3300009551 Bacteria 2291
156 Ga0105238_10174177 3300009551 Bacteria 2128
157 Ga0105249_10078026 3300009553 Bacteria 3072
158 Ga0105239_12709369 3300010375 Bacteria 578
159 Ga0157373_10027783 3300013100 Bacteria 4082
160 Ga0157373_10121285 3300013100 Bacteria 1837
161 Ga0157373_10168088 3300013100 Bacteria 1543
162 Ga0157371_10022019 3300013102 Bacteria 4677
163 Ga0157371_10048250 3300013102 Bacteria 3027
164 Ga0157371_10207819 3300013102 Bacteria 1404
165 Ga0157371_10591895 3300013102 Bacteria 824
166 Ga0157370_10021937 3300013104 Bacteria 6359
167 Ga0157370_10064826 3300013104 Bacteria 3457
168 Ga0157370_10217817 3300013104 Bacteria 1769
169 Ga0157370_10461209 3300013104 Bacteria 1168
170 Ga0157370_10695236 3300013104 Bacteria 928
171 Ga0157369_10008490 3300013105 Bacteria 11778
172 Ga0157369_10015109 3300013105 Bacteria 8713
173 Ga0157369_10062341 3300013105 Bacteria 4018
174 Ga0157369_10246020 3300013105 Bacteria 1867
175 Ga0157369_10969075 3300013105 Bacteria 871
176 Ga0157369_11869372 3300013105 Bacteria 610
177 Ga0157369_11886304 3300013105 Bacteria 607
178 Ga0157374_10006143 3300013296 Bacteria 10175
179 Ga0157374_10040625 3300013296 Bacteria 4285
180 Ga0157378_10088921 3300013297 Bacteria 2804
181 Ga0157378_10255971 3300013297 Bacteria 1678
182 Ga0157378_10729739 3300013297 Bacteria 1012
183 Ga0163162_10003899 3300013306 Bacteria 14323
184 Ga0163162_10060325 3300013306 Bacteria 3828
185 Ga0163162_10920801 3300013306 Bacteria 986
186 Ga0157372_10176333 3300013307 Bacteria 2474
187 Ga0157372_10210265 3300013307 Bacteria 2254
188 Ga0157375_10003022 3300013308 Bacteria 14591
189 Ga0157375_10083253 3300013308 Bacteria 3244
190 Ga0157375_10351342 3300013308 Bacteria 1640
191 Ga0157375_11129690 3300013308 Bacteria 918
192 Ga0157375_12504379 3300013308 Bacteria 616
193 Ga0163163_10006110 3300014325 Bacteria 10486
194 Ga0157380_11003545 3300014326 Bacteria 868
195 Ga0157376_10250455 3300014969 Bacteria 1654
196 Ga0206356_11863626 3300020070 Bacteria 1724
197 Ga0206354_10364096 3300020081 Bacteria 1174
198 Ga0206353_10501187 3300020082 Bacteria 1451
199 Ga0207697_10201253 3300025315 Bacteria 876
200 Ga0207688_10085286 3300025901 Bacteria 1809
201 Ga0207680_10008260 3300025903 Bacteria 5103
202 Ga0207680_10070333 3300025903 Bacteria 2166
203 Ga0207680_10671798 3300025903 Bacteria 742
204 Ga0207647_10006225 3300025904 Bacteria 8695
205 Ga0207647_10098727 3300025904 Bacteria 1735
206 Ga0207647_10222360 3300025904 Bacteria 1088
207 Ga0207645_10023748 3300025907 Bacteria 3981
208 Ga0207645_10096203 3300025907 Bacteria 1907
209 Ga0207643_10280556 3300025908 Bacteria 1033
210 Ga0207705_10005516 3300025909 Bacteria 9460
211 Ga0207705_10019599 3300025909 Bacteria 4836
212 Ga0207705_10023281 3300025909 Bacteria 4419
213 Ga0207705_10026804 3300025909 Bacteria 4107
214 Ga0207654_10029437 3300025911 Bacteria 3007
215 Ga0207707_10159519 3300025912 Bacteria 1972
216 Ga0207695_10011178 3300025913 Bacteria 10892
217 Ga0207671_10234042 3300025914 Bacteria 1442
218 Ga0207663_11683638 3300025916 Bacteria 510
219 Ga0207660_10033761 3300025917 Bacteria 3542
220 Ga0207657_10000020 3300025919 Bacteria 157826
221 Ga0207657_10000956 3300025919 Bacteria 30551
222 Ga0207657_10001472 3300025919 Bacteria 25161
223 Ga0207657_10008938 3300025919 Bacteria 10122
224 Ga0207657_10016201 3300025919 Bacteria 7195
225 Ga0207657_10023326 3300025919 Bacteria 5764
226 Ga0207657_10040377 3300025919 Bacteria 4134
227 Ga0207657_10123942 3300025919 Bacteria 2123
228 Ga0207657_10218127 3300025919 Bacteria 1529
229 Ga0207657_10350145 3300025919 Bacteria 1165
230 Ga0207649_10006175 3300025920 Bacteria 6502
231 Ga0207649_10006974 3300025920 Bacteria 6139
232 Ga0207649_10040996 3300025920 Bacteria 2817
233 Ga0207649_10085951 3300025920 Bacteria 2048
234 Ga0207649_10166874 3300025920 Bacteria 1530
235 Ga0207649_10298133 3300025920 Bacteria 1178
236 Ga0207649_10705919 3300025920 Bacteria 782
237 Ga0207681_10182144 3300025923 Bacteria 1601
238 Ga0207681_10563855 3300025923 Bacteria 938
239 Ga0207694_10012584 3300025924 Bacteria 6377
240 Ga0207650_10014857 3300025925 Bacteria 5416
241 Ga0207650_10126560 3300025925 Bacteria 1995
242 Ga0207650_10463340 3300025925 Bacteria 1056
243 Ga0207659_10010954 3300025926 Bacteria 5712
244 Ga0207659_10054843 3300025926 Bacteria 2848
245 Ga0207659_10106311 3300025926 Bacteria 2125
246 Ga0207687_10106570 3300025927 Bacteria 2072
247 Ga0207664_10048259 3300025929 Bacteria 3348
248 Ga0207644_10008480 3300025931 Bacteria 6728
249 Ga0207644_10022518 3300025931 Bacteria 4305
250 Ga0207644_10417773 3300025931 Bacteria 1098
251 Ga0207690_10000005 3300025932 Bacteria 581199
252 Ga0207690_10006514 3300025932 Bacteria 6922
253 Ga0207690_10035807 3300025932 Bacteria 3210
254 Ga0207690_10184377 3300025932 Bacteria 1574
255 Ga0207690_10818042 3300025932 Bacteria 770
256 Ga0207706_10004731 3300025933 Bacteria 12745
257 Ga0207706_10008102 3300025933 Bacteria 9697
258 Ga0207706_10042070 3300025933 Bacteria 4048
259 Ga0207706_10048797 3300025933 Bacteria 3744
260 Ga0207706_10128318 3300025933 Bacteria 2230
261 Ga0207706_10190921 3300025933 Bacteria 1798
262 Ga0207706_10325113 3300025933 Bacteria 1338
263 Ga0207686_10608442 3300025934 Bacteria 861
264 Ga0207669_10132330 3300025937 Bacteria 1716
265 Ga0207669_11201930 3300025937 Bacteria 642
266 Ga0207665_10181708 3300025939 Bacteria 1524
267 Ga0207691_10017864 3300025940 Bacteria 6721
268 Ga0207691_10535897 3300025940 Bacteria 993
269 Ga0207711_10029264 3300025941 Bacteria 4644
270 Ga0207711_10092092 3300025941 Bacteria 2667
271 Ga0207711_10252837 3300025941 Bacteria 1618
272 Ga0207661_10001385 3300025944 Bacteria 16276
273 Ga0207661_10016355 3300025944 Bacteria 5471
274 Ga0207661_10119172 3300025944 Bacteria 2245
275 Ga0207661_10664410 3300025944 Bacteria 958
276 Ga0207679_10069227 3300025945 Bacteria 2655
277 Ga0207679_10155549 3300025945 Bacteria 1866
278 Ga0207679_10303797 3300025945 Bacteria 1376
279 Ga0207679_10422249 3300025945 Bacteria 1177
280 Ga0207667_10013474 3300025949 Bacteria 9356
281 Ga0207667_10016897 3300025949 Bacteria 8232
282 Ga0207667_10471395 3300025949 Bacteria 1275
283 Ga0207651_10003994 3300025960 Bacteria 7332
284 Ga0207651_10105317 3300025960 Bacteria 2103
285 Ga0207668_10206272 3300025972 Bacteria 1569
286 Ga0207640_10009988 3300025981 Bacteria 5331
287 Ga0207640_10554571 3300025981 Bacteria 966
288 Ga0207658_10006970 3300025986 Bacteria 7693
289 Ga0207658_10405482 3300025986 Bacteria 1199
290 Ga0207677_10000029 3300026023 Bacteria 121521
291 Ga0207677_10099949 3300026023 Bacteria 2132
292 Ga0207677_10357908 3300026023 Bacteria 1225
293 Ga0207703_10055508 3300026035 Bacteria 3223
294 Ga0207703_10084841 3300026035 Bacteria 2649
295 Ga0207703_10229687 3300026035 Bacteria 1663
296 Ga0207639_10015722 3300026041 Bacteria 5339
297 Ga0207639_10084223 3300026041 Bacteria 2525
298 Ga0207639_10104336 3300026041 Bacteria 2298
299 Ga0207639_11575717 3300026041 Bacteria 616
300 Ga0207678_10001839 3300026067 Bacteria 19467
301 Ga0207678_10039236 3300026067 Bacteria 4110
302 Ga0207678_10049333 3300026067 Bacteria 3638
303 Ga0207678_10110665 3300026067 Bacteria 2343
304 Ga0207678_10282882 3300026067 Bacteria 1424
305 Ga0207678_10622727 3300026067 Bacteria 947
306 Ga0207702_10007190 3300026078 Bacteria 9527
307 Ga0207702_10034760 3300026078 Bacteria 4215
308 Ga0207702_10238351 3300026078 Bacteria 1703
309 Ga0207641_10182696 3300026088 Bacteria 1922
310 Ga0207641_10421406 3300026088 Bacteria 1285
311 Ga0207648_10144959 3300026089 Bacteria 2094
312 Ga0207648_10577045 3300026089 Bacteria 1035
313 Ga0207676_10002742 3300026095 Bacteria 12541
314 Ga0207674_10006650 3300026116 Bacteria 13580
315 Ga0207674_10017192 3300026116 Bacteria 7893
316 Ga0207674_10032929 3300026116 Bacteria 5432
317 Ga0207675_100087359 3300026118 Bacteria 2928
318 Ga0207683_10004762 3300026121 Bacteria 11684
319 Ga0207683_10019975 3300026121 Bacteria 5723
320 Ga0207683_10334952 3300026121 Bacteria 1387
321 Ga0207698_10001626 3300026142 Bacteria 13084
322 Ga0207698_10055084 3300026142 Bacteria 3062
323 Ga0207698_10083958 3300026142 Bacteria 2580
324 Ga0207698_10117903 3300026142 Bacteria 2240
325 Ga0207698_10580944 3300026142 Bacteria 1102
326 Ga0268266_10000002 3300028379 Bacteria 3059047
327 Ga0268266_10000055 3300028379 Bacteria 291630
328 Ga0268266_10001357 3300028379 Bacteria 29539
329 Ga0268266_10025308 3300028379 Bacteria 5049
330 Ga0268266_10060172 3300028379 Bacteria 3274
331 Ga0268264_10001374 3300028381 Bacteria 22774
332 Ga0268264_10297655 3300028381 Bacteria 1518
333 Ga0307517_10013727 3300028786 Bacteria 10972
334 Ga0307517_10014263 3300028786 Bacteria 10697
335 Ga0307408_100323218 3300031548 Bacteria 1300
336 Ga0307413_10724669 3300031824 Bacteria 829
337 Ga0307410_10089059 3300031852 Bacteria 2186
338 Ga0307410_10434281 3300031852 Bacteria 1068
339 Ga0307410_11030581 3300031852 Bacteria 711
340 Ga0307409_100436109 3300031995 Bacteria 1261
341 Ga0307416_100053751 3300032002 Bacteria 3233
342 Ga0307416_102446469 3300032002 Bacteria 621
343 Ga0307411_10114703 3300032005 Bacteria 1936
344 Ga0307415_100062716 3300032126 Bacteria 2579
345 Ga0307415_100096046 3300032126 Bacteria 2159
346 Ga0307415_100097534 3300032126 Bacteria 2146
347 Ga0373937_0759291 3300036401 Bacteria 917
348 Ga0395899_0002128 3300037312 Bacteria 16274
349 Ga0395899_0028050 3300037312 Bacteria 4240
350 Ga0395899_0039174 3300037312 Bacteria 3549
351 Ga0395900_0000136 3300037418 Bacteria 123664
352 Ga0395900_0160070 3300037418 Bacteria 2296
353 Ga0395900_0203065 3300037418 Bacteria 2004
354 Ga0395900_0611277 3300037418 Bacteria 1030
355 Ga0395900_1185067 3300037418 Bacteria 679
356 Ga0395900_1480587 3300037418 Bacteria 591
357 Ga0395898_0114959 3300037466 Bacteria 2578
358 Ga0395905_0055292 3300037471 Bacteria 3715
359 Ga0395905_0081052 3300037471 Bacteria 3041
360 Ga0395905_0219755 3300037471 Bacteria 1778
361 Ga0395905_0278545 3300037471 Bacteria 1558
362 Ga0395905_0294705 3300037471 Bacteria 1509
363 Ga0395905_0808634 3300037471 Bacteria 840
364 Ga0436364_1182596 3300037853 Bacteria 26080
365 Ga0395901_0000108 3300038443 Bacteria 113046
366 Ga0395901_0170937 3300038443 Bacteria 2280
367 Ga0395901_0237027 3300038443 Bacteria 1904
368 Ga0395901_0350477 3300038443 Bacteria 1523
369 Ga0395901_0483071 3300038443 Bacteria 1263
370 Ga0436365_0904559 3300039437 Bacteria 6510
371 Ga0436363_0985695 3300039450 Bacteria 1476
372 Ga0436362_0511555 3300039453 Bacteria 691
373 Ga0439436_0048151 3300041404 Bacteria 1210
374 Ga0451791_0210941 3300041451 Bacteria 569
375 Ga0451807_2701616 3300041486 Bacteria 1343
376 Ga0451845_0229754 3300041501 Bacteria 562
377 Ga0451849_0931423 3300041505 Bacteria 519
378 Ga0466972_0327081 3300044658 Bacteria 717
379 Ga0466966_0069967 3300044684 Bacteria 2200
380 Ga0466966_0334758 3300044684 Bacteria 910
381 Ga0466966_0335768 3300044684 Bacteria 908
382 Ga0466961_0239926 3300044693 Bacteria 1114
383 Ga0466961_0334993 3300044693 Bacteria 922
384 Ga0466963_0148695 3300044694 Bacteria 1626
385 Ga0466963_0395705 3300044694 Bacteria 974
386 Ga0466963_0962051 3300044694 Bacteria 601
387 Ga0466971_0017104 3300044719 Bacteria 3204
388 Ga0466971_0054448 3300044719 Bacteria 1803
389 Ga0466970_0248836 3300044765 Bacteria 995
390 Ga0466970_0371753 3300044765 Unclassified 813
391 Ga0466970_0657754 3300044765 Bacteria 610
392 Ga0466957_0022292 3300044842 Bacteria 3735
393 Ga0466957_0317056 3300044842 Bacteria 1051
394 Ga0466957_0863612 3300044842 Bacteria 645
395 Ga0466959_0169395 3300045049 Bacteria 1532
396 Ga0466959_0296455 3300045049 Bacteria 1108
397 Ga0466958_0115482 3300045836 Bacteria 1677
398 Ga0466967_0197459 3300045976 Bacteria 1904
399 Ga0466967_0574511 3300045976 Bacteria 1111
400 Ga0466967_0696146 3300045976 Bacteria 1006
401 Ga0466967_0802729 3300045976 Bacteria 934
402 Ga0495617_069095 3300046452 Bacteria 1162
403 Ga0495650_0000629 3300046471 Bacteria 47390
404 Ga0495639_0355702 3300046475 Bacteria 736
405 Ga0495583_0000420 3300046506 Bacteria 64084
406 Ga0495632_0508651 3300046519 Bacteria 519
407 Ga0495621_0029908 3300046539 Bacteria 1859
408 Ga0495633_0158769 3300046558 Bacteria 1043
409 Ga0495647_0185036 3300046681 Bacteria 908
410 Ga0495669_0009628 3300046684 Bacteria 4077
411 Ga0495669_0082539 3300046684 Bacteria 1477
412 Ga0495687_072917 3300047443 Bacteria 1370
413 Ga0495677_0189936 3300047445 Bacteria 797
414 Ga0496100_0519909 3300048903 Bacteria 918
415 Ga0496101_0005873 3300048904 Bacteria 7860
416 Ga0496101_0125213 3300048904 Bacteria 1947
417 Ga0496101_0467800 3300048904 Bacteria 995
418 Ga0496107_0030888 3300048910 Bacteria 3820
419 Ga0496107_0099520 3300048910 Bacteria 2131
420 Ga0496108_0015293 3300048911 Bacteria 6261
421 Ga0496108_0155520 3300048911 Bacteria 1974
422 Ga0496109_0022342 3300048912 Bacteria 5602
423 Ga0496110_0006431 3300048913 Bacteria 9303
424 Ga0496111_0011626 3300048914 Bacteria 5938
425 Ga0496112_0028190 3300048915 Bacteria 5417
426 Ga0496112_0515631 3300048915 Bacteria 1130
427 Ga0496113_0017479 3300048916 Bacteria 4979
428 Ga0496113_0186171 3300048916 Bacteria 1647
429 Ga0496114_0064650 3300048917 Bacteria 3064
430 Ga0496115_0071443 3300048918 Bacteria 2815
431 Ga0496121_0037372 3300048924 Bacteria 4313
432 Ga0496123_0515390 3300048926 Bacteria 520
433 Ga0501034_0802269 3300049571 Bacteria 834
434 Ga0501047_1074671 3300049581 Bacteria 618
435 nmdc:mga0k408_304869_c1 3300050493 Bacteria 950
436 nmdc:mga0n895_24275_c1 3300050512 Bacteria 5711
437 Ga0500643_006988 3300053087 Bacteria 4630
438 Ga0500658_0177573 3300053134 Bacteria 969
439 Ga0500568_0000942 3300053139 Bacteria 20047
440 Ga0500604_0000043 3300053151 Bacteria 48703
441 Ga0500616_0000293 3300053153 Bacteria 72597
442 Ga0500636_0000413 3300053177 Bacteria 23522
443 Ga0500596_000823 3300053735 Bacteria 6138
444 Ga0587088_017665 3300059508 Bacteria 1151
445 Ga0466962_0026858 3300061719 Bacteria 2764
446 Ga0466962_0049730 3300061719 Bacteria 2004
447 2739650786 2739367664 Bacteria 4114334
448 2740029259 2739367865 Bacteria 4114482
449 Ga0466957_0549235
450 JGI24740J21852_10008605
451 JGI24739J22299_10064366
452 JGI24739J22299_10090181
453 JGI24735J21928_10059666
454 JGI24735J21928_10072222
455 JGI24034J26672_10059551
456 rootL2_10123961
457 Ga0065165_1001921
458 Ga0065712_10094237
459 Ga0070658_10048736
460 Ga0070658_10289540
461 Ga0070658_10615509
462 Ga0070658_11154646
463 Ga0070676_10019824
464 Ga0070683_100059595
465 Ga0070670_100001034
466 Ga0070666_10175324
467 Ga0070666_10188818
468 Ga0070666_11341649
469 Ga0070680_100017636
470 Ga0070680_100222129
471 Ga0070682_100053399
472 Ga0070682_100412958
473 Ga0068868_100040920
474 Ga0068868_100158504
475 Ga0070660_100000493
476 Ga0070660_100007352
477 Ga0070660_100019247
478 Ga0070660_100036808
479 Ga0070660_100113511
480 Ga0070660_100352866
481 Ga0070660_100515296
482 Ga0070691_10006375
483 Ga0070661_100013982
484 Ga0070661_100044664
485 Ga0070661_100060656
486 Ga0070661_100116348
487 Ga0070661_100365665
488 Ga0070692_10019550
489 Ga0070692_10031674
490 Ga0070668_100276052
491 Ga0070669_100195425
492 Ga0070675_100013986
493 Ga0070675_100036496
494 Ga0070671_100023793
495 Ga0070671_100121534
496 Ga0070674_100155714
497 Ga0070674_100407773
498 Ga0070674_100853039
499 Ga0070673_100002512
500 Ga0070673_100024928
501 Ga0070673_100052467
502 Ga0070673_100664441
503 Ga0070659_100000034
504 Ga0070659_100065110
505 Ga0070659_100317045
506 Ga0070667_100005333
507 Ga0070667_100279128
508 Ga0070667_101174893
509 Ga0070714_100010037
510 Ga0070714_100098392
511 Ga0070713_100005994
512 Ga0070713_100078826
513 Ga0070713_101697878
514 Ga0070663_100029451
515 Ga0070663_100084574
516 Ga0070663_100161809
517 Ga0070663_100766216
518 Ga0070678_100032582
519 Ga0070678_100424803
520 Ga0070678_100564541
521 Ga0070662_100001652
522 Ga0070662_100006322
523 Ga0070662_100014307
524 Ga0070662_100076316
525 Ga0070662_100154175
526 Ga0070662_100197714
527 Ga0070681_10093694
528 Ga0070681_10402016
529 Ga0068867_100187656
530 Ga0070685_10309034
531 Ga0070679_100334993
532 Ga0070684_100007275
533 Ga0070684_100057990
534 Ga0070684_100549818
535 Ga0068853_100011622
536 Ga0068853_100099668
537 Ga0068853_100370587
538 Ga0068853_100510600
539 Ga0068853_100733794
540 Ga0070672_100022888
541 Ga0070686_100000140
542 Ga0070665_100000105
543 Ga0070665_100000155
544 Ga0070665_100005893
545 Ga0070665_100044781
546 Ga0070665_100167811
547 Ga0070665_101515203
548 Ga0070704_100628374
549 Ga0068855_101958046
550 Ga0070664_100014497
551 Ga0070664_100060424
552 Ga0070664_100311923
553 Ga0070664_100329228
554 Ga0068857_100028109
555 Ga0068857_100078813
556 Ga0068857_100623649
557 Ga0068854_100043828
558 Ga0068854_100065463
559 Ga0068854_100071352
560 Ga0068854_100311205
561 Ga0068854_100541639
562 Ga0068856_100321116
563 Ga0068852_100217235
564 Ga0068852_100316603
565 Ga0068852_100371451
566 Ga0068852_100585612
567 Ga0068852_100651850
568 Ga0068859_100037542
569 Ga0068859_100078102
570 Ga0068859_101683006
571 Ga0068861_100013143
572 Ga0068851_10046728
573 Ga0068870_10400966
574 Ga0068863_100025159
575 Ga0068863_100033328
576 Ga0068858_100003225
577 Ga0068858_100162227
578 Ga0068860_100004562
579 Ga0068860_100051361
580 Ga0068862_100284718
581 Ga0070717_10470975
582 Ga0097621_100307297
583 Ga0068871_100238088
584 Ga0075430_100645589
585 Ga0075434_100299844
586 Ga0068865_100083711
587 Ga0097620_100037542
588 Ga0097620_100078099
589 Ga0097620_101682938
590 Ga0075435_101486991
591 Ga0105240_10071890
592 Ga0105240_10119591
593 Ga0105245_10418496
594 Ga0105243_12150079
595 Ga0105241_11581925
596 Ga0105242_10514128
597 Ga0105248_10004580
598 Ga0105248_10122482
599 Ga0105248_10992173
600 Ga0105248_12154195
601 Ga0105237_10059044
602 Ga0105238_10150477
603 Ga0105238_10151906
604 Ga0105238_10174177
605 Ga0105249_10078026
606 Ga0105239_12709369
607 Ga0157373_10027783
608 Ga0157373_10121285
609 Ga0157373_10168088
610 Ga0157371_10022019
611 Ga0157371_10048250
612 Ga0157371_10207819
613 Ga0157371_10591895
614 Ga0157370_10021937
615 Ga0157370_10064826
616 Ga0157370_10217817
617 Ga0157370_10461209
618 Ga0157370_10695236
619 Ga0157369_10008490
620 Ga0157369_10015109
621 Ga0157369_10062341
622 Ga0157369_10246020
623 Ga0157369_10969075
624 Ga0157369_11869372
625 Ga0157369_11886304
626 Ga0157374_10006143
627 Ga0157374_10040625
628 Ga0157378_10088921
629 Ga0157378_10255971
630 Ga0157378_10729739
631 Ga0163162_10003899
632 Ga0163162_10060325
633 Ga0163162_10920801
634 Ga0157372_10176333
635 Ga0157372_10210265
636 Ga0157375_10003022
637 Ga0157375_10083253
638 Ga0157375_10351342
639 Ga0157375_11129690
640 Ga0157375_12504379
641 Ga0163163_10006110
642 Ga0157380_11003545
643 Ga0157376_10250455
644 Ga0206356_11863626
645 Ga0206354_10364096
646 Ga0206353_10501187
647 Ga0207697_10201253
648 Ga0207688_10085286
649 Ga0207680_10008260
650 Ga0207680_10070333
651 Ga0207680_10671798
652 Ga0207647_10006225
653 Ga0207647_10098727
654 Ga0207647_10222360
655 Ga0207645_10023748
656 Ga0207645_10096203
657 Ga0207643_10280556
658 Ga0207705_10005516
659 Ga0207705_10019599
660 Ga0207705_10023281
661 Ga0207705_10026804
662 Ga0207654_10029437
663 Ga0207707_10159519
664 Ga0207695_10011178
665 Ga0207671_10234042
666 Ga0207663_11683638
667 Ga0207660_10033761
668 Ga0207657_10000020
669 Ga0207657_10000956
670 Ga0207657_10001472
671 Ga0207657_10008938
672 Ga0207657_10016201
673 Ga0207657_10023326
674 Ga0207657_10040377
675 Ga0207657_10123942
676 Ga0207657_10218127
677 Ga0207657_10350145
678 Ga0207649_10006175
679 Ga0207649_10006974
680 Ga0207649_10040996
681 Ga0207649_10085951
682 Ga0207649_10166874
683 Ga0207649_10298133
684 Ga0207649_10705919
685 Ga0207681_10182144
686 Ga0207681_10563855
687 Ga0207694_10012584
688 Ga0207650_10014857
689 Ga0207650_10126560
690 Ga0207650_10463340
691 Ga0207659_10010954
692 Ga0207659_10054843
693 Ga0207659_10106311
694 Ga0207687_10106570
695 Ga0207664_10048259
696 Ga0207644_10008480
697 Ga0207644_10022518
698 Ga0207644_10417773
699 Ga0207690_10000005
700 Ga0207690_10006514
701 Ga0207690_10035807
702 Ga0207690_10184377
703 Ga0207690_10818042
704 Ga0207706_10004731
705 Ga0207706_10008102
706 Ga0207706_10042070
707 Ga0207706_10048797
708 Ga0207706_10128318
709 Ga0207706_10190921
710 Ga0207706_10325113
711 Ga0207686_10608442
712 Ga0207669_10132330
713 Ga0207669_11201930
714 Ga0207665_10181708
715 Ga0207691_10017864
716 Ga0207691_10535897
717 Ga0207711_10029264
718 Ga0207711_10092092
719 Ga0207711_10252837
720 Ga0207661_10001385
721 Ga0207661_10016355
722 Ga0207661_10119172
723 Ga0207661_10664410
724 Ga0207679_10069227
725 Ga0207679_10155549
726 Ga0207679_10303797
727 Ga0207679_10422249
728 Ga0207667_10013474
729 Ga0207667_10016897
730 Ga0207667_10471395
731 Ga0207651_10003994
732 Ga0207651_10105317
733 Ga0207668_10206272
734 Ga0207640_10009988
735 Ga0207640_10554571
736 Ga0207658_10006970
737 Ga0207658_10405482
738 Ga0207677_10000029
739 Ga0207677_10099949
740 Ga0207677_10357908
741 Ga0207703_10055508
742 Ga0207703_10084841
743 Ga0207703_10229687
744 Ga0207639_10015722
745 Ga0207639_10084223
746 Ga0207639_10104336
747 Ga0207639_11575717
748 Ga0207678_10001839
749 Ga0207678_10039236
750 Ga0207678_10049333
751 Ga0207678_10110665
752 Ga0207678_10282882
753 Ga0207678_10622727
754 Ga0207702_10007190
755 Ga0207702_10034760
756 Ga0207702_10238351
757 Ga0207641_10182696
758 Ga0207641_10421406
759 Ga0207648_10144959
760 Ga0207648_10577045
761 Ga0207676_10002742
762 Ga0207674_10006650
763 Ga0207674_10017192
764 Ga0207674_10032929
765 Ga0207675_100087359
766 Ga0207683_10004762
767 Ga0207683_10019975
768 Ga0207683_10334952
769 Ga0207698_10001626
770 Ga0207698_10055084
771 Ga0207698_10083958
772 Ga0207698_10117903
773 Ga0207698_10580944
774 Ga0268266_10000002
775 Ga0268266_10000055
776 Ga0268266_10001357
777 Ga0268266_10025308
778 Ga0268266_10060172
779 Ga0268264_10001374
780 Ga0268264_10297655
781 Ga0307517_10013727
782 Ga0307517_10014263
783 Ga0307408_100323218
784 Ga0307413_10724669
785 Ga0307410_10089059
786 Ga0307410_10434281
787 Ga0307410_11030581
788 Ga0307409_100436109
789 Ga0307416_100053751
790 Ga0307416_102446469
791 Ga0307411_10114703
792 Ga0307415_100062716
793 Ga0307415_100096046
794 Ga0307415_100097534
795 Ga0373937_0759291
796 Ga0395899_0002128
797 Ga0395899_0028050
798 Ga0395899_0039174
799 Ga0395900_0000136
800 Ga0395900_0160070
801 Ga0395900_0203065
802 Ga0395900_0611277
803 Ga0395900_1185067
804 Ga0395900_1480587
805 Ga0395898_0114959
806 Ga0395905_0055292
807 Ga0395905_0081052
808 Ga0395905_0219755
809 Ga0395905_0278545
810 Ga0395905_0294705
811 Ga0395905_0808634
812 Ga0436364_1182596
813 Ga0395901_0000108
814 Ga0395901_0170937
815 Ga0395901_0237027
816 Ga0395901_0350477
817 Ga0395901_0483071
818 Ga0436365_0904559
819 Ga0436363_0985695
820 Ga0436362_0511555
821 Ga0439436_0048151
822 Ga0451791_0210941
823 Ga0451807_2701616
824 Ga0451845_0229754
825 Ga0451849_0931423
826 Ga0466972_0327081
827 Ga0466966_0069967
828 Ga0466966_0334758
829 Ga0466966_0335768
830 Ga0466961_0239926
831 Ga0466961_0334993
832 Ga0466963_0148695
833 Ga0466963_0395705
834 Ga0466963_0962051
835 Ga0466971_0017104
836 Ga0466971_0054448
837 Ga0466970_0248836
838 Ga0466970_0371753
839 Ga0466970_0657754
840 Ga0466957_0022292
841 Ga0466957_0317056
842 Ga0466957_0863612
843 Ga0466959_0169395
844 Ga0466959_0296455
845 Ga0466958_0115482
846 Ga0466967_0197459
847 Ga0466967_0574511
848 Ga0466967_0696146
849 Ga0466967_0802729
850 Ga0495617_069095
851 Ga0495650_0000629
852 Ga0495639_0355702
853 Ga0495583_0000420
854 Ga0495632_0508651
855 Ga0495621_0029908
856 Ga0495633_0158769
857 Ga0495647_0185036
858 Ga0495669_0009628
859 Ga0495669_0082539
860 Ga0495687_072917
861 Ga0495677_0189936
862 Ga0496100_0519909
863 Ga0496101_0005873
864 Ga0496101_0125213
865 Ga0496101_0467800
866 Ga0496107_0030888
867 Ga0496107_0099520
868 Ga0496108_0015293
869 Ga0496108_0155520
870 Ga0496109_0022342
871 Ga0496110_0006431
872 Ga0496111_0011626
873 Ga0496112_0028190
874 Ga0496112_0515631
875 Ga0496113_0017479
876 Ga0496113_0186171
877 Ga0496114_0064650
878 Ga0496115_0071443
879 Ga0496121_0037372
880 Ga0496123_0515390
881 Ga0501034_0802269
882 Ga0501047_1074671
883 nmdc:mga0k408_304869_c1
884 nmdc:mga0n895_24275_c1
885 Ga0500643_006988
886 Ga0500658_0177573
887 Ga0500568_0000942
888 Ga0500604_0000043
889 Ga0500616_0000293
890 Ga0500636_0000413
891 Ga0500596_000823
892 Ga0587088_017665
893 Ga0466962_0026858
894 Ga0466962_0049730
895 2739650786
896 2740029259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

33

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y6i-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa hmgr 0.9082 32 96
4mtd-assembly1.cif.gz_B zinc uptake regulator complexed with zinc and dna 0.8616 12 154
7dh8-assembly1.cif.gz_A-2 crystal structure of holo xczur 0.8381 11 153
6qua-assembly1.cif.gz_A the complex structure of hsrosr-sg (vng0258/rosr-sg) 0.8299 27 97
7dh8-assembly1.cif.gz_A-2 crystal structure of holo xczur 0.8279 11 153
ID Description Score Start End Superfamily
4mteC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9145 12 94 1.10.10.10
4mtdB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9121 12 94 1.10.10.10
2xroF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9116 32 94 1.10.10.10
af_Q2FY73_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9084 11 94 1.10.10.10
4mteD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8903 7 94 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A258BNZ9-F1-model_v4 Transcriptional repressor 0.9705 1 108 GO:0003700
AF-A0A1G3JD87-F1-model_v4 Fur family transcriptional regulator 0.9652 1 152 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900376
AF-A0A5E7ZI02-F1-model_v4 Fur family transcriptional regulator 0.9612 2 153 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900376
AF-A0A2W6S2S8-F1-model_v4 Ferric uptake regulation protein 0.961 1 149 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900376
AF-A0A3N2QP22-F1-model_v4 deleted 0.9602 1 150

Map