F446236

General Info

Members Datasets Scaffolds Average Seq Length
448 218 448 157

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_1237515|Ga0496106_1237515_94_513
Length 139
Sequence MSALFPDPSLSRVYRLEATLGEPLDLGDLPTGRRRIVPLAGGTFAGPELNGRLLPGASADWQLVLPDGTALGDGVRHGSADVLERLARGEDVDASEYTFRTSTQIETAEPELDWLNKGVFISVGGRQPGRVIYETYLVG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 14.51
Rhizosphere 84.38
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10015188 3300003373 Bacteria 1987
2 JGI25407J50210_10016411 3300003373 Bacteria 1918
3 Ga0068869_100012077 3300005334 Bacteria 5693
4 Ga0070666_10164898 3300005335 Bacteria 1550
5 Ga0070680_100222668 3300005336 Bacteria 1593
6 Ga0068868_100080687 3300005338 Bacteria 2607
7 Ga0068868_100454339 3300005338 Bacteria 1115
8 Ga0070660_100034351 3300005339 Bacteria 3831
9 Ga0070689_100129663 3300005340 Bacteria 2021
10 Ga0070691_10081442 3300005341 Bacteria 1586
11 Ga0070687_100360208 3300005343 Bacteria 941
12 Ga0070692_10033185 3300005345 Bacteria 2601
13 Ga0070668_100364706 3300005347 Bacteria 1226
14 Ga0070675_100035425 3300005354 Bacteria 4055
15 Ga0070671_100365144 3300005355 Bacteria 1233
16 Ga0070671_101213185 3300005355 Bacteria 664
17 Ga0070688_100504936 3300005365 Bacteria 913
18 Ga0070714_100030611 3300005435 Bacteria 4482
19 Ga0070714_100054052 3300005435 Bacteria 3430
20 Ga0070714_100164036 3300005435 Bacteria 2012
21 Ga0070714_100356252 3300005435 Bacteria 1375
22 Ga0070714_100477721 3300005435 Bacteria 1187
23 Ga0070713_100036198 3300005436 Bacteria 3981
24 Ga0070713_100240717 3300005436 Bacteria 1648
25 Ga0070713_100671441 3300005436 Bacteria 988
26 Ga0070710_10001036 3300005437 Bacteria 13206
27 Ga0070710_10069955 3300005437 Unclassified 2020
28 Ga0070710_11269090 3300005437 Unclassified 547
29 Ga0070701_10179703 3300005438 Bacteria 1238
30 Ga0070711_100021868 3300005439 Bacteria 4140
31 Ga0070711_100443498 3300005439 Bacteria 1061
32 Ga0070711_100453958 3300005439 Unclassified 1050
33 Ga0070711_100680637 3300005439 Bacteria 865
34 Ga0070705_100036520 3300005440 Bacteria 2763
35 Ga0070708_100086160 3300005445 Bacteria 2852
36 Ga0070708_100379172 3300005445 Bacteria 1333
37 Ga0070708_100778543 3300005445 Bacteria 899
38 Ga0070708_101138466 3300005445 Bacteria 730
39 Ga0070663_100018030 3300005455 Bacteria 4619
40 Ga0070678_100173049 3300005456 Bacteria 1760
41 Ga0070678_100999165 3300005456 Bacteria 769
42 Ga0070678_101040453 3300005456 Bacteria 754
43 Ga0070662_100046925 3300005457 Bacteria 3105
44 Ga0070662_100535738 3300005457 Bacteria 980
45 Ga0070662_100543198 3300005457 Bacteria 973
46 Ga0070681_10054258 3300005458 Bacteria 3993
47 Ga0070706_100088379 3300005467 Bacteria 2873
48 Ga0070706_100189195 3300005467 Bacteria 1923
49 Ga0070706_100551184 3300005467 Bacteria 1072
50 Ga0070707_100002256 3300005468 Bacteria 18401
51 Ga0070707_100014225 3300005468 Bacteria 7458
52 Ga0070707_100014699 3300005468 Bacteria 7336
53 Ga0070707_100509344 3300005468 Bacteria 1165
54 Ga0070707_100763372 3300005468 Bacteria 930
55 Ga0070707_100803457 3300005468 Bacteria 904
56 Ga0070707_101225706 3300005468 Bacteria 716
57 Ga0070707_101755969 3300005468 Unclassified 588
58 Ga0070698_100236777 3300005471 Bacteria 1759
59 Ga0070698_100253953 3300005471 Bacteria 1690
60 Ga0070698_100394281 3300005471 Bacteria 1317
61 Ga0070698_100468159 3300005471 Unclassified 1196
62 Ga0070698_100853429 3300005471 Bacteria 855
63 Ga0070698_101450210 3300005471 Bacteria 637
64 Ga0070699_100079505 3300005518 Bacteria 2856
65 Ga0070699_100383269 3300005518 Unclassified 1269
66 Ga0070679_100082352 3300005530 Bacteria 3208
67 Ga0070684_100087519 3300005535 Bacteria 2766
68 Ga0070697_100198328 3300005536 Bacteria 1706
69 Ga0070672_100267885 3300005543 Bacteria 1442
70 Ga0070686_100084970 3300005544 Bacteria 2104
71 Ga0070695_100038103 3300005545 Bacteria 3031
72 Ga0070695_100062090 3300005545 Bacteria 2426
73 Ga0070695_100209444 3300005545 Bacteria 1398
74 Ga0070695_100641667 3300005545 Bacteria 838
75 Ga0070696_100376368 3300005546 Bacteria 1105
76 Ga0070693_100022158 3300005547 Bacteria 3373
77 Ga0070665_100017738 3300005548 Bacteria 7148
78 Ga0070704_100068834 3300005549 Bacteria 2562
79 Ga0070704_100171410 3300005549 Unclassified 1726
80 Ga0070704_100248999 3300005549 Bacteria 1458
81 Ga0068855_100105256 3300005563 Bacteria 3244
82 Ga0068855_100231286 3300005563 Bacteria 2070
83 Ga0070664_100018335 3300005564 Bacteria 5748
84 Ga0068857_100108696 3300005577 Bacteria 2491
85 Ga0068854_100010971 3300005578 Bacteria 5879
86 Ga0070702_100102965 3300005615 Bacteria 1755
87 Ga0070702_100218243 3300005615 Bacteria 1273
88 Ga0068852_100031197 3300005616 Bacteria 4394
89 Ga0068866_10151753 3300005718 Bacteria 1342
90 Ga0068861_100005826 3300005719 Bacteria 8366
91 Ga0068870_10686058 3300005840 Bacteria 705
92 Ga0068863_100229447 3300005841 Bacteria 1790
93 Ga0068858_100131907 3300005842 Bacteria 2343
94 Ga0068858_100163355 3300005842 Bacteria 2097
95 Ga0068860_100103421 3300005843 Bacteria 2718
96 Ga0068860_100389936 3300005843 Bacteria 1376
97 Ga0068860_100431192 3300005843 Bacteria 1308
98 Ga0068862_100229744 3300005844 Bacteria 1683
99 Ga0068862_100368149 3300005844 Bacteria 1337
100 Ga0081455_10192251 3300005937 Bacteria 1536
101 Ga0081538_10002279 3300005981 Bacteria 18960
102 Ga0081540_1072739 3300005983 Bacteria 1582
103 Ga0070717_10003237 3300006028 Bacteria 11636
104 Ga0070717_10020693 3300006028 Bacteria 5179
105 Ga0070717_10386471 3300006028 Bacteria 1256
106 Ga0070717_10789984 3300006028 Unclassified 863
107 Ga0075363_100268024 3300006048 Bacteria 986
108 Ga0075364_10074951 3300006051 Bacteria 2232
109 Ga0070715_10000676 3300006163 Bacteria 9140
110 Ga0070715_10041197 3300006163 Bacteria 1934
111 Ga0070715_10126788 3300006163 Bacteria 1223
112 Ga0070716_100018717 3300006173 Bacteria 3611
113 Ga0070716_100049589 3300006173 Bacteria 2379
114 Ga0070716_100132859 3300006173 Bacteria 1576
115 Ga0070712_100032478 3300006175 Bacteria 3526
116 Ga0070712_100033141 3300006175 Bacteria 3493
117 Ga0070712_100043305 3300006175 Bacteria 3098
118 Ga0070712_100073313 3300006175 Bacteria 2455
119 Ga0070712_100121765 3300006175 Bacteria 1964
120 Ga0070712_100182486 3300006175 Bacteria 1636
121 Ga0097621_100031156 3300006237 Bacteria 4230
122 Ga0068871_100136779 3300006358 Bacteria 2081
123 Ga0075428_100023117 3300006844 Bacteria 6877
124 Ga0075428_101845159 3300006844 Unclassified 629
125 Ga0075431_100067663 3300006847 Bacteria 3687
126 Ga0075431_100252753 3300006847 Bacteria 1790
127 Ga0075431_100666953 3300006847 Bacteria 1019
128 Ga0075431_100771398 3300006847 Bacteria 936
129 Ga0075433_10043853 3300006852 Bacteria 3884
130 Ga0075433_10339907 3300006852 Bacteria 1327
131 Ga0075433_10404864 3300006852 Unclassified 1204
132 Ga0075434_100065067 3300006871 Bacteria 3631
133 Ga0075436_100033456 3300006914 Bacteria 3543
134 Ga0075435_100006961 3300007076 Bacteria 8027
135 Ga0075435_100330956 3300007076 Bacteria 1304
136 Ga0099794_10384197 3300007265 Bacteria 732
137 Ga0105251_10055937 3300009011 Bacteria 1869
138 Ga0105251_10146855 3300009011 Bacteria 1066
139 Ga0105240_10109788 3300009093 Bacteria 3340
140 Ga0111539_10083544 3300009094 Bacteria 3755
141 Ga0111539_10616983 3300009094 Bacteria 1263
142 Ga0105245_10035473 3300009098 Bacteria 4427
143 Ga0105245_10479367 3300009098 Bacteria 1257
144 Ga0105245_11825043 3300009098 Bacteria 661
145 Ga0105247_10034877 3300009101 Bacteria 3065
146 Ga0114129_10028650 3300009147 Bacteria 7890
147 Ga0114129_10134453 3300009147 Bacteria 3394
148 Ga0114129_10308382 3300009147 Bacteria 2108
149 Ga0114129_12653931 3300009147 Bacteria 597
150 Ga0105243_10140507 3300009148 Bacteria 2060
151 Ga0105243_10284213 3300009148 Bacteria 1492
152 Ga0105243_10286159 3300009148 Bacteria 1487
153 Ga0105243_10871189 3300009148 Unclassified 893
154 Ga0105243_11072903 3300009148 Unclassified 812
155 Ga0105243_11184171 3300009148 Unclassified 776
156 Ga0105242_10279051 3300009176 Unclassified 1517
157 Ga0105242_10345152 3300009176 Unclassified 1373
158 Ga0105242_10500993 3300009176 Bacteria 1155
159 Ga0105242_10663090 3300009176 Bacteria 1016
160 Ga0105242_10728426 3300009176 Bacteria 974
161 Ga0105242_10866553 3300009176 Bacteria 900
162 Ga0105248_10021223 3300009177 Bacteria 7196
163 Ga0105237_10117558 3300009545 Bacteria 2653
164 Ga0105237_10898684 3300009545 Unclassified 893
165 Ga0105238_10435806 3300009551 Bacteria 1306
166 Ga0105249_10044179 3300009553 Bacteria 4052
167 Ga0105249_10967772 3300009553 Bacteria 919
168 Ga0099796_10064521 3300010159 Bacteria 1307
169 Ga0105239_10061329 3300010375 Bacteria 4127
170 Ga0105239_10144031 3300010375 Bacteria 2656
171 Ga0105239_10476273 3300010375 Bacteria 1418
172 Ga0105239_10582692 3300010375 Unclassified 1275
173 Ga0105239_11550622 3300010375 Bacteria 766
174 Ga0105246_10083461 3300011119 Bacteria 2283
175 Ga0157373_10158594 3300013100 Bacteria 1592
176 Ga0157371_10330374 3300013102 Bacteria 1108
177 Ga0157369_10494128 3300013105 Unclassified 1266
178 Ga0157374_10950173 3300013296 Bacteria 878
179 Ga0157378_10182943 3300013297 Bacteria 1972
180 Ga0163162_10060171 3300013306 Bacteria 3832
181 Ga0163162_10325099 3300013306 Bacteria 1670
182 Ga0163162_10326435 3300013306 Bacteria 1667
183 Ga0157372_11439574 3300013307 Bacteria 794
184 Ga0157375_10023755 3300013308 Bacteria 5663
185 Ga0157375_10791967 3300013308 Unclassified 1097
186 Ga0157375_12087958 3300013308 Unclassified 674
187 Ga0163163_10103982 3300014325 Bacteria 2865
188 Ga0163163_10140119 3300014325 Bacteria 2461
189 Ga0163163_12016261 3300014325 Bacteria 637
190 Ga0157379_10339099 3300014968 Bacteria 1374
191 Ga0157379_10953218 3300014968 Bacteria 816
192 Ga0163161_10095403 3300017792 Bacteria 2206
193 Ga0163161_10439572 3300017792 Bacteria 1053
194 Ga0206353_10201732 3300020082 Bacteria 1286
195 Ga0224712_10218267 3300022467 Unclassified 872
196 Ga0207653_10013615 3300025885 Bacteria 2547
197 Ga0207653_10021733 3300025885 Bacteria 2035
198 Ga0207692_10069617 3300025898 Bacteria 1849
199 Ga0207710_10306854 3300025900 Bacteria 803
200 Ga0207680_10071014 3300025903 Bacteria 2157
201 Ga0207647_10543855 3300025904 Bacteria 645
202 Ga0207685_10020588 3300025905 Bacteria 2196
203 Ga0207685_10065864 3300025905 Bacteria 1452
204 Ga0207685_10125731 3300025905 Bacteria 1132
205 Ga0207699_10004897 3300025906 Bacteria 6407
206 Ga0207699_10015164 3300025906 Bacteria 3998
207 Ga0207699_10194705 3300025906 Bacteria 1370
208 Ga0207699_10461474 3300025906 Bacteria 912
209 Ga0207684_10118751 3300025910 Bacteria 2266
210 Ga0207684_10178247 3300025910 Bacteria 1832
211 Ga0207684_10308891 3300025910 Bacteria 1363
212 Ga0207684_10413243 3300025910 Bacteria 1159
213 Ga0207684_10535716 3300025910 Bacteria 1002
214 Ga0207654_10091933 3300025911 Bacteria 1852
215 Ga0207707_10151735 3300025912 Bacteria 2025
216 Ga0207707_10422528 3300025912 Bacteria 1143
217 Ga0207671_10304362 3300025914 Bacteria 1260
218 Ga0207693_10014535 3300025915 Bacteria 6326
219 Ga0207693_10035028 3300025915 Bacteria 3960
220 Ga0207693_10075384 3300025915 Bacteria 2641
221 Ga0207693_10078884 3300025915 Bacteria 2577
222 Ga0207693_10301363 3300025915 Bacteria 1255
223 Ga0207693_10664531 3300025915 Bacteria 809
224 Ga0207663_10036663 3300025916 Bacteria 2951
225 Ga0207663_10207716 3300025916 Bacteria 1417
226 Ga0207660_10141091 3300025917 Bacteria 1842
227 Ga0207657_10071913 3300025919 Bacteria 2927
228 Ga0207652_10120256 3300025921 Bacteria 2336
229 Ga0207646_10003348 3300025922 Bacteria 18188
230 Ga0207646_10006696 3300025922 Bacteria 11875
231 Ga0207646_10020005 3300025922 Bacteria 6209
232 Ga0207646_10406219 3300025922 Bacteria 1230
233 Ga0207646_10586214 3300025922 Unclassified 1001
234 Ga0207646_10905737 3300025922 Bacteria 782
235 Ga0207694_10497845 3300025924 Bacteria 1020
236 Ga0207650_10601520 3300025925 Bacteria 925
237 Ga0207659_10054509 3300025926 Bacteria 2856
238 Ga0207687_10158801 3300025927 Bacteria 1733
239 Ga0207687_10444179 3300025927 Bacteria 1075
240 Ga0207700_10008307 3300025928 Bacteria 6421
241 Ga0207700_10054163 3300025928 Bacteria 3009
242 Ga0207700_10189067 3300025928 Bacteria 1729
243 Ga0207664_10004373 3300025929 Bacteria 9576
244 Ga0207664_10032065 3300025929 Bacteria 4025
245 Ga0207664_10050779 3300025929 Bacteria 3271
246 Ga0207664_10285652 3300025929 Bacteria 1449
247 Ga0207664_10534264 3300025929 Bacteria 1051
248 Ga0207664_10804310 3300025929 Unclassified 845
249 Ga0207644_10418445 3300025931 Bacteria 1097
250 Ga0207690_10041355 3300025932 Bacteria 3020
251 Ga0207706_10046273 3300025933 Bacteria 3853
252 Ga0207706_10082234 3300025933 Bacteria 2831
253 Ga0207706_10759634 3300025933 Unclassified 826
254 Ga0207686_10108104 3300025934 Unclassified 1870
255 Ga0207686_10186039 3300025934 Bacteria 1477
256 Ga0207709_10213643 3300025935 Bacteria 1386
257 Ga0207709_10422734 3300025935 Bacteria 1024
258 Ga0207670_10089713 3300025936 Bacteria 2170
259 Ga0207665_10003278 3300025939 Bacteria 10844
260 Ga0207665_10010634 3300025939 Bacteria 6045
261 Ga0207665_10012676 3300025939 Bacteria 5543
262 Ga0207665_10480189 3300025939 Unclassified 957
263 Ga0207665_10518786 3300025939 Bacteria 922
264 Ga0207665_10613787 3300025939 Bacteria 850
265 Ga0207665_10854180 3300025939 Bacteria 721
266 Ga0207665_10865823 3300025939 Bacteria 716
267 Ga0207691_10461609 3300025940 Bacteria 1080
268 Ga0207711_10679514 3300025941 Bacteria 960
269 Ga0207689_10025446 3300025942 Bacteria 4961
270 Ga0207679_10350196 3300025945 Bacteria 1287
271 Ga0207667_10708961 3300025949 Bacteria 1008
272 Ga0207667_11291270 3300025949 Unclassified 707
273 Ga0207712_10018877 3300025961 Bacteria 4497
274 Ga0207712_10227990 3300025961 Bacteria 1494
275 Ga0207712_10258836 3300025961 Unclassified 1410
276 Ga0207712_10511373 3300025961 Bacteria 1028
277 Ga0207668_10142269 3300025972 Bacteria 1846
278 Ga0207668_10167648 3300025972 Bacteria 1719
279 Ga0207640_10558130 3300025981 Bacteria 963
280 Ga0207677_10461310 3300026023 Unclassified 1091
281 Ga0207677_10622950 3300026023 Bacteria 949
282 Ga0207703_10010783 3300026035 Bacteria 7129
283 Ga0207703_10178806 3300026035 Bacteria 1871
284 Ga0207703_10872084 3300026035 Bacteria 861
285 Ga0207639_10441030 3300026041 Bacteria 1180
286 Ga0207702_10077448 3300026078 Bacteria 2876
287 Ga0207641_10553978 3300026088 Bacteria 1121
288 Ga0207674_10097223 3300026116 Bacteria 2928
289 Ga0207675_100000907 3300026118 Bacteria 29583
290 Ga0207675_100046130 3300026118 Bacteria 4070
291 Ga0207675_100978350 3300026118 Bacteria 864
292 Ga0207675_101227124 3300026118 Bacteria 770
293 Ga0207683_10047961 3300026121 Bacteria 3740
294 Ga0207683_10466810 3300026121 Unclassified 1164
295 Ga0207698_10136078 3300026142 Bacteria 2108
296 Ga0268265_10195352 3300028380 Bacteria 1751
297 Ga0268265_10701963 3300028380 Bacteria 977
298 Ga0268264_10691282 3300028381 Bacteria 1012
299 Ga0268264_10847634 3300028381 Bacteria 915
300 Ga0373930_0007878 3300034816 Bacteria 1847
301 Ga0373950_0027891 3300034818 Bacteria 1032
302 Ga0373959_0014849 3300034820 Bacteria 1423
303 Ga0373940_0034515 3300035088 Bacteria 1365
304 Ga0373932_0077540 3300035112 Bacteria 1043
305 Ga0373932_0150083 3300035112 Bacteria 799
306 Ga0373941_0007453 3300035115 Bacteria 2677
307 Ga0373960_0039594 3300035121 Bacteria 1356
308 Ga0373942_0074906 3300035207 Bacteria 995
309 Ga0373962_0082963 3300035242 Bacteria 976
310 Ga0373931_0018507 3300035691 Bacteria 3465
311 Ga0373937_0875016 3300036401 Bacteria 847
312 Ga0373925_0535233 3300037068 Bacteria 963
313 Ga0395899_0363700 3300037312 Bacteria 965
314 Ga0395900_0035117 3300037418 Bacteria 5164
315 Ga0395900_0054791 3300037418 Bacteria 4106
316 Ga0395898_0013706 3300037466 Bacteria 8338
317 Ga0395898_0171753 3300037466 Unclassified 2072
318 Ga0395898_0181013 3300037466 Bacteria 2014
319 Ga0395898_0914308 3300037466 Bacteria 815
320 Ga0395905_0068831 3300037471 Bacteria 3315
321 Ga0395905_0115495 3300037471 Bacteria 2523
322 Ga0395905_0147933 3300037471 Bacteria 2210
323 Ga0395901_0065083 3300038443 Bacteria 3795
324 Ga0395901_0315529 3300038443 Unclassified 1618
325 Ga0395901_0604410 3300038443 Bacteria 1105
326 Ga0451853_0943107 3300041512 Bacteria 1063
327 Ga0439464_0001440 3300042439 Bacteria 5609
328 Ga0439460_0031408 3300042461 Bacteria 1515
329 Ga0439440_0003345 3300042993 Bacteria 3087
330 Ga0466960_0000079 3300044901 Bacteria 31870
331 Ga0495641_0072956 3300046461 Bacteria 1540
332 Ga0495664_0133183 3300046477 Bacteria 1506
333 Ga0495664_0242679 3300046477 Bacteria 1090
334 Ga0495585_0183196 3300046492 Bacteria 1076
335 Ga0495608_0502700 3300046511 Bacteria 734
336 Ga0495628_0441632 3300046516 Bacteria 946
337 Ga0495630_1165507 3300046517 Bacteria 583
338 Ga0495644_0035728 3300046523 Unclassified 1876
339 Ga0495640_0557655 3300046533 Bacteria 694
340 Ga0495645_0594423 3300046543 Unclassified 681
341 Ga0495667_0867710 3300046559 Bacteria 554
342 Ga0495668_0627781 3300046616 Bacteria 594
343 Ga0495634_0290820 3300046642 Bacteria 990
344 Ga0495659_0117072 3300046664 Bacteria 1046
345 Ga0495659_0129164 3300046664 Unclassified 1001
346 Ga0495657_0088555 3300046675 Bacteria 1990
347 Ga0495658_0848453 3300046683 Bacteria 584
348 Ga0495624_0703760 3300046690 Unclassified 600
349 Ga0495589_0257851 3300046794 Bacteria 814
350 Ga0495604_0129353 3300047317 Bacteria 1817
351 Ga0495676_1039599 3300047321 Unclassified 522
352 Ga0495680_0104532 3300047322 Bacteria 2107
353 Ga0495684_0925363 3300047471 Unclassified 560
354 Ga0496100_0134115 3300048903 Bacteria 1747
355 Ga0496100_0142388 3300048903 Bacteria 1701
356 Ga0496100_0267308 3300048903 Bacteria 1270
357 Ga0496100_0352931 3300048903 Unclassified 1111
358 Ga0496100_0526669 3300048903 Bacteria 912
359 Ga0496101_0053965 3300048904 Bacteria 2901
360 Ga0496101_0082766 3300048904 Unclassified 2375
361 Ga0496101_0139265 3300048904 Unclassified 1848
362 Ga0496101_0575191 3300048904 Bacteria 891
363 Ga0496102_0079954 3300048905 Bacteria 3011
364 Ga0496102_0587535 3300048905 Bacteria 1037
365 Ga0496102_0875122 3300048905 Bacteria 820
366 Ga0496102_0898135 3300048905 Unclassified 808
367 Ga0496103_0060372 3300048906 Bacteria 2356
368 Ga0496103_0061150 3300048906 Bacteria 2342
369 Ga0496103_0137441 3300048906 Bacteria 1562
370 Ga0496103_0722051 3300048906 Bacteria 631
371 Ga0496104_0065966 3300048907 Bacteria 3436
372 Ga0496104_0171064 3300048907 Bacteria 2083
373 Ga0496104_1734215 3300048907 Unclassified 527
374 Ga0496105_0027974 3300048908 Bacteria 4610
375 Ga0496105_0054435 3300048908 Bacteria 3303
376 Ga0496105_0084534 3300048908 Bacteria 2621
377 Ga0496105_0263188 3300048908 Bacteria 1394
378 Ga0496105_0474452 3300048908 Bacteria 985
379 Ga0496106_0058345 3300048909 Bacteria 2922
380 Ga0496106_0343545 3300048909 Bacteria 1198
381 Ga0496106_0384072 3300048909 Bacteria 1128
382 Ga0496106_0438515 3300048909 Unclassified 1049
383 Ga0496106_0798710 3300048909 Bacteria 748
384 Ga0496106_1237515 3300048909 Bacteria 581
385 Ga0496106_1370796 3300048909 Bacteria 547
386 Ga0496107_0026677 3300048910 Bacteria 4097
387 Ga0496107_0028607 3300048910 Bacteria 3961
388 Ga0496107_0041730 3300048910 Bacteria 3295
389 Ga0496107_0353412 3300048910 Unclassified 1093
390 Ga0496107_0782860 3300048910 Bacteria 699
391 Ga0496108_0024057 3300048911 Bacteria 5013
392 Ga0496108_0044555 3300048911 Bacteria 3702
393 Ga0496108_0070920 3300048911 Bacteria 2940
394 Ga0496108_0123940 3300048911 Bacteria 2217
395 Ga0496108_0148939 3300048911 Bacteria 2019
396 Ga0496108_0311690 3300048911 Bacteria 1371
397 Ga0496109_0041715 3300048912 Bacteria 4156
398 Ga0496109_0162261 3300048912 Bacteria 2094
399 Ga0496109_0478080 3300048912 Unclassified 1176
400 Ga0496109_0527367 3300048912 Unclassified 1114
401 Ga0496110_0021199 3300048913 Bacteria 5496
402 Ga0496111_0016291 3300048914 Bacteria 5118
403 Ga0496111_0045552 3300048914 Bacteria 3156
404 Ga0496111_0208010 3300048914 Bacteria 1454
405 Ga0496112_0090533 3300048915 Bacteria 3028
406 Ga0496112_0149683 3300048915 Bacteria 2301
407 Ga0496112_0249504 3300048915 Bacteria 1726
408 Ga0496112_0589917 3300048915 Bacteria 1043
409 Ga0496113_0034057 3300048916 Bacteria 3713
410 Ga0496113_0143742 3300048916 Bacteria 1878
411 Ga0496113_0730917 3300048916 Unclassified 789
412 Ga0496114_0100823 3300048917 Bacteria 2464
413 Ga0496114_0115158 3300048917 Bacteria 2306
414 Ga0496114_0297044 3300048917 Unclassified 1426
415 Ga0496115_0085453 3300048918 Bacteria 2573
416 Ga0496115_0134529 3300048918 Bacteria 2038
417 Ga0496115_0281459 3300048918 Bacteria 1365
418 Ga0496115_0298901 3300048918 Bacteria 1319
419 Ga0496126_0079747 3300048929 Bacteria 2898
420 Ga0501068_0249028 3300049584 Unclassified 1132
421 nmdc:mga03n38_195057_c1 3300050490 Bacteria 1045
422 nmdc:mga05p37_1618757_c1 3300050507 Bacteria 637
423 nmdc:mga05p37_169871_c1 3300050507 Bacteria 2660
424 nmdc:mga05p37_341456_c1 3300050507 Bacteria 1766
425 nmdc:mga05p37_532421_c1 3300050507 Bacteria 1341
426 nmdc:mga06r32_50180_c1 3300050510 Bacteria 3991
427 nmdc:mga06r32_691076_c1 3300050510 Bacteria 986
428 nmdc:mga0n895_1299706_c1 3300050512 Bacteria 698
429 nmdc:mga0n895_590230_c1 3300050512 Bacteria 1114
430 nmdc:mga0n895_595107_c1 3300050512 Bacteria 1109
431 nmdc:mga0n895_65723_c1 3300050512 Bacteria 3591
432 nmdc:mga0n895_85373_c1 3300050512 Bacteria 3151
433 nmdc:mga0n895_876760_c1 3300050512 Bacteria 884
434 nmdc:mga0rr50_25828_c1 3300050513 Bacteria 4090
435 nmdc:mga0rr50_389163_c1 3300050513 Bacteria 1176
436 nmdc:mga0rr50_423076_c1 3300050513 Bacteria 1127
437 nmdc:mga08x19_12141_c1 3300050514 Bacteria 5185
438 nmdc:mga08x19_392335_c1 3300050514 Bacteria 973
439 nmdc:mga08x19_482759_c1 3300050514 Bacteria 874
440 nmdc:mga0a205_1349_c1 3300050515 Bacteria 20705
441 nmdc:mga0a205_385300_c1 3300050515 Bacteria 1267
442 nmdc:mga0a205_875260_c1 3300050515 Unclassified 745
443 Ga0495601_0344868 3300053077 Bacteria 969
444 Ga0495601_0405346 3300053077 Bacteria 884
445 Ga0495601_0866224 3300053077 Unclassified 572
446 Ga0495612_0159201 3300053078 Bacteria 985
447 Ga0495612_0211749 3300053078 Unclassified 857
448 Ga0495595_0504006 3300053084 Bacteria 617

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035088 Ga0373940_0034515 Ga0373940_0034515_48_464 138
2 3300006852 Ga0075433_10339907 Ga0075433_103399072 139
3 3300009147 Ga0114129_10134453 Ga0114129_101344533 139
4 3300048909 Ga0496106_1237515 Ga0496106_1237515_94_513 139
5 3300050512 nmdc:mga0n895_85373_c1 nmdc:mga0n895_85373_c1_739_1158 139
6 3300050515 nmdc:mga0a205_385300_c1 nmdc:mga0a205_385300_c1_248_667 139
7 3300005471 Ga0070698_100236777 Ga0070698_1002367771 140
8 3300009098 Ga0105245_10035473 Ga0105245_100354735 142
9 3300046511 Ga0495608_0502700 Ga0495608_0502700_269_697 142
10 3300046616 Ga0495668_0627781 Ga0495668_0627781_115_543 142
11 3300047321 Ga0495676_1039599 Ga0495676_1039599_51_479 142
12 3300047471 Ga0495684_0925363 Ga0495684_0925363_94_522 142
13 3300048916 Ga0496113_0730917 Ga0496113_0730917_26_454 142
14 3300050507 nmdc:mga05p37_532421_c1 nmdc:mga05p37_532421_c1_77_505 142
15 3300013308 Ga0157375_12087958 Ga0157375_120879581 145
16 3300014325 Ga0163163_12016261 Ga0163163_120162612 145
17 3300048910 Ga0496107_0353412 Ga0496107_0353412_636_1073 145
18 3300009098 Ga0105245_11825043 Ga0105245_118250432 148
19 3300009176 Ga0105242_10728426 Ga0105242_107284261 148
20 3300046492 Ga0495585_0183196 Ga0495585_0183196_367_813 148
21 3300048915 Ga0496112_0090533 Ga0496112_0090533_1458_1919 153
22 3300049584 Ga0501068_0249028 Ga0501068_0249028_154_615 153
23 3300005435 Ga0070714_100054052 Ga0070714_1000540522 155
24 3300005436 Ga0070713_100671441 Ga0070713_1006714412 155
25 3300025929 Ga0207664_10004373 Ga0207664_100043732 155
26 3300046533 Ga0495640_0557655 Ga0495640_0557655_154_621 155
27 3300046559 Ga0495667_0867710 Ga0495667_0867710_64_531 155
28 3300005435 Ga0070714_100356252 Ga0070714_1003562521 156
29 3300005437 Ga0070710_11269090 Ga0070710_112690901 156
30 3300005457 Ga0070662_100046925 Ga0070662_1000469253 156
31 3300005545 Ga0070695_100062090 Ga0070695_1000620903 156
32 3300005563 Ga0068855_100231286 Ga0068855_1002312864 156
33 3300005719 Ga0068861_100005826 Ga0068861_1000058265 156
34 3300005844 Ga0068862_100368149 Ga0068862_1003681493 156
35 3300006175 Ga0070712_100032478 Ga0070712_1000324785 156
36 3300006844 Ga0075428_100023117 Ga0075428_1000231175 156
37 3300006847 Ga0075431_100771398 Ga0075431_1007713982 156
38 3300009147 Ga0114129_10028650 Ga0114129_100286508 156
39 3300009148 Ga0105243_10871189 Ga0105243_108711892 156
40 3300009176 Ga0105242_10663090 Ga0105242_106630902 156
41 3300010375 Ga0105239_11550622 Ga0105239_115506222 156
42 3300013306 Ga0163162_10060171 Ga0163162_100601711 156
43 3300017792 Ga0163161_10095403 Ga0163161_100954033 156
44 3300025915 Ga0207693_10664531 Ga0207693_106645311 156
45 3300025933 Ga0207706_10082234 Ga0207706_100822343 156
46 3300025939 Ga0207665_10480189 Ga0207665_104801892 156
47 3300025939 Ga0207665_10518786 Ga0207665_105187862 156
48 3300025961 Ga0207712_10018877 Ga0207712_100188777 156
49 3300025972 Ga0207668_10142269 Ga0207668_101422693 156
50 3300026118 Ga0207675_100000907 Ga0207675_10000090726 156
51 3300028380 Ga0268265_10195352 Ga0268265_101953523 156
52 3300028381 Ga0268264_10691282 Ga0268264_106912822 156
53 3300041512 Ga0451853_0943107 Ga0451853_0943107_223_693 156
54 3300046477 Ga0495664_0242679 Ga0495664_0242679_590_1060 156
55 3300046683 Ga0495658_0848453 Ga0495658_0848453_36_506 156
56 3300048906 Ga0496103_0722051 Ga0496103_0722051_44_514 156
57 3300050507 nmdc:mga05p37_341456_c1 nmdc:mga05p37_341456_c1_1241_1711 156
58 3300050510 nmdc:mga06r32_691076_c1 nmdc:mga06r32_691076_c1_267_737 156
59 3300003373 JGI25407J50210_10015188 JGI25407J50210_100151881 157
60 3300003373 JGI25407J50210_10016411 JGI25407J50210_100164113 157
61 3300005334 Ga0068869_100012077 Ga0068869_1000120775 157
62 3300005335 Ga0070666_10164898 Ga0070666_101648983 157
63 3300005336 Ga0070680_100222668 Ga0070680_1002226682 157
64 3300005338 Ga0068868_100080687 Ga0068868_1000806871 157
65 3300005338 Ga0068868_100454339 Ga0068868_1004543393 157
66 3300005339 Ga0070660_100034351 Ga0070660_1000343514 157
67 3300005340 Ga0070689_100129663 Ga0070689_1001296632 157
68 3300005341 Ga0070691_10081442 Ga0070691_100814423 157
69 3300005343 Ga0070687_100360208 Ga0070687_1003602081 157
70 3300005345 Ga0070692_10033185 Ga0070692_100331852 157
71 3300005347 Ga0070668_100364706 Ga0070668_1003647062 157
72 3300005354 Ga0070675_100035425 Ga0070675_1000354255 157
73 3300005355 Ga0070671_100365144 Ga0070671_1003651442 157
74 3300005355 Ga0070671_101213185 Ga0070671_1012131851 157
75 3300005365 Ga0070688_100504936 Ga0070688_1005049362 157
76 3300005435 Ga0070714_100030611 Ga0070714_1000306113 157
77 3300005435 Ga0070714_100164036 Ga0070714_1001640363 157
78 3300005435 Ga0070714_100477721 Ga0070714_1004777213 157
79 3300005436 Ga0070713_100036198 Ga0070713_1000361984 157
80 3300005436 Ga0070713_100240717 Ga0070713_1002407174 157
81 3300005437 Ga0070710_10001036 Ga0070710_1000103614 157
82 3300005437 Ga0070710_10069955 Ga0070710_100699553 157
83 3300005438 Ga0070701_10179703 Ga0070701_101797033 157
84 3300005439 Ga0070711_100021868 Ga0070711_1000218685 157
85 3300005439 Ga0070711_100443498 Ga0070711_1004434982 157
86 3300005439 Ga0070711_100453958 Ga0070711_1004539582 157
87 3300005439 Ga0070711_100680637 Ga0070711_1006806372 157
88 3300005440 Ga0070705_100036520 Ga0070705_1000365204 157
89 3300005445 Ga0070708_100086160 Ga0070708_1000861602 157
90 3300005445 Ga0070708_100379172 Ga0070708_1003791723 157
91 3300005445 Ga0070708_100778543 Ga0070708_1007785432 157
92 3300005445 Ga0070708_101138466 Ga0070708_1011384662 157
93 3300005455 Ga0070663_100018030 Ga0070663_1000180306 157
94 3300005456 Ga0070678_100173049 Ga0070678_1001730493 157
95 3300005456 Ga0070678_100999165 Ga0070678_1009991651 157
96 3300005456 Ga0070678_101040453 Ga0070678_1010404532 157
97 3300005457 Ga0070662_100535738 Ga0070662_1005357382 157
98 3300005457 Ga0070662_100543198 Ga0070662_1005431982 157
99 3300005458 Ga0070681_10054258 Ga0070681_100542585 157
100 3300005467 Ga0070706_100088379 Ga0070706_1000883793 157
101 3300005467 Ga0070706_100189195 Ga0070706_1001891952 157
102 3300005467 Ga0070706_100551184 Ga0070706_1005511842 157
103 3300005468 Ga0070707_100002256 Ga0070707_10000225624 157
104 3300005468 Ga0070707_100014225 Ga0070707_1000142256 157
105 3300005468 Ga0070707_100014699 Ga0070707_1000146999 157
106 3300005468 Ga0070707_100509344 Ga0070707_1005093441 157
107 3300005468 Ga0070707_100763372 Ga0070707_1007633722 157
108 3300005468 Ga0070707_100803457 Ga0070707_1008034572 157
109 3300005468 Ga0070707_101225706 Ga0070707_1012257062 157
110 3300005468 Ga0070707_101755969 Ga0070707_1017559691 157
111 3300005471 Ga0070698_100253953 Ga0070698_1002539531 157
112 3300005471 Ga0070698_100394281 Ga0070698_1003942812 157
113 3300005471 Ga0070698_100468159 Ga0070698_1004681593 157
114 3300005471 Ga0070698_100853429 Ga0070698_1008534291 157
115 3300005471 Ga0070698_101450210 Ga0070698_1014502101 157
116 3300005518 Ga0070699_100079505 Ga0070699_1000795053 157
117 3300005518 Ga0070699_100383269 Ga0070699_1003832692 157
118 3300005530 Ga0070679_100082352 Ga0070679_1000823525 157
119 3300005535 Ga0070684_100087519 Ga0070684_1000875192 157
120 3300005536 Ga0070697_100198328 Ga0070697_1001983283 157
121 3300005543 Ga0070672_100267885 Ga0070672_1002678852 157
122 3300005544 Ga0070686_100084970 Ga0070686_1000849703 157
123 3300005545 Ga0070695_100038103 Ga0070695_1000381031 157
124 3300005545 Ga0070695_100209444 Ga0070695_1002094441 157
125 3300005545 Ga0070695_100641667 Ga0070695_1006416672 157
126 3300005546 Ga0070696_100376368 Ga0070696_1003763682 157
127 3300005547 Ga0070693_100022158 Ga0070693_1000221584 157
128 3300005548 Ga0070665_100017738 Ga0070665_10001773811 157
129 3300005549 Ga0070704_100068834 Ga0070704_1000688343 157
130 3300005549 Ga0070704_100171410 Ga0070704_1001714104 157
131 3300005549 Ga0070704_100248999 Ga0070704_1002489992 157
132 3300005563 Ga0068855_100105256 Ga0068855_1001052566 157
133 3300005564 Ga0070664_100018335 Ga0070664_1000183357 157
134 3300005577 Ga0068857_100108696 Ga0068857_1001086964 157
135 3300005578 Ga0068854_100010971 Ga0068854_1000109715 157
136 3300005615 Ga0070702_100102965 Ga0070702_1001029653 157
137 3300005615 Ga0070702_100218243 Ga0070702_1002182433 157
138 3300005616 Ga0068852_100031197 Ga0068852_1000311979 157
139 3300005718 Ga0068866_10151753 Ga0068866_101517532 157
140 3300005840 Ga0068870_10686058 Ga0068870_106860582 157
141 3300005841 Ga0068863_100229447 Ga0068863_1002294473 157
142 3300005842 Ga0068858_100131907 Ga0068858_1001319072 157
143 3300005842 Ga0068858_100163355 Ga0068858_1001633552 157
144 3300005843 Ga0068860_100103421 Ga0068860_1001034214 157
145 3300005843 Ga0068860_100389936 Ga0068860_1003899363 157
146 3300005843 Ga0068860_100431192 Ga0068860_1004311922 157
147 3300005844 Ga0068862_100229744 Ga0068862_1002297443 157
148 3300005937 Ga0081455_10192251 Ga0081455_101922513 157
149 3300005981 Ga0081538_10002279 Ga0081538_100022797 157
150 3300005983 Ga0081540_1072739 Ga0081540_10727393 157
151 3300006028 Ga0070717_10003237 Ga0070717_1000323712 157
152 3300006028 Ga0070717_10020693 Ga0070717_100206937 157
153 3300006028 Ga0070717_10386471 Ga0070717_103864713 157
154 3300006028 Ga0070717_10789984 Ga0070717_107899842 157
155 3300006048 Ga0075363_100268024 Ga0075363_1002680242 157
156 3300006051 Ga0075364_10074951 Ga0075364_100749513 157
157 3300006163 Ga0070715_10000676 Ga0070715_1000067610 157
158 3300006163 Ga0070715_10041197 Ga0070715_100411974 157
159 3300006163 Ga0070715_10126788 Ga0070715_101267882 157
160 3300006173 Ga0070716_100018717 Ga0070716_1000187173 157
161 3300006173 Ga0070716_100049589 Ga0070716_1000495894 157
162 3300006173 Ga0070716_100132859 Ga0070716_1001328593 157
163 3300006175 Ga0070712_100033141 Ga0070712_1000331413 157
164 3300006175 Ga0070712_100043305 Ga0070712_1000433053 157
165 3300006175 Ga0070712_100073313 Ga0070712_1000733133 157
166 3300006175 Ga0070712_100121765 Ga0070712_1001217653 157
167 3300006175 Ga0070712_100182486 Ga0070712_1001824862 157
168 3300006237 Ga0097621_100031156 Ga0097621_1000311563 157
169 3300006358 Ga0068871_100136779 Ga0068871_1001367792 157
170 3300006844 Ga0075428_101845159 Ga0075428_1018451591 157
171 3300006847 Ga0075431_100067663 Ga0075431_1000676632 157
172 3300006847 Ga0075431_100252753 Ga0075431_1002527533 157
173 3300006847 Ga0075431_100666953 Ga0075431_1006669531 157
174 3300006852 Ga0075433_10043853 Ga0075433_100438533 157
175 3300006852 Ga0075433_10404864 Ga0075433_104048642 157
176 3300006871 Ga0075434_100065067 Ga0075434_1000650676 157
177 3300006914 Ga0075436_100033456 Ga0075436_1000334563 157
178 3300007076 Ga0075435_100006961 Ga0075435_1000069617 157
179 3300007076 Ga0075435_100330956 Ga0075435_1003309561 157
180 3300007265 Ga0099794_10384197 Ga0099794_103841971 157
181 3300009011 Ga0105251_10055937 Ga0105251_100559373 157
182 3300009011 Ga0105251_10146855 Ga0105251_101468552 157
183 3300009093 Ga0105240_10109788 Ga0105240_101097885 157
184 3300009094 Ga0111539_10083544 Ga0111539_100835445 157
185 3300009094 Ga0111539_10616983 Ga0111539_106169831 157
186 3300009098 Ga0105245_10479367 Ga0105245_104793672 157
187 3300009101 Ga0105247_10034877 Ga0105247_100348773 157
188 3300009147 Ga0114129_10308382 Ga0114129_103083824 157
189 3300009147 Ga0114129_12653931 Ga0114129_126539311 157
190 3300009148 Ga0105243_10140507 Ga0105243_101405072 157
191 3300009148 Ga0105243_10284213 Ga0105243_102842131 157
192 3300009148 Ga0105243_10286159 Ga0105243_102861592 157
193 3300009148 Ga0105243_11072903 Ga0105243_110729032 157
194 3300009148 Ga0105243_11184171 Ga0105243_111841711 157
195 3300009176 Ga0105242_10279051 Ga0105242_102790512 157
196 3300009176 Ga0105242_10345152 Ga0105242_103451522 157
197 3300009176 Ga0105242_10500993 Ga0105242_105009932 157
198 3300009176 Ga0105242_10866553 Ga0105242_108665532 157
199 3300009177 Ga0105248_10021223 Ga0105248_100212235 157
200 3300009545 Ga0105237_10117558 Ga0105237_101175582 157
201 3300009545 Ga0105237_10898684 Ga0105237_108986841 157
202 3300009551 Ga0105238_10435806 Ga0105238_104358062 157
203 3300009553 Ga0105249_10044179 Ga0105249_100441795 157
204 3300009553 Ga0105249_10967772 Ga0105249_109677722 157
205 3300010159 Ga0099796_10064521 Ga0099796_100645212 157
206 3300010375 Ga0105239_10061329 Ga0105239_100613292 157
207 3300010375 Ga0105239_10144031 Ga0105239_101440314 157
208 3300010375 Ga0105239_10476273 Ga0105239_104762733 157
209 3300010375 Ga0105239_10582692 Ga0105239_105826923 157
210 3300011119 Ga0105246_10083461 Ga0105246_100834612 157
211 3300013100 Ga0157373_10158594 Ga0157373_101585942 157
212 3300013102 Ga0157371_10330374 Ga0157371_103303742 157
213 3300013105 Ga0157369_10494128 Ga0157369_104941282 157
214 3300013296 Ga0157374_10950173 Ga0157374_109501732 157
215 3300013297 Ga0157378_10182943 Ga0157378_101829433 157
216 3300013306 Ga0163162_10325099 Ga0163162_103250993 157
217 3300013306 Ga0163162_10326435 Ga0163162_103264352 157
218 3300013307 Ga0157372_11439574 Ga0157372_114395742 157
219 3300013308 Ga0157375_10023755 Ga0157375_100237556 157
220 3300013308 Ga0157375_10791967 Ga0157375_107919671 157
221 3300014325 Ga0163163_10103982 Ga0163163_101039822 157
222 3300014325 Ga0163163_10140119 Ga0163163_101401195 157
223 3300014968 Ga0157379_10339099 Ga0157379_103390992 157
224 3300014968 Ga0157379_10953218 Ga0157379_109532182 157
225 3300017792 Ga0163161_10439572 Ga0163161_104395722 157
226 3300020082 Ga0206353_10201732 Ga0206353_102017322 157
227 3300022467 Ga0224712_10218267 Ga0224712_102182672 157
228 3300025885 Ga0207653_10013615 Ga0207653_100136154 157
229 3300025885 Ga0207653_10021733 Ga0207653_100217332 157
230 3300025898 Ga0207692_10069617 Ga0207692_100696172 157
231 3300025900 Ga0207710_10306854 Ga0207710_103068542 157
232 3300025903 Ga0207680_10071014 Ga0207680_100710143 157
233 3300025904 Ga0207647_10543855 Ga0207647_105438552 157
234 3300025905 Ga0207685_10020588 Ga0207685_100205882 157
235 3300025905 Ga0207685_10065864 Ga0207685_100658643 157
236 3300025905 Ga0207685_10125731 Ga0207685_101257312 157
237 3300025906 Ga0207699_10004897 Ga0207699_100048974 157
238 3300025906 Ga0207699_10015164 Ga0207699_100151644 157
239 3300025906 Ga0207699_10194705 Ga0207699_101947052 157
240 3300025906 Ga0207699_10461474 Ga0207699_104614742 157
241 3300025910 Ga0207684_10118751 Ga0207684_101187513 157
242 3300025910 Ga0207684_10178247 Ga0207684_101782473 157
243 3300025910 Ga0207684_10308891 Ga0207684_103088912 157
244 3300025910 Ga0207684_10413243 Ga0207684_104132432 157
245 3300025910 Ga0207684_10535716 Ga0207684_105357162 157
246 3300025911 Ga0207654_10091933 Ga0207654_100919333 157
247 3300025912 Ga0207707_10151735 Ga0207707_101517352 157
248 3300025912 Ga0207707_10422528 Ga0207707_104225282 157
249 3300025914 Ga0207671_10304362 Ga0207671_103043621 157
250 3300025915 Ga0207693_10014535 Ga0207693_100145355 157
251 3300025915 Ga0207693_10035028 Ga0207693_100350283 157
252 3300025915 Ga0207693_10075384 Ga0207693_100753843 157
253 3300025915 Ga0207693_10078884 Ga0207693_100788844 157
254 3300025915 Ga0207693_10301363 Ga0207693_103013632 157
255 3300025916 Ga0207663_10036663 Ga0207663_100366633 157
256 3300025916 Ga0207663_10207716 Ga0207663_102077162 157
257 3300025917 Ga0207660_10141091 Ga0207660_101410913 157
258 3300025919 Ga0207657_10071913 Ga0207657_100719134 157
259 3300025921 Ga0207652_10120256 Ga0207652_101202563 157
260 3300025922 Ga0207646_10003348 Ga0207646_100033484 157
261 3300025922 Ga0207646_10006696 Ga0207646_100066963 157
262 3300025922 Ga0207646_10020005 Ga0207646_100200052 157
263 3300025922 Ga0207646_10406219 Ga0207646_104062192 157
264 3300025922 Ga0207646_10586214 Ga0207646_105862142 157
265 3300025922 Ga0207646_10905737 Ga0207646_109057372 157
266 3300025924 Ga0207694_10497845 Ga0207694_104978451 157
267 3300025925 Ga0207650_10601520 Ga0207650_106015202 157
268 3300025926 Ga0207659_10054509 Ga0207659_100545092 157
269 3300025927 Ga0207687_10158801 Ga0207687_101588012 157
270 3300025927 Ga0207687_10444179 Ga0207687_104441792 157
271 3300025928 Ga0207700_10008307 Ga0207700_100083075 157
272 3300025928 Ga0207700_10054163 Ga0207700_100541635 157
273 3300025928 Ga0207700_10189067 Ga0207700_101890672 157
274 3300025929 Ga0207664_10032065 Ga0207664_100320657 157
275 3300025929 Ga0207664_10050779 Ga0207664_100507794 157
276 3300025929 Ga0207664_10285652 Ga0207664_102856523 157
277 3300025929 Ga0207664_10534264 Ga0207664_105342641 157
278 3300025929 Ga0207664_10804310 Ga0207664_108043102 157
279 3300025931 Ga0207644_10418445 Ga0207644_104184452 157
280 3300025932 Ga0207690_10041355 Ga0207690_100413555 157
281 3300025933 Ga0207706_10046273 Ga0207706_100462734 157
282 3300025933 Ga0207706_10759634 Ga0207706_107596341 157
283 3300025934 Ga0207686_10108104 Ga0207686_101081043 157
284 3300025934 Ga0207686_10186039 Ga0207686_101860392 157
285 3300025935 Ga0207709_10213643 Ga0207709_102136432 157
286 3300025935 Ga0207709_10422734 Ga0207709_104227342 157
287 3300025936 Ga0207670_10089713 Ga0207670_100897134 157
288 3300025939 Ga0207665_10003278 Ga0207665_1000327816 157
289 3300025939 Ga0207665_10010634 Ga0207665_100106344 157
290 3300025939 Ga0207665_10012676 Ga0207665_100126766 157
291 3300025939 Ga0207665_10613787 Ga0207665_106137872 157
292 3300025939 Ga0207665_10854180 Ga0207665_108541802 157
293 3300025939 Ga0207665_10865823 Ga0207665_108658231 157
294 3300025940 Ga0207691_10461609 Ga0207691_104616093 157
295 3300025941 Ga0207711_10679514 Ga0207711_106795142 157
296 3300025942 Ga0207689_10025446 Ga0207689_100254465 157
297 3300025945 Ga0207679_10350196 Ga0207679_103501962 157
298 3300025949 Ga0207667_10708961 Ga0207667_107089613 157
299 3300025949 Ga0207667_11291270 Ga0207667_112912702 157
300 3300025961 Ga0207712_10227990 Ga0207712_102279902 157
301 3300025961 Ga0207712_10258836 Ga0207712_102588361 157
302 3300025961 Ga0207712_10511373 Ga0207712_105113732 157
303 3300025972 Ga0207668_10167648 Ga0207668_101676483 157
304 3300025981 Ga0207640_10558130 Ga0207640_105581302 157
305 3300026023 Ga0207677_10461310 Ga0207677_104613102 157
306 3300026023 Ga0207677_10622950 Ga0207677_106229501 157
307 3300026035 Ga0207703_10010783 Ga0207703_100107833 157
308 3300026035 Ga0207703_10178806 Ga0207703_101788063 157
309 3300026035 Ga0207703_10872084 Ga0207703_108720842 157
310 3300026041 Ga0207639_10441030 Ga0207639_104410302 157
311 3300026078 Ga0207702_10077448 Ga0207702_100774483 157
312 3300026088 Ga0207641_10553978 Ga0207641_105539782 157
313 3300026116 Ga0207674_10097223 Ga0207674_100972235 157
314 3300026118 Ga0207675_100046130 Ga0207675_1000461305 157
315 3300026118 Ga0207675_100978350 Ga0207675_1009783502 157
316 3300026118 Ga0207675_101227124 Ga0207675_1012271242 157
317 3300026121 Ga0207683_10047961 Ga0207683_100479615 157
318 3300026121 Ga0207683_10466810 Ga0207683_104668103 157
319 3300026142 Ga0207698_10136078 Ga0207698_101360784 157
320 3300028380 Ga0268265_10701963 Ga0268265_107019632 157
321 3300028381 Ga0268264_10847634 Ga0268264_108476342 157
322 3300034816 Ga0373930_0007878 Ga0373930_0007878_578_1051 157
323 3300034818 Ga0373950_0027891 Ga0373950_0027891_448_921 157
324 3300034820 Ga0373959_0014849 Ga0373959_0014849_793_1266 157
325 3300035112 Ga0373932_0077540 Ga0373932_0077540_409_882 157
326 3300035112 Ga0373932_0150083 Ga0373932_0150083_29_502 157
327 3300035115 Ga0373941_0007453 Ga0373941_0007453_1107_1580 157
328 3300035121 Ga0373960_0039594 Ga0373960_0039594_26_499 157
329 3300035207 Ga0373942_0074906 Ga0373942_0074906_231_704 157
330 3300035242 Ga0373962_0082963 Ga0373962_0082963_183_656 157
331 3300035691 Ga0373931_0018507 Ga0373931_0018507_1907_2380 157
332 3300036401 Ga0373937_0875016 Ga0373937_0875016_65_538 157
333 3300037068 Ga0373925_0535233 Ga0373925_0535233_34_507 157
334 3300037312 Ga0395899_0363700 Ga0395899_0363700_351_824 157
335 3300037418 Ga0395900_0035117 Ga0395900_0035117_3926_4399 157
336 3300037418 Ga0395900_0054791 Ga0395900_0054791_2460_2933 157
337 3300037466 Ga0395898_0013706 Ga0395898_0013706_6342_6815 157
338 3300037466 Ga0395898_0171753 Ga0395898_0171753_1046_1519 157
339 3300037466 Ga0395898_0181013 Ga0395898_0181013_495_968 157
340 3300037466 Ga0395898_0914308 Ga0395898_0914308_170_643 157
341 3300037471 Ga0395905_0068831 Ga0395905_0068831_406_879 157
342 3300037471 Ga0395905_0115495 Ga0395905_0115495_410_883 157
343 3300037471 Ga0395905_0147933 Ga0395905_0147933_713_1186 157
344 3300038443 Ga0395901_0065083 Ga0395901_0065083_894_1367 157
345 3300038443 Ga0395901_0315529 Ga0395901_0315529_760_1233 157
346 3300038443 Ga0395901_0604410 Ga0395901_0604410_503_976 157
347 3300042439 Ga0439464_0001440 Ga0439464_0001440_3518_3991 157
348 3300042461 Ga0439460_0031408 Ga0439460_0031408_467_940 157
349 3300042993 Ga0439440_0003345 Ga0439440_0003345_798_1271 157
350 3300044901 Ga0466960_0000079 Ga0466960_0000079_27425_27901 157
351 3300046461 Ga0495641_0072956 Ga0495641_0072956_222_698 157
352 3300046477 Ga0495664_0133183 Ga0495664_0133183_482_955 157
353 3300046516 Ga0495628_0441632 Ga0495628_0441632_18_494 157
354 3300046517 Ga0495630_1165507 Ga0495630_1165507_58_531 157
355 3300046523 Ga0495644_0035728 Ga0495644_0035728_530_1003 157
356 3300046543 Ga0495645_0594423 Ga0495645_0594423_140_613 157
357 3300046642 Ga0495634_0290820 Ga0495634_0290820_409_882 157
358 3300046664 Ga0495659_0117072 Ga0495659_0117072_48_566 157
359 3300046664 Ga0495659_0129164 Ga0495659_0129164_57_530 157
360 3300046675 Ga0495657_0088555 Ga0495657_0088555_771_1247 157
361 3300046690 Ga0495624_0703760 Ga0495624_0703760_117_590 157
362 3300046794 Ga0495589_0257851 Ga0495589_0257851_146_619 157
363 3300047317 Ga0495604_0129353 Ga0495604_0129353_744_1220 157
364 3300047322 Ga0495680_0104532 Ga0495680_0104532_628_1104 157
365 3300048903 Ga0496100_0134115 Ga0496100_0134115_937_1410 157
366 3300048903 Ga0496100_0142388 Ga0496100_0142388_852_1325 157
367 3300048903 Ga0496100_0267308 Ga0496100_0267308_86_562 157
368 3300048903 Ga0496100_0352931 Ga0496100_0352931_96_569 157
369 3300048903 Ga0496100_0526669 Ga0496100_0526669_204_677 157
370 3300048904 Ga0496101_0053965 Ga0496101_0053965_1097_1570 157
371 3300048904 Ga0496101_0082766 Ga0496101_0082766_1593_2069 157
372 3300048904 Ga0496101_0139265 Ga0496101_0139265_890_1363 157
373 3300048904 Ga0496101_0575191 Ga0496101_0575191_256_729 157
374 3300048905 Ga0496102_0079954 Ga0496102_0079954_2180_2653 157
375 3300048905 Ga0496102_0587535 Ga0496102_0587535_289_762 157
376 3300048905 Ga0496102_0875122 Ga0496102_0875122_208_681 157
377 3300048905 Ga0496102_0898135 Ga0496102_0898135_175_648 157
378 3300048906 Ga0496103_0060372 Ga0496103_0060372_659_1132 157
379 3300048906 Ga0496103_0061150 Ga0496103_0061150_791_1264 157
380 3300048906 Ga0496103_0137441 Ga0496103_0137441_1060_1533 157
381 3300048907 Ga0496104_0065966 Ga0496104_0065966_2749_3222 157
382 3300048907 Ga0496104_0171064 Ga0496104_0171064_325_798 157
383 3300048907 Ga0496104_1734215 Ga0496104_1734215_41_517 157
384 3300048908 Ga0496105_0027974 Ga0496105_0027974_1326_1799 157
385 3300048908 Ga0496105_0054435 Ga0496105_0054435_2145_2618 157
386 3300048908 Ga0496105_0084534 Ga0496105_0084534_325_798 157
387 3300048908 Ga0496105_0263188 Ga0496105_0263188_765_1238 157
388 3300048908 Ga0496105_0474452 Ga0496105_0474452_66_539 157
389 3300048909 Ga0496106_0058345 Ga0496106_0058345_1460_1936 157
390 3300048909 Ga0496106_0343545 Ga0496106_0343545_456_929 157
391 3300048909 Ga0496106_0384072 Ga0496106_0384072_83_556 157
392 3300048909 Ga0496106_0438515 Ga0496106_0438515_339_812 157
393 3300048909 Ga0496106_0798710 Ga0496106_0798710_167_640 157
394 3300048909 Ga0496106_1370796 Ga0496106_1370796_52_525 157
395 3300048910 Ga0496107_0026677 Ga0496107_0026677_536_1009 157
396 3300048910 Ga0496107_0028607 Ga0496107_0028607_957_1430 157
397 3300048910 Ga0496107_0041730 Ga0496107_0041730_1022_1498 157
398 3300048910 Ga0496107_0782860 Ga0496107_0782860_173_646 157
399 3300048911 Ga0496108_0024057 Ga0496108_0024057_2150_2623 157
400 3300048911 Ga0496108_0044555 Ga0496108_0044555_2185_2658 157
401 3300048911 Ga0496108_0070920 Ga0496108_0070920_16_489 157
402 3300048911 Ga0496108_0123940 Ga0496108_0123940_1401_1874 157
403 3300048911 Ga0496108_0148939 Ga0496108_0148939_1426_1899 157
404 3300048911 Ga0496108_0311690 Ga0496108_0311690_647_1123 157
405 3300048912 Ga0496109_0041715 Ga0496109_0041715_2353_2826 157
406 3300048912 Ga0496109_0162261 Ga0496109_0162261_16_489 157
407 3300048912 Ga0496109_0478080 Ga0496109_0478080_48_521 157
408 3300048912 Ga0496109_0527367 Ga0496109_0527367_249_725 157
409 3300048913 Ga0496110_0021199 Ga0496110_0021199_3146_3619 157
410 3300048914 Ga0496111_0016291 Ga0496111_0016291_3125_3598 157
411 3300048914 Ga0496111_0045552 Ga0496111_0045552_821_1294 157
412 3300048914 Ga0496111_0208010 Ga0496111_0208010_913_1386 157
413 3300048915 Ga0496112_0149683 Ga0496112_0149683_771_1244 157
414 3300048915 Ga0496112_0249504 Ga0496112_0249504_1045_1518 157
415 3300048915 Ga0496112_0589917 Ga0496112_0589917_366_839 157
416 3300048916 Ga0496113_0034057 Ga0496113_0034057_2733_3206 157
417 3300048916 Ga0496113_0143742 Ga0496113_0143742_343_816 157
418 3300048917 Ga0496114_0100823 Ga0496114_0100823_1241_1714 157
419 3300048917 Ga0496114_0115158 Ga0496114_0115158_1602_2075 157
420 3300048917 Ga0496114_0297044 Ga0496114_0297044_520_993 157
421 3300048918 Ga0496115_0085453 Ga0496115_0085453_1201_1674 157
422 3300048918 Ga0496115_0134529 Ga0496115_0134529_1160_1633 157
423 3300048918 Ga0496115_0281459 Ga0496115_0281459_217_690 157
424 3300048918 Ga0496115_0298901 Ga0496115_0298901_484_957 157
425 3300048929 Ga0496126_0079747 Ga0496126_0079747_1866_2342 157
426 3300050490 nmdc:mga03n38_195057_c1 nmdc:mga03n38_195057_c1_45_518 157
427 3300050507 nmdc:mga05p37_1618757_c1 nmdc:mga05p37_1618757_c1_22_498 157
428 3300050507 nmdc:mga05p37_169871_c1 nmdc:mga05p37_169871_c1_205_678 157
429 3300050510 nmdc:mga06r32_50180_c1 nmdc:mga06r32_50180_c1_2914_3387 157
430 3300050512 nmdc:mga0n895_1299706_c1 nmdc:mga0n895_1299706_c1_15_488 157
431 3300050512 nmdc:mga0n895_590230_c1 nmdc:mga0n895_590230_c1_396_869 157
432 3300050512 nmdc:mga0n895_595107_c1 nmdc:mga0n895_595107_c1_367_840 157
433 3300050512 nmdc:mga0n895_65723_c1 nmdc:mga0n895_65723_c1_2464_2937 157
434 3300050512 nmdc:mga0n895_876760_c1 nmdc:mga0n895_876760_c1_387_860 157
435 3300050513 nmdc:mga0rr50_25828_c1 nmdc:mga0rr50_25828_c1_1026_1499 157
436 3300050513 nmdc:mga0rr50_389163_c1 nmdc:mga0rr50_389163_c1_622_1095 157
437 3300050513 nmdc:mga0rr50_423076_c1 nmdc:mga0rr50_423076_c1_124_597 157
438 3300050514 nmdc:mga08x19_12141_c1 nmdc:mga08x19_12141_c1_437_910 157
439 3300050514 nmdc:mga08x19_392335_c1 nmdc:mga08x19_392335_c1_227_700 157
440 3300050514 nmdc:mga08x19_482759_c1 nmdc:mga08x19_482759_c1_65_538 157
441 3300050515 nmdc:mga0a205_1349_c1 nmdc:mga0a205_1349_c1_18199_18672 157
442 3300050515 nmdc:mga0a205_875260_c1 nmdc:mga0a205_875260_c1_196_669 157
443 3300053077 Ga0495601_0344868 Ga0495601_0344868_297_770 157
444 3300053077 Ga0495601_0405346 Ga0495601_0405346_238_711 157
445 3300053077 Ga0495601_0866224 Ga0495601_0866224_69_554 157
446 3300053078 Ga0495612_0159201 Ga0495612_0159201_374_847 157
447 3300053078 Ga0495612_0211749 Ga0495612_0211749_365_838 157
448 3300053084 Ga0495595_0504006 Ga0495595_0504006_14_580 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11578

DUF3237

Protein of unknown function (DUF3237)

8

73

0.96

PF11578

DUF3237

Protein of unknown function (DUF3237)

71

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c5o-assembly1.cif.gz_D crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9568 5 157
3c5o-assembly1.cif.gz_C crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9562 4 157
3c5o-assembly1.cif.gz_A crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.955 5 157
3c5o-assembly1.cif.gz_D crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.9508 5 157
3c5o-assembly1.cif.gz_C crystal structure of the conserved protein of unknown function rpa1785 from rhodopseudomonas palustris 0.95 4 157
ID Description Score Start End Superfamily
3c5oC00 Mainly Beta;Beta Barrel;Porin; 0.958 5 157 2.40.160.20
3c5oC00 Mainly Beta;Beta Barrel;Porin; 0.9517 5 157 2.40.160.20
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.9181 9 157 2.40.160.20
3g7gG00 Mainly Beta;Beta Barrel;Porin; 0.9062 9 157 2.40.160.20
4puxA00 Mainly Beta;Beta Barrel;Porin; 0.8514 2 157 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A538JSX3-F1-model_v4 DUF3237 domain-containing protein 0.9782 2 83
AF-A0A7Y5WY87-F1-model_v4 UPF0311 protein HOQ28_04900 0.9781 1 157
AF-A0A354V2T9-F1-model_v4 UPF0311 protein DDZ81_08495 0.9766 8 157
AF-A0A538J6X6-F1-model_v4 UPF0311 protein E6G06_21945 0.976 2 157
AF-A0A6M1LR28-F1-model_v4 UPF0311 protein G3576_22875 0.9727 12 155

Feature Viewer

pLDDT pTM Quality
93.19 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map