F446254

General Info

Members Datasets Scaffolds Average Seq Length
448 199 447 616

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_32718_c1|nmdc:mga0yw44_32718_c1_233_2080
Length 615
Sequence MAGSEATRTAPTMSDHKPVDHPEGIVTNFIRTRIDGDLAAGKYARRTWAGAPGDAAKQAGXXXXPAKIRTRFPPEPNGYLHFGHAKSICLNFGLARDYAGVCHMRFDDTNPEKEEQEYVDSILDSVHWLGFGWEGFGVNHQYFASDYFDILYRFAELFIEKGLAYVDSQSAEELKLARGSFTEAGKESPYRNRTPAENLALFREMRDGKHAERTHVLRLKIDMASPNINMRDPAIYRIRHAEHHRTGAKWCVYPLYDYTHCISDALENITHSICTLEFQDHRPLYDWVLAKLAEFGQLQVPLPQQIEFARLQLTYVVLSKRKLIKLVKEGYVSGWDDPRMPTLVGARRRGYTPAGFRLFAERIGVAKADSLIDYSTLEECMREDLNETAPRRVAVLDPLKLIIDNYPAGEQEESRMPNHPQKPVLGERVVPFTGELWIEREDFMEVPSKGYFRLFPGNKVRLRHGFVVECIGADKDAAGNITAVHCNYFPDSKSGTDGSNNYKVKGNIHWVSAKHAYAAEVRLYDRLFKVPHPGGRREGDPEDLERDFVEDINPDSVKVITAQVEPALKDAKAEEIFQFERHGYFVADRIDSQPGTPKFNRAVSMKDSWAPPKKK

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.46
Nodule 0
Rhizoplane 3.12
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10002764 3300001991 Bacteria 2693
2 JGI24749J21850_1002723 3300002076 Bacteria 2475
3 Ga0070658_10056038 3300005327 Bacteria 3203
4 Ga0070676_10000409 3300005328 Bacteria 20112
5 Ga0070676_10007710 3300005328 Bacteria 5779
6 Ga0070683_100004039 3300005329 Bacteria 12016
7 Ga0070683_100080073 3300005329 Bacteria 3058
8 Ga0070690_100003370 3300005330 Bacteria 8723
9 Ga0070690_100016902 3300005330 Bacteria 4379
10 Ga0070690_100026835 3300005330 Bacteria 3556
11 Ga0070670_100014220 3300005331 Bacteria 6827
12 Ga0070670_100028203 3300005331 Bacteria 4831
13 Ga0070670_100040937 3300005331 Bacteria 3982
14 Ga0070670_100045408 3300005331 Bacteria 3777
15 Ga0068869_100000241 3300005334 Bacteria 28780
16 Ga0068869_100003459 3300005334 Bacteria 9654
17 Ga0068869_100033795 3300005334 Bacteria 3613
18 Ga0070666_10008499 3300005335 Bacteria 6377
19 Ga0068868_100078105 3300005338 Bacteria 2649
20 Ga0070660_100002491 3300005339 Bacteria 12640
21 Ga0070660_100072357 3300005339 Bacteria 2694
22 Ga0070689_100009420 3300005340 Bacteria 6924
23 Ga0070689_100043341 3300005340 Bacteria 3458
24 Ga0070661_100002610 3300005344 Bacteria 12360
25 Ga0070661_100005939 3300005344 Bacteria 8409
26 Ga0070661_100008060 3300005344 Bacteria 7271
27 Ga0070692_10017508 3300005345 Bacteria 3427
28 Ga0070668_100001824 3300005347 Bacteria 15505
29 Ga0070668_100008440 3300005347 Bacteria 7648
30 Ga0070668_100010286 3300005347 Bacteria 6945
31 Ga0070668_100032019 3300005347 Bacteria 4001
32 Ga0070668_100032199 3300005347 Bacteria 3990
33 Ga0070669_100001002 3300005353 Bacteria 20558
34 Ga0070669_100010129 3300005353 Bacteria 6706
35 Ga0070669_100010823 3300005353 Bacteria 6475
36 Ga0070669_100080667 3300005353 Bacteria 2422
37 Ga0070675_100001486 3300005354 Bacteria 17301
38 Ga0070675_100016434 3300005354 Bacteria 5873
39 Ga0070675_100060069 3300005354 Bacteria 3138
40 Ga0070671_100003732 3300005355 Bacteria 11955
41 Ga0070671_100005429 3300005355 Bacteria 10175
42 Ga0070671_100007647 3300005355 Bacteria 8640
43 Ga0070671_100018327 3300005355 Bacteria 5685
44 Ga0070671_100029995 3300005355 Bacteria 4487
45 Ga0070671_100078708 3300005355 Bacteria 2755
46 Ga0070674_100032646 3300005356 Bacteria 3458
47 Ga0070674_100041610 3300005356 Bacteria 3115
48 Ga0070673_100000369 3300005364 Bacteria 23581
49 Ga0070673_100022022 3300005364 Bacteria 4632
50 Ga0070673_100022764 3300005364 Bacteria 4566
51 Ga0070659_100003342 3300005366 Bacteria 11413
52 Ga0070659_100003585 3300005366 Bacteria 11042
53 Ga0070659_100006802 3300005366 Bacteria 8277
54 Ga0070659_100060471 3300005366 Bacteria 2992
55 Ga0070667_100001414 3300005367 Bacteria 21485
56 Ga0070667_100004046 3300005367 Bacteria 12399
57 Ga0070667_100008559 3300005367 Bacteria 8480
58 Ga0070667_100093680 3300005367 Bacteria 2587
59 Ga0070709_10004947 3300005434 Bacteria 7201
60 Ga0070714_100000881 3300005435 Bacteria 21343
61 Ga0070714_100064775 3300005435 Bacteria 3147
62 Ga0070713_100000161 3300005436 Bacteria 45444
63 Ga0070713_100004999 3300005436 Bacteria 9004
64 Ga0070701_10003210 3300005438 Bacteria 6438
65 Ga0070705_100015928 3300005440 Bacteria 3896
66 Ga0070700_100001388 3300005441 Bacteria 12024
67 Ga0070708_100000721 3300005445 Bacteria 25106
68 Ga0070663_100003516 3300005455 Bacteria 9045
69 Ga0070663_100012142 3300005455 Bacteria 5437
70 Ga0070663_100018475 3300005455 Bacteria 4573
71 Ga0070678_100000697 3300005456 Bacteria 16601
72 Ga0070678_100010882 3300005456 Bacteria 5580
73 Ga0070662_100000340 3300005457 Bacteria 28030
74 Ga0070662_100010780 3300005457 Bacteria 6017
75 Ga0070681_10004643 3300005458 Bacteria 13120
76 Ga0070681_10009351 3300005458 Bacteria 9643
77 Ga0070681_10065093 3300005458 Bacteria 3615
78 Ga0070681_10150807 3300005458 Bacteria 2251
79 Ga0068867_100002597 3300005459 Bacteria 12738
80 Ga0068867_100009237 3300005459 Bacteria 6957
81 Ga0070685_10003123 3300005466 Bacteria 8423
82 Ga0070707_100053504 3300005468 Bacteria 3870
83 Ga0070698_100031587 3300005471 Bacteria 5489
84 Ga0070679_100031360 3300005530 Bacteria 5250
85 Ga0070684_100003132 3300005535 Bacteria 12343
86 Ga0070684_100037056 3300005535 Bacteria 4181
87 Ga0070697_100012449 3300005536 Bacteria 6666
88 Ga0068853_100004329 3300005539 Bacteria 10982
89 Ga0068853_100005128 3300005539 Bacteria 10239
90 Ga0068853_100104565 3300005539 Bacteria 2507
91 Ga0070672_100000618 3300005543 Bacteria 20856
92 Ga0070672_100000746 3300005543 Bacteria 19295
93 Ga0070672_100018599 3300005543 Bacteria 5028
94 Ga0070672_100027958 3300005543 Bacteria 4213
95 Ga0070672_100075869 3300005543 Bacteria 2685
96 Ga0070686_100006481 3300005544 Bacteria 6509
97 Ga0070686_100025178 3300005544 Bacteria 3577
98 Ga0070695_100021162 3300005545 Bacteria 3977
99 Ga0070696_100002786 3300005546 Bacteria 11603
100 Ga0070696_100054171 3300005546 Bacteria 2794
101 Ga0070696_100070273 3300005546 Bacteria 2462
102 Ga0070665_100002113 3300005548 Bacteria 22201
103 Ga0070665_100038023 3300005548 Bacteria 4838
104 Ga0070665_100040078 3300005548 Bacteria 4708
105 Ga0070665_100057008 3300005548 Bacteria 3917
106 Ga0068855_100003919 3300005563 Bacteria 18171
107 Ga0068855_100009230 3300005563 Bacteria 11912
108 Ga0068855_100126830 3300005563 Bacteria 2917
109 Ga0070664_100006183 3300005564 Bacteria 9676
110 Ga0070664_100020841 3300005564 Bacteria 5400
111 Ga0070664_100058031 3300005564 Bacteria 3292
112 Ga0070664_100069609 3300005564 Bacteria 3011
113 Ga0068857_100026296 3300005577 Bacteria 5128
114 Ga0068857_100040945 3300005577 Bacteria 4107
115 Ga0068857_100133491 3300005577 Bacteria 2240
116 Ga0068854_100004294 3300005578 Bacteria 8980
117 Ga0068854_100021837 3300005578 Bacteria 4350
118 Ga0068856_100000121 3300005614 Bacteria 78250
119 Ga0068856_100002936 3300005614 Bacteria 17469
120 Ga0068856_100006037 3300005614 Bacteria 11913
121 Ga0068856_100016863 3300005614 Bacteria 7079
122 Ga0068856_100118836 3300005614 Bacteria 2644
123 Ga0070702_100001194 3300005615 Bacteria 10479
124 Ga0070702_100053589 3300005615 Bacteria 2318
125 Ga0068852_100001886 3300005616 Bacteria 14284
126 Ga0068852_100005100 3300005616 Bacteria 9351
127 Ga0068859_100001091 3300005617 Bacteria 27670
128 Ga0068859_100069502 3300005617 Bacteria 3557
129 Ga0068864_100000584 3300005618 Bacteria 31036
130 Ga0068864_100004990 3300005618 Bacteria 10872
131 Ga0068864_100006490 3300005618 Bacteria 9583
132 Ga0068864_100050009 3300005618 Bacteria 3597
133 Ga0068866_10000796 3300005718 Bacteria 14142
134 Ga0068861_100000823 3300005719 Bacteria 18760
135 Ga0068861_100027431 3300005719 Bacteria 4146
136 Ga0068861_100043144 3300005719 Bacteria 3383
137 Ga0068851_10000310 3300005834 Bacteria 22166
138 Ga0068851_10000364 3300005834 Bacteria 20414
139 Ga0068851_10017676 3300005834 Bacteria 3428
140 Ga0068870_10015189 3300005840 Bacteria 3649
141 Ga0068870_10034161 3300005840 Bacteria 2601
142 Ga0068863_100001050 3300005841 Bacteria 27624
143 Ga0068863_100003644 3300005841 Bacteria 15215
144 Ga0068863_100006241 3300005841 Bacteria 11708
145 Ga0068863_100024523 3300005841 Bacteria 5753
146 Ga0068863_100041202 3300005841 Bacteria 4390
147 Ga0068863_100075008 3300005841 Bacteria 3200
148 Ga0068863_100088944 3300005841 Bacteria 2927
149 Ga0068858_100003652 3300005842 Bacteria 15229
150 Ga0068858_100007734 3300005842 Bacteria 10371
151 Ga0068858_100013481 3300005842 Bacteria 7712
152 Ga0068858_100018130 3300005842 Bacteria 6595
153 Ga0068858_100034960 3300005842 Bacteria 4661
154 Ga0068858_100058532 3300005842 Bacteria 3563
155 Ga0068858_100074982 3300005842 Bacteria 3142
156 Ga0068860_100001726 3300005843 Bacteria 23325
157 Ga0068860_100028277 3300005843 Bacteria 5396
158 Ga0068860_100069247 3300005843 Bacteria 3353
159 Ga0068860_100133901 3300005843 Bacteria 2380
160 Ga0068862_100002356 3300005844 Bacteria 16824
161 Ga0068862_100016027 3300005844 Bacteria 6233
162 Ga0068862_100017315 3300005844 Bacteria 6000
163 Ga0068862_100029557 3300005844 Bacteria 4618
164 Ga0068862_100080505 3300005844 Bacteria 2824
165 Ga0081539_10010944 3300005985 Bacteria 7275
166 Ga0075368_10003125 3300006042 Bacteria 5493
167 Ga0075369_10017083 3300006186 Bacteria 2936
168 Ga0075366_10048518 3300006195 Bacteria 2518
169 Ga0097621_100004190 3300006237 Bacteria 10005
170 Ga0097621_100020302 3300006237 Bacteria 5118
171 Ga0097621_100021787 3300006237 Bacteria 4965
172 Ga0097621_100033429 3300006237 Bacteria 4096
173 Ga0097621_100052218 3300006237 Bacteria 3330
174 Ga0097621_100140224 3300006237 Bacteria 2065
175 Ga0075370_10009875 3300006353 Bacteria 4973
176 Ga0068871_100010324 3300006358 Bacteria 6808
177 Ga0068871_100020774 3300006358 Bacteria 5035
178 Ga0068871_100024180 3300006358 Bacteria 4707
179 Ga0068865_100011577 3300006881 Bacteria 5527
180 Ga0068865_100020446 3300006881 Bacteria 4292
181 Ga0068865_100041746 3300006881 Bacteria 3124
182 Ga0097620_100001092 3300006931 Bacteria 27670
183 Ga0097620_100069499 3300006931 Bacteria 3557
184 Ga0099794_10008573 3300007265 Bacteria 4255
185 Ga0105240_10003341 3300009093 Bacteria 24979
186 Ga0105240_10044573 3300009093 Bacteria 5635
187 Ga0111539_10062512 3300009094 Bacteria 4407
188 Ga0105245_10021004 3300009098 Bacteria 5727
189 Ga0105243_10022296 3300009148 Bacteria 4812
190 Ga0105243_10025731 3300009148 Bacteria 4500
191 Ga0105241_10047110 3300009174 Bacteria 3277
192 Ga0105242_10017710 3300009176 Bacteria 5556
193 Ga0105242_10087349 3300009176 Bacteria 2618
194 Ga0105248_10009560 3300009177 Bacteria 10671
195 Ga0105248_10011247 3300009177 Bacteria 9870
196 Ga0105248_10021011 3300009177 Bacteria 7234
197 Ga0105248_10043658 3300009177 Bacteria 5027
198 Ga0105238_10002111 3300009551 Bacteria 20074
199 Ga0105238_10024732 3300009551 Bacteria 6122
200 Ga0105239_10022524 3300010375 Bacteria 6946
201 Ga0105239_10061782 3300010375 Bacteria 4112
202 Ga0157373_10000313 3300013100 Bacteria 39072
203 Ga0157371_10001341 3300013102 Bacteria 25918
204 Ga0157371_10061896 3300013102 Bacteria 2654
205 Ga0157370_10012667 3300013104 Bacteria 8733
206 Ga0157370_10017427 3300013104 Bacteria 7247
207 Ga0157370_10036534 3300013104 Bacteria 4767
208 Ga0157370_10127357 3300013104 Bacteria 2377
209 Ga0157369_10087933 3300013105 Bacteria 3317
210 Ga0157374_10026634 3300013296 Bacteria 5205
211 Ga0157374_10068695 3300013296 Bacteria 3334
212 Ga0157374_10080110 3300013296 Bacteria 3096
213 Ga0157378_10007496 3300013297 Bacteria 9528
214 Ga0157378_10041300 3300013297 Bacteria 4091
215 Ga0157378_10053727 3300013297 Bacteria 3587
216 Ga0163162_10027844 3300013306 Bacteria 5590
217 Ga0163162_10039103 3300013306 Bacteria 4738
218 Ga0157372_10005180 3300013307 Bacteria 13866
219 Ga0157372_10017912 3300013307 Bacteria 7611
220 Ga0157372_10045220 3300013307 Bacteria 4882
221 Ga0157372_10065779 3300013307 Bacteria 4072
222 Ga0157375_10013307 3300013308 Bacteria 7317
223 Ga0157375_10014402 3300013308 Bacteria 7053
224 Ga0157375_10042237 3300013308 Bacteria 4412
225 Ga0157375_10047351 3300013308 Bacteria 4198
226 Ga0157375_10129433 3300013308 Bacteria 2642
227 Ga0163163_10000642 3300014325 Bacteria 29971
228 Ga0163163_10005036 3300014325 Bacteria 11387
229 Ga0163163_10012468 3300014325 Bacteria 7746
230 Ga0163163_10088879 3300014325 Bacteria 3101
231 Ga0157380_10001123 3300014326 Bacteria 17254
232 Ga0157380_10005564 3300014326 Bacteria 8808
233 Ga0157380_10106033 3300014326 Bacteria 2351
234 Ga0157377_10005499 3300014745 Bacteria 5961
235 Ga0157379_10000555 3300014968 Bacteria 30137
236 Ga0157379_10001305 3300014968 Bacteria 20314
237 Ga0157379_10008059 3300014968 Bacteria 9148
238 Ga0157379_10017142 3300014968 Bacteria 6378
239 Ga0157376_10005392 3300014969 Bacteria 8942
240 Ga0157376_10015463 3300014969 Bacteria 5765
241 Ga0157376_10028221 3300014969 Bacteria 4458
242 Ga0163161_10004118 3300017792 Bacteria 10173
243 Ga0163161_10047405 3300017792 Bacteria 3103
244 Ga0207697_10000552 3300025315 Bacteria 21216
245 Ga0207682_10000696 3300025893 Bacteria 15554
246 Ga0207682_10001581 3300025893 Bacteria 10476
247 Ga0207680_10003849 3300025903 Bacteria 7065
248 Ga0207680_10008445 3300025903 Bacteria 5056
249 Ga0207680_10012720 3300025903 Bacteria 4296
250 Ga0207645_10000077 3300025907 Bacteria 69960
251 Ga0207645_10001675 3300025907 Bacteria 18033
252 Ga0207645_10002559 3300025907 Bacteria 14215
253 Ga0207643_10000579 3300025908 Bacteria 23210
254 Ga0207643_10017810 3300025908 Bacteria 3889
255 Ga0207705_10045156 3300025909 Bacteria 3167
256 Ga0207707_10012775 3300025912 Bacteria 7305
257 Ga0207707_10036484 3300025912 Bacteria 4297
258 Ga0207707_10078032 3300025912 Bacteria 2891
259 Ga0207707_10117004 3300025912 Bacteria 2330
260 Ga0207707_10119063 3300025912 Bacteria 2308
261 Ga0207695_10006083 3300025913 Bacteria 15748
262 Ga0207695_10013182 3300025913 Bacteria 9865
263 Ga0207695_10029541 3300025913 Bacteria 6053
264 Ga0207671_10019474 3300025914 Bacteria 5188
265 Ga0207693_10049661 3300025915 Bacteria 3295
266 Ga0207662_10000516 3300025918 Bacteria 17183
267 Ga0207662_10052433 3300025918 Bacteria 2427
268 Ga0207657_10000809 3300025919 Bacteria 33036
269 Ga0207657_10000995 3300025919 Bacteria 30092
270 Ga0207649_10011776 3300025920 Bacteria 4836
271 Ga0207649_10084432 3300025920 Bacteria 2064
272 Ga0207652_10103317 3300025921 Bacteria 2519
273 Ga0207646_10005173 3300025922 Bacteria 13797
274 Ga0207681_10008991 3300025923 Bacteria 6101
275 Ga0207681_10014287 3300025923 Bacteria 4931
276 Ga0207694_10005020 3300025924 Bacteria 10238
277 Ga0207694_10018840 3300025924 Bacteria 5217
278 Ga0207650_10001400 3300025925 Bacteria 17395
279 Ga0207650_10031052 3300025925 Bacteria 3855
280 Ga0207650_10040037 3300025925 Bacteria 3428
281 Ga0207650_10047458 3300025925 Bacteria 3165
282 Ga0207650_10078730 3300025925 Bacteria 2494
283 Ga0207650_10121202 3300025925 Bacteria 2036
284 Ga0207659_10017397 3300025926 Bacteria 4697
285 Ga0207687_10000379 3300025927 Bacteria 29896
286 Ga0207664_10022129 3300025929 Bacteria 4741
287 Ga0207644_10002447 3300025931 Bacteria 11978
288 Ga0207644_10006501 3300025931 Bacteria 7620
289 Ga0207644_10014671 3300025931 Bacteria 5249
290 Ga0207644_10032788 3300025931 Bacteria 3627
291 Ga0207690_10001081 3300025932 Bacteria 17428
292 Ga0207690_10015651 3300025932 Bacteria 4601
293 Ga0207706_10000351 3300025933 Bacteria 49664
294 Ga0207706_10002579 3300025933 Bacteria 17647
295 Ga0207706_10012482 3300025933 Bacteria 7739
296 Ga0207706_10067063 3300025933 Bacteria 3157
297 Ga0207686_10002634 3300025934 Bacteria 9733
298 Ga0207686_10057390 3300025934 Bacteria 2451
299 Ga0207709_10001934 3300025935 Bacteria 13610
300 Ga0207670_10042943 3300025936 Bacteria 2983
301 Ga0207704_10007441 3300025938 Bacteria 5174
302 Ga0207704_10008866 3300025938 Bacteria 4830
303 Ga0207691_10000499 3300025940 Bacteria 39022
304 Ga0207691_10001011 3300025940 Bacteria 27902
305 Ga0207691_10002200 3300025940 Bacteria 19071
306 Ga0207691_10002929 3300025940 Bacteria 16652
307 Ga0207691_10003403 3300025940 Bacteria 15465
308 Ga0207691_10010343 3300025940 Bacteria 8949
309 Ga0207691_10013887 3300025940 Bacteria 7685
310 Ga0207691_10052287 3300025940 Bacteria 3731
311 Ga0207711_10036766 3300025941 Bacteria 4155
312 Ga0207711_10097359 3300025941 Bacteria 2598
313 Ga0207689_10000003 3300025942 Bacteria 175710
314 Ga0207689_10001066 3300025942 Bacteria 26408
315 Ga0207689_10005681 3300025942 Bacteria 11099
316 Ga0207689_10019181 3300025942 Bacteria 5766
317 Ga0207689_10028124 3300025942 Bacteria 4702
318 Ga0207661_10019665 3300025944 Bacteria 5040
319 Ga0207661_10042397 3300025944 Bacteria 3587
320 Ga0207661_10055828 3300025944 Bacteria 3169
321 Ga0207679_10003087 3300025945 Bacteria 10309
322 Ga0207679_10004504 3300025945 Bacteria 8678
323 Ga0207679_10082504 3300025945 Bacteria 2461
324 Ga0207667_10001104 3300025949 Bacteria 34133
325 Ga0207667_10003582 3300025949 Bacteria 19195
326 Ga0207651_10001712 3300025960 Bacteria 10127
327 Ga0207651_10009844 3300025960 Bacteria 5261
328 Ga0207651_10014031 3300025960 Bacteria 4612
329 Ga0207651_10026020 3300025960 Bacteria 3647
330 Ga0207668_10003581 3300025972 Bacteria 9126
331 Ga0207668_10026999 3300025972 Bacteria 3736
332 Ga0207640_10002153 3300025981 Bacteria 10582
333 Ga0207640_10022730 3300025981 Bacteria 3759
334 Ga0207658_10004601 3300025986 Bacteria 9568
335 Ga0207658_10025571 3300025986 Bacteria 4134
336 Ga0207658_10039627 3300025986 Bacteria 3400
337 Ga0207658_10055257 3300025986 Bacteria 2942
338 Ga0207677_10014048 3300026023 Bacteria 4661
339 Ga0207703_10000904 3300026035 Bacteria 29021
340 Ga0207703_10005562 3300026035 Bacteria 10114
341 Ga0207703_10017151 3300026035 Bacteria 5648
342 Ga0207703_10025683 3300026035 Bacteria 4634
343 Ga0207703_10041648 3300026035 Bacteria 3681
344 Ga0207703_10121286 3300026035 Bacteria 2244
345 Ga0207639_10002265 3300026041 Bacteria 12933
346 Ga0207639_10025932 3300026041 Bacteria 4254
347 Ga0207678_10002339 3300026067 Bacteria 17182
348 Ga0207678_10003679 3300026067 Bacteria 13784
349 Ga0207678_10008888 3300026067 Bacteria 8847
350 Ga0207708_10000049 3300026075 Bacteria 114743
351 Ga0207708_10000693 3300026075 Bacteria 25576
352 Ga0207708_10023331 3300026075 Bacteria 4676
353 Ga0207702_10002222 3300026078 Bacteria 18606
354 Ga0207702_10002542 3300026078 Bacteria 17175
355 Ga0207702_10006152 3300026078 Bacteria 10390
356 Ga0207702_10009988 3300026078 Bacteria 7956
357 Ga0207641_10002961 3300026088 Bacteria 15359
358 Ga0207641_10026730 3300026088 Bacteria 4763
359 Ga0207648_10000126 3300026089 Bacteria 75403
360 Ga0207648_10000589 3300026089 Bacteria 40773
361 Ga0207648_10001872 3300026089 Bacteria 23010
362 Ga0207648_10002126 3300026089 Bacteria 21549
363 Ga0207648_10002919 3300026089 Bacteria 18093
364 Ga0207648_10018976 3300026089 Bacteria 6210
365 Ga0207676_10000762 3300026095 Bacteria 25182
366 Ga0207676_10019522 3300026095 Bacteria 4947
367 Ga0207676_10019660 3300026095 Bacteria 4931
368 Ga0207676_10068902 3300026095 Bacteria 2831
369 Ga0207674_10004946 3300026116 Bacteria 15914
370 Ga0207674_10016301 3300026116 Bacteria 8138
371 Ga0207674_10019440 3300026116 Bacteria 7355
372 Ga0207675_100001747 3300026118 Bacteria 21721
373 Ga0207675_100012787 3300026118 Bacteria 7841
374 Ga0207683_10000280 3300026121 Bacteria 45558
375 Ga0207683_10001731 3300026121 Bacteria 19437
376 Ga0207683_10006222 3300026121 Bacteria 10230
377 Ga0207683_10114639 3300026121 Bacteria 2415
378 Ga0207698_10009365 3300026142 Bacteria 6243
379 Ga0207698_10012240 3300026142 Bacteria 5605
380 Ga0207698_10035501 3300026142 Bacteria 3648
381 Ga0209813_10001057 3300027866 Bacteria 6201
382 Ga0209974_10004825 3300027876 Bacteria 4779
383 Ga0209974_10009273 3300027876 Bacteria 3341
384 Ga0207428_10014978 3300027907 Bacteria 6719
385 Ga0268266_10056257 3300028379 Bacteria 3384
386 Ga0268266_10059818 3300028379 Bacteria 3282
387 Ga0268266_10079030 3300028379 Bacteria 2863
388 Ga0268265_10004994 3300028380 Bacteria 9105
389 Ga0268265_10013273 3300028380 Bacteria 5598
390 Ga0268265_10053291 3300028380 Bacteria 3064
391 Ga0268265_10145164 3300028380 Bacteria 1993
392 Ga0268264_10007085 3300028381 Bacteria 9396
393 Ga0268264_10024875 3300028381 Bacteria 4893
394 Ga0268264_10051758 3300028381 Bacteria 3423
395 Ga0307511_10000574 3300030521 Bacteria 39348
396 Ga0265330_10003053 3300031235 Bacteria 8874
397 Ga0265332_10000284 3300031238 Bacteria 39799
398 Ga0265320_10014350 3300031240 Bacteria 4515
399 Ga0265329_10005042 3300031242 Bacteria 5391
400 Ga0265331_10000415 3300031250 Bacteria 43326
401 Ga0265327_10004174 3300031251 Bacteria 13030
402 Ga0307408_100004748 3300031548 Bacteria 9163
403 Ga0307408_100026343 3300031548 Bacteria 3993
404 Ga0265314_10017192 3300031711 Bacteria 5683
405 Ga0307405_10000547 3300031731 Bacteria 14284
406 Ga0307405_10000931 3300031731 Bacteria 11645
407 Ga0307410_10005943 3300031852 Bacteria 6526
408 Ga0307410_10037162 3300031852 Bacteria 3178
409 Ga0307406_10006227 3300031901 Bacteria 6570
410 Ga0307412_10014646 3300031911 Bacteria 4632
411 Ga0307409_100020047 3300031995 Bacteria 4546
412 Ga0307409_100029171 3300031995 Bacteria 3944
413 Ga0307416_100035114 3300032002 Bacteria 3824
414 Ga0307416_100075743 3300032002 Bacteria 2817
415 Ga0307415_100000868 3300032126 Bacteria 13824
416 Ga0307507_10025624 3300033179 Bacteria 6392
417 Ga0373947_0086541 3300035725 Bacteria 1948
418 Ga0373937_0055171 3300036401 Bacteria 3647
419 Ga0395898_0119569 3300037466 Bacteria 2524
420 Ga0395905_0028209 3300037471 Bacteria 5292
421 Ga0466967_0101643 3300045976 Bacteria 2628
422 Ga0496100_0024257 3300048903 Bacteria 3697
423 Ga0496100_0054440 3300048903 Bacteria 2610
424 Ga0496102_0036514 3300048905 Bacteria 4427
425 Ga0496103_0054345 3300048906 Bacteria 2482
426 Ga0496104_0098455 3300048907 Bacteria 2799
427 Ga0496106_0000971 3300048909 Bacteria 20941
428 Ga0496106_0109941 3300048909 Bacteria 2145
429 Ga0496107_0002428 3300048910 Bacteria 12074
430 Ga0496109_0041278 3300048912 Bacteria 4180
431 Ga0496109_0047622 3300048912 Bacteria 3898
432 Ga0496110_0061665 3300048913 Bacteria 3311
433 Ga0496110_0061978 3300048913 Bacteria 3302
434 Ga0496111_0066337 3300048914 Bacteria 2621
435 Ga0496115_0034929 3300048918 Bacteria 3975
436 Ga0501069_0044690 3300049585 Bacteria 2452
437 Ga0501070_0089975 3300049586 Bacteria 2540
438 Ga0501074_0044044 3300049590 Bacteria 3231
439 nmdc:mga03n38_4077_c1 3300050490 Bacteria 4789
440 nmdc:mga0yw44_32718_c1 3300050492 Bacteria 3032
441 nmdc:mga0k408_5952_c1 3300050493 Bacteria 6507
442 nmdc:mga06z11_3221_c1 3300050494 Bacteria 6306
443 nmdc:mga07m45_6236_c1 3300050496 Bacteria 4743
444 nmdc:mga08y16_34775_c1 3300050511 Bacteria 5294
445 nmdc:mga0n895_80206_c1 3300050512 Bacteria 3251
446 nmdc:mga08x19_34112_c1 3300050514 Bacteria 3215
447 nmdc:mga0sz30_4547_c1 3300050516 Bacteria 5024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100070273 Ga0070696_1000702732 537
2 3300005615 Ga0070702_100053589 Ga0070702_1000535892 539
3 3300031240 Ga0265320_10014350 Ga0265320_100143503 556
4 3300007265 Ga0099794_10008573 Ga0099794_100085732 557
5 3300005345 Ga0070692_10017508 Ga0070692_100175082 558
6 3300026075 Ga0207708_10023331 Ga0207708_100233312 558
7 3300045976 Ga0466967_0101643 Ga0466967_0101643_566_2374 558
8 3300005842 Ga0068858_100013481 Ga0068858_1000134813 561
9 iso_pu_bacteria 8039098773 8039104044 561
10 3300005577 Ga0068857_100026296 Ga0068857_1000262964 564
11 3300005614 Ga0068856_100016863 Ga0068856_1000168635 564
12 3300026078 Ga0207702_10002222 Ga0207702_100022226 564
13 3300026116 Ga0207674_10016301 Ga0207674_100163015 564
14 3300005330 Ga0070690_100003370 Ga0070690_1000033704 567
15 3300005340 Ga0070689_100043341 Ga0070689_1000433413 567
16 3300005440 Ga0070705_100015928 Ga0070705_1000159283 567
17 3300005441 Ga0070700_100001388 Ga0070700_1000013887 567
18 3300005544 Ga0070686_100025178 Ga0070686_1000251782 567
19 3300005545 Ga0070695_100021162 Ga0070695_1000211623 567
20 3300005546 Ga0070696_100054171 Ga0070696_1000541713 567
21 3300005615 Ga0070702_100001194 Ga0070702_1000011947 567
22 3300005719 Ga0068861_100027431 Ga0068861_1000274313 567
23 3300005842 Ga0068858_100034960 Ga0068858_1000349603 567
24 3300005844 Ga0068862_100080505 Ga0068862_1000805052 567
25 3300006237 Ga0097621_100020302 Ga0097621_1000203023 567
26 3300006358 Ga0068871_100010324 Ga0068871_1000103245 567
27 3300006881 Ga0068865_100011577 Ga0068865_1000115772 567
28 3300009098 Ga0105245_10021004 Ga0105245_100210044 567
29 3300009148 Ga0105243_10025731 Ga0105243_100257313 567
30 3300009176 Ga0105242_10017710 Ga0105242_100177104 567
31 3300013297 Ga0157378_10053727 Ga0157378_100537274 567
32 3300014326 Ga0157380_10001123 Ga0157380_100011232 567
33 3300025918 Ga0207662_10052433 Ga0207662_100524332 567
34 3300025927 Ga0207687_10000379 Ga0207687_100003795 567
35 3300025934 Ga0207686_10002634 Ga0207686_100026345 567
36 3300025935 Ga0207709_10001934 Ga0207709_100019343 567
37 3300025936 Ga0207670_10042943 Ga0207670_100429432 567
38 3300025938 Ga0207704_10007441 Ga0207704_100074413 567
39 3300026035 Ga0207703_10025683 Ga0207703_100256832 567
40 3300026075 Ga0207708_10000049 Ga0207708_10000049100 567
41 3300026089 Ga0207648_10002919 Ga0207648_1000291915 567
42 3300026118 Ga0207675_100001747 Ga0207675_1000017476 567
43 3300026121 Ga0207683_10114639 Ga0207683_101146392 567
44 3300028380 Ga0268265_10053291 Ga0268265_100532913 567
45 3300006186 Ga0075369_10017083 Ga0075369_100170833 570
46 3300005985 Ga0081539_10010944 Ga0081539_100109446 571
47 3300030521 Ga0307511_10000574 Ga0307511_1000057418 571
48 3300014968 Ga0157379_10017142 Ga0157379_100171425 572
49 3300025942 Ga0207689_10005681 Ga0207689_100056813 572
50 3300005536 Ga0070697_100012449 Ga0070697_1000124493 573
51 3300006042 Ga0075368_10003125 Ga0075368_100031253 574
52 3300006195 Ga0075366_10048518 Ga0075366_100485182 574
53 3300006353 Ga0075370_10009875 Ga0075370_100098752 574
54 3300027866 Ga0209813_10001057 Ga0209813_100010574 574
55 3300050490 nmdc:mga03n38_4077_c1 nmdc:mga03n38_4077_c1_927_2729 574
56 3300050493 nmdc:mga0k408_5952_c1 nmdc:mga0k408_5952_c1_1781_3583 574
57 3300050494 nmdc:mga06z11_3221_c1 nmdc:mga06z11_3221_c1_2209_4011 574
58 3300050496 nmdc:mga07m45_6236_c1 nmdc:mga07m45_6236_c1_1793_3595 574
59 3300050516 nmdc:mga0sz30_4547_c1 nmdc:mga0sz30_4547_c1_1255_3057 574
60 3300006358 Ga0068871_100020774 Ga0068871_1000207744 576
61 3300009177 Ga0105248_10011247 Ga0105248_100112475 576
62 3300010375 Ga0105239_10061782 Ga0105239_100617822 576
63 3300013297 Ga0157378_10041300 Ga0157378_100413004 576
64 3300013308 Ga0157375_10014402 Ga0157375_100144023 576
65 3300014969 Ga0157376_10005392 Ga0157376_100053924 576
66 3300025960 Ga0207651_10014031 Ga0207651_100140314 576
67 3300033179 Ga0307507_10025624 Ga0307507_100256242 578
68 3300005339 Ga0070660_100002491 Ga0070660_1000024915 579
69 3300005344 Ga0070661_100005939 Ga0070661_1000059399 579
70 3300005353 Ga0070669_100080667 Ga0070669_1000806671 579
71 3300005355 Ga0070671_100005429 Ga0070671_1000054295 579
72 3300005366 Ga0070659_100003585 Ga0070659_1000035854 579
73 3300005455 Ga0070663_100003516 Ga0070663_1000035165 579
74 3300005457 Ga0070662_100000340 Ga0070662_10000034018 579
75 3300005458 Ga0070681_10150807 Ga0070681_101508072 579
76 3300005539 Ga0068853_100005128 Ga0068853_1000051282 579
77 3300005543 Ga0070672_100027958 Ga0070672_1000279582 579
78 3300005563 Ga0068855_100003919 Ga0068855_1000039199 579
79 3300005614 Ga0068856_100000121 Ga0068856_10000012134 579
80 3300005841 Ga0068863_100041202 Ga0068863_1000412022 579
81 3300005842 Ga0068858_100074982 Ga0068858_1000749822 579
82 3300005843 Ga0068860_100069247 Ga0068860_1000692472 579
83 3300013100 Ga0157373_10000313 Ga0157373_1000031318 579
84 3300013102 Ga0157371_10001341 Ga0157371_1000134112 579
85 3300013105 Ga0157369_10087933 Ga0157369_100879332 579
86 3300013307 Ga0157372_10005180 Ga0157372_1000518016 579
87 3300025912 Ga0207707_10119063 Ga0207707_101190632 579
88 3300025919 Ga0207657_10000995 Ga0207657_1000099525 579
89 3300025931 Ga0207644_10002447 Ga0207644_100024474 579
90 3300025932 Ga0207690_10001081 Ga0207690_1000108112 579
91 3300025933 Ga0207706_10000351 Ga0207706_1000035123 579
92 3300025940 Ga0207691_10052287 Ga0207691_100522872 579
93 3300025945 Ga0207679_10004504 Ga0207679_100045042 579
94 3300025949 Ga0207667_10003582 Ga0207667_1000358210 579
95 3300025960 Ga0207651_10009844 Ga0207651_100098446 579
96 3300026035 Ga0207703_10121286 Ga0207703_101212861 579
97 3300026041 Ga0207639_10002265 Ga0207639_100022654 579
98 3300026067 Ga0207678_10002339 Ga0207678_1000233919 579
99 3300026078 Ga0207702_10002542 Ga0207702_100025426 579
100 3300026142 Ga0207698_10012240 Ga0207698_100122406 579
101 3300028380 Ga0268265_10145164 Ga0268265_101451641 579
102 3300048903 Ga0496100_0054440 Ga0496100_0054440_558_2423 579
103 3300048905 Ga0496102_0036514 Ga0496102_0036514_472_2337 579
104 3300048909 Ga0496106_0000971 Ga0496106_0000971_11745_13610 579
105 3300048910 Ga0496107_0002428 Ga0496107_0002428_4824_6689 579
106 3300049585 Ga0501069_0044690 Ga0501069_0044690_274_2013 579
107 3300049586 Ga0501070_0089975 Ga0501070_0089975_425_2164 579
108 3300049590 Ga0501074_0044044 Ga0501074_0044044_639_2378 579
109 3300050492 nmdc:mga0yw44_32718_c1 nmdc:mga0yw44_32718_c1_233_2080 582
110 3300031852 Ga0307410_10037162 Ga0307410_100371621 583
111 3300031995 Ga0307409_100020047 Ga0307409_1000200472 583
112 3300050514 nmdc:mga08x19_34112_c1 nmdc:mga08x19_34112_c1_1237_3060 583
113 3300013104 Ga0157370_10127357 Ga0157370_101273571 584
114 3300013307 Ga0157372_10065779 Ga0157372_100657794 584
115 3300005331 Ga0070670_100014220 Ga0070670_1000142202 585
116 3300013308 Ga0157375_10042237 Ga0157375_100422372 585
117 3300025925 Ga0207650_10121202 Ga0207650_101212022 585
118 3300025981 Ga0207640_10022730 Ga0207640_100227302 585
119 3300048918 Ga0496115_0034929 Ga0496115_0034929_1401_3188 585
120 3300005334 Ga0068869_100003459 Ga0068869_1000034595 586
121 3300005842 Ga0068858_100007734 Ga0068858_1000077345 586
122 3300014326 Ga0157380_10106033 Ga0157380_101060332 586
123 3300025941 Ga0207711_10036766 Ga0207711_100367662 586
124 3300028379 Ga0268266_10056257 Ga0268266_100562573 586
125 3300005355 Ga0070671_100078708 Ga0070671_1000787082 591
126 3300031548 Ga0307408_100004748 Ga0307408_1000047489 591
127 3300031911 Ga0307412_10014646 Ga0307412_100146462 591
128 3300035725 Ga0373947_0086541 Ga0373947_0086541_79_1854 591
129 3300005436 Ga0070713_100000161 Ga0070713_10000016131 593
130 3300005468 Ga0070707_100053504 Ga0070707_1000535042 595
131 3300005843 Ga0068860_100133901 Ga0068860_1001339012 595
132 3300025922 Ga0207646_10005173 Ga0207646_100051731 595
133 3300048914 Ga0496111_0066337 Ga0496111_0066337_770_2575 595
134 3300031235 Ga0265330_10003053 Ga0265330_100030535 596
135 3300031238 Ga0265332_10000284 Ga0265332_100002848 596
136 3300031242 Ga0265329_10005042 Ga0265329_100050424 596
137 3300031250 Ga0265331_10000415 Ga0265331_100004154 596
138 3300031251 Ga0265327_10004174 Ga0265327_1000417411 596
139 3300031711 Ga0265314_10017192 Ga0265314_100171925 596
140 3300031731 Ga0307405_10000547 Ga0307405_100005473 596
141 3300031852 Ga0307410_10005943 Ga0307410_100059434 596
142 3300031995 Ga0307409_100029171 Ga0307409_1000291713 596
143 3300032002 Ga0307416_100035114 Ga0307416_1000351142 596
144 3300032126 Ga0307415_100000868 Ga0307415_1000008689 596
145 3300037466 Ga0395898_0119569 Ga0395898_0119569_426_2303 596
146 3300006237 Ga0097621_100052218 Ga0097621_1000522182 601
147 3300005334 Ga0068869_100033795 Ga0068869_1000337952 602
148 3300005354 Ga0070675_100060069 Ga0070675_1000600692 602
149 3300005617 Ga0068859_100069502 Ga0068859_1000695022 602
150 3300006931 Ga0097620_100069499 Ga0097620_1000694992 602
151 3300025942 Ga0207689_10028124 Ga0207689_100281242 602
152 3300026095 Ga0207676_10019522 Ga0207676_100195223 602
153 3300009176 Ga0105242_10087349 Ga0105242_100873492 603
154 3300025934 Ga0207686_10057390 Ga0207686_100573901 603
155 3300005356 Ga0070674_100032646 Ga0070674_1000326462 604
156 3300005367 Ga0070667_100008559 Ga0070667_1000085594 605
157 3300005456 Ga0070678_100000697 Ga0070678_10000069716 605
158 3300005543 Ga0070672_100018599 Ga0070672_1000185991 605
159 3300005548 Ga0070665_100040078 Ga0070665_1000400783 605
160 3300013308 Ga0157375_10129433 Ga0157375_101294331 605
161 3300025903 Ga0207680_10012720 Ga0207680_100127202 605
162 3300025940 Ga0207691_10013887 Ga0207691_100138875 605
163 3300025986 Ga0207658_10025571 Ga0207658_100255712 605
164 3300028379 Ga0268266_10059818 Ga0268266_100598182 605
165 3300005435 Ga0070714_100064775 Ga0070714_1000647753 606
166 3300005471 Ga0070698_100031587 Ga0070698_1000315874 606
167 3300005719 Ga0068861_100043144 Ga0068861_1000431443 606
168 3300005844 Ga0068862_100029557 Ga0068862_1000295573 606
169 3300028380 Ga0268265_10013273 Ga0268265_100132734 606
170 3300005328 Ga0070676_10000409 Ga0070676_100004092 607
171 3300005329 Ga0070683_100080073 Ga0070683_1000800732 607
172 3300005330 Ga0070690_100016902 Ga0070690_1000169022 607
173 3300005331 Ga0070670_100040937 Ga0070670_1000409372 607
174 3300005335 Ga0070666_10008499 Ga0070666_100084994 607
175 3300005344 Ga0070661_100002610 Ga0070661_1000026105 607
176 3300005347 Ga0070668_100010286 Ga0070668_1000102863 607
177 3300005353 Ga0070669_100001002 Ga0070669_1000010023 607
178 3300005355 Ga0070671_100029995 Ga0070671_1000299952 607
179 3300005356 Ga0070674_100041610 Ga0070674_1000416102 607
180 3300005364 Ga0070673_100022764 Ga0070673_1000227642 607
181 3300005366 Ga0070659_100006802 Ga0070659_1000068029 607
182 3300005367 Ga0070667_100004046 Ga0070667_1000040462 607
183 3300005435 Ga0070714_100000881 Ga0070714_1000008818 607
184 3300005456 Ga0070678_100010882 Ga0070678_1000108823 607
185 3300005458 Ga0070681_10004643 Ga0070681_100046431 607
186 3300005459 Ga0068867_100002597 Ga0068867_10000259710 607
187 3300005535 Ga0070684_100003132 Ga0070684_1000031321 607
188 3300005539 Ga0068853_100104565 Ga0068853_1001045652 607
189 3300005543 Ga0070672_100000618 Ga0070672_1000006182 607
190 3300005548 Ga0070665_100002113 Ga0070665_10000211321 607
191 3300005563 Ga0068855_100009230 Ga0068855_10000923011 607
192 3300005564 Ga0070664_100006183 Ga0070664_1000061831 607
193 3300005614 Ga0068856_100006037 Ga0068856_1000060372 607
194 3300005618 Ga0068864_100050009 Ga0068864_1000500092 607
195 3300005841 Ga0068863_100024523 Ga0068863_1000245232 607
196 3300005842 Ga0068858_100058532 Ga0068858_1000585321 607
197 3300005843 Ga0068860_100028277 Ga0068860_1000282773 607
198 3300006237 Ga0097621_100004190 Ga0097621_1000041909 607
199 3300006358 Ga0068871_100024180 Ga0068871_1000241802 607
200 3300006881 Ga0068865_100020446 Ga0068865_1000204462 607
201 3300009093 Ga0105240_10003341 Ga0105240_100033414 607
202 3300009177 Ga0105248_10021011 Ga0105248_100210112 607
203 3300009551 Ga0105238_10002111 Ga0105238_100021116 607
204 3300013102 Ga0157371_10061896 Ga0157371_100618961 607
205 3300013296 Ga0157374_10026634 Ga0157374_100266343 607
206 3300013306 Ga0163162_10039103 Ga0163162_100391032 607
207 3300013307 Ga0157372_10017912 Ga0157372_100179122 607
208 3300014968 Ga0157379_10001305 Ga0157379_100013053 607
209 3300017792 Ga0163161_10004118 Ga0163161_1000411810 607
210 3300025907 Ga0207645_10002559 Ga0207645_100025592 607
211 3300025912 Ga0207707_10078032 Ga0207707_100780322 607
212 3300025913 Ga0207695_10006083 Ga0207695_1000608314 607
213 3300025914 Ga0207671_10019474 Ga0207671_100194742 607
214 3300025920 Ga0207649_10084432 Ga0207649_100844321 607
215 3300025923 Ga0207681_10014287 Ga0207681_100142872 607
216 3300025924 Ga0207694_10005020 Ga0207694_100050202 607
217 3300025931 Ga0207644_10032788 Ga0207644_100327881 607
218 3300025938 Ga0207704_10008866 Ga0207704_100088662 607
219 3300025940 Ga0207691_10001011 Ga0207691_100010112 607
220 3300025940 Ga0207691_10002200 Ga0207691_1000220017 607
221 3300025942 Ga0207689_10019181 Ga0207689_100191813 607
222 3300025944 Ga0207661_10019665 Ga0207661_100196652 607
223 3300025945 Ga0207679_10003087 Ga0207679_100030876 607
224 3300025960 Ga0207651_10001712 Ga0207651_100017125 607
225 3300025986 Ga0207658_10055257 Ga0207658_100552571 607
226 3300026035 Ga0207703_10005562 Ga0207703_100055622 607
227 3300026078 Ga0207702_10006152 Ga0207702_1000615212 607
228 3300026088 Ga0207641_10026730 Ga0207641_100267303 607
229 3300026089 Ga0207648_10000126 Ga0207648_1000012630 607
230 3300026089 Ga0207648_10018976 Ga0207648_100189763 607
231 3300026095 Ga0207676_10019660 Ga0207676_100196602 607
232 3300026121 Ga0207683_10001731 Ga0207683_1000173121 607
233 3300028381 Ga0268264_10024875 Ga0268264_100248753 607
234 3300048912 Ga0496109_0041278 Ga0496109_0041278_1032_2897 607
235 3300048913 Ga0496110_0061665 Ga0496110_0061665_949_2814 607
236 3300025923 Ga0207681_10008991 Ga0207681_100089917 608
237 3300005354 Ga0070675_100016434 Ga0070675_1000164343 610
238 3300005364 Ga0070673_100022022 Ga0070673_1000220223 610
239 3300005543 Ga0070672_100000746 Ga0070672_1000007466 610
240 3300013306 Ga0163162_10027844 Ga0163162_100278442 610
241 3300013308 Ga0157375_10013307 Ga0157375_100133074 610
242 3300017792 Ga0163161_10047405 Ga0163161_100474052 610
243 3300025925 Ga0207650_10078730 Ga0207650_100787301 610
244 3300025933 Ga0207706_10012482 Ga0207706_100124826 610
245 3300025940 Ga0207691_10010343 Ga0207691_100103434 610
246 3300025960 Ga0207651_10026020 Ga0207651_100260202 610
247 3300025972 Ga0207668_10003581 Ga0207668_100035812 610
248 3300005353 Ga0070669_100010129 Ga0070669_1000101292 611
249 3300005543 Ga0070672_100075869 Ga0070672_1000758692 611
250 3300005618 Ga0068864_100006490 Ga0068864_1000064904 611
251 3300005840 Ga0068870_10034161 Ga0068870_100341612 611
252 3300005841 Ga0068863_100003644 Ga0068863_1000036444 611
253 3300005844 Ga0068862_100017315 Ga0068862_1000173152 611
254 3300014325 Ga0163163_10005036 Ga0163163_100050366 611
255 3300014969 Ga0157376_10015463 Ga0157376_100154633 611
256 3300014969 Ga0157376_10028221 Ga0157376_100282212 611
257 3300025908 Ga0207643_10017810 Ga0207643_100178102 611
258 3300025940 Ga0207691_10003403 Ga0207691_100034038 611
259 3300026095 Ga0207676_10068902 Ga0207676_100689022 611
260 3300005445 Ga0070708_100000721 Ga0070708_1000007215 612
261 3300005564 Ga0070664_100058031 Ga0070664_1000580313 612
262 3300005614 Ga0068856_100118836 Ga0068856_1001188362 612
263 3300050512 nmdc:mga0n895_80206_c1 nmdc:mga0n895_80206_c1_234_2102 612
264 3300005355 Ga0070671_100007647 Ga0070671_1000076479 613
265 3300005548 Ga0070665_100038023 Ga0070665_1000380233 613
266 3300006237 Ga0097621_100021787 Ga0097621_1000217872 613
267 3300013297 Ga0157378_10007496 Ga0157378_100074966 613
268 3300014325 Ga0163163_10088879 Ga0163163_100888792 613
269 3300025931 Ga0207644_10014671 Ga0207644_100146712 613
270 3300025986 Ga0207658_10039627 Ga0207658_100396272 613
271 3300028379 Ga0268266_10079030 Ga0268266_100790301 613
272 3300005347 Ga0070668_100032019 Ga0070668_1000320192 614
273 3300005347 Ga0070668_100032199 Ga0070668_1000321992 614
274 3300005367 Ga0070667_100093680 Ga0070667_1000936802 614
275 3300025972 Ga0207668_10026999 Ga0207668_100269992 614
276 3300027876 Ga0209974_10009273 Ga0209974_100092731 614
277 3300031548 Ga0307408_100026343 Ga0307408_1000263432 614
278 3300031731 Ga0307405_10000931 Ga0307405_100009315 614
279 3300031901 Ga0307406_10006227 Ga0307406_100062276 614
280 3300032002 Ga0307416_100075743 Ga0307416_1000757432 614
281 3300005347 Ga0070668_100008440 Ga0070668_1000084404 615
282 3300005546 Ga0070696_100002786 Ga0070696_1000027869 615
283 3300025925 Ga0207650_10040037 Ga0207650_100400371 615
284 3300028381 Ga0268264_10051758 Ga0268264_100517582 615
285 3300005339 Ga0070660_100072357 Ga0070660_1000723572 618
286 3300005366 Ga0070659_100003342 Ga0070659_1000033425 618
287 3300005458 Ga0070681_10009351 Ga0070681_100093519 618
288 3300005530 Ga0070679_100031360 Ga0070679_1000313602 618
289 3300005564 Ga0070664_100069609 Ga0070664_1000696092 618
290 3300005578 Ga0068854_100004294 Ga0068854_1000042949 618
291 3300005614 Ga0068856_100002936 Ga0068856_10000293613 618
292 3300005834 Ga0068851_10000364 Ga0068851_100003647 618
293 3300005841 Ga0068863_100075008 Ga0068863_1000750082 618
294 3300009093 Ga0105240_10044573 Ga0105240_100445732 618
295 3300009174 Ga0105241_10047110 Ga0105241_100471102 618
296 3300009551 Ga0105238_10024732 Ga0105238_100247325 618
297 3300010375 Ga0105239_10022524 Ga0105239_100225246 618
298 3300013104 Ga0157370_10036534 Ga0157370_100365342 618
299 3300025912 Ga0207707_10012775 Ga0207707_100127752 618
300 3300025912 Ga0207707_10036484 Ga0207707_100364841 618
301 3300025913 Ga0207695_10013182 Ga0207695_100131824 618
302 3300025919 Ga0207657_10000809 Ga0207657_1000080916 618
303 3300025920 Ga0207649_10011776 Ga0207649_100117763 618
304 3300025921 Ga0207652_10103317 Ga0207652_101033172 618
305 3300025924 Ga0207694_10018840 Ga0207694_100188404 618
306 3300025929 Ga0207664_10022129 Ga0207664_100221295 618
307 3300025932 Ga0207690_10015651 Ga0207690_100156515 618
308 3300025944 Ga0207661_10042397 Ga0207661_100423972 618
309 3300025949 Ga0207667_10001104 Ga0207667_1000110423 618
310 3300025981 Ga0207640_10002153 Ga0207640_100021533 618
311 3300026041 Ga0207639_10025932 Ga0207639_100259322 618
312 3300026078 Ga0207702_10009988 Ga0207702_100099886 618
313 3300026116 Ga0207674_10004946 Ga0207674_100049465 618
314 3300026142 Ga0207698_10009365 Ga0207698_100093653 618
315 3300037471 Ga0395905_0028209 Ga0395905_0028209_2147_4018 618
316 3300005458 Ga0070681_10065093 Ga0070681_100650932 619
317 3300005841 Ga0068863_100088944 Ga0068863_1000889441 619
318 3300025912 Ga0207707_10117004 Ga0207707_101170041 619
319 3300005434 Ga0070709_10004947 Ga0070709_100049474 620
320 3300005436 Ga0070713_100004999 Ga0070713_1000049992 620
321 3300013104 Ga0157370_10012667 Ga0157370_100126675 620
322 3300013307 Ga0157372_10045220 Ga0157372_100452202 620
323 3300013308 Ga0157375_10047351 Ga0157375_100473512 620
324 3300005842 Ga0068858_100003652 Ga0068858_1000036521 621
325 3300014968 Ga0157379_10008059 Ga0157379_1000805912 621
326 3300025941 Ga0207711_10097359 Ga0207711_100973592 621
327 3300026035 Ga0207703_10017151 Ga0207703_100171514 621
328 3300027876 Ga0209974_10004825 Ga0209974_100048252 621
329 3300005328 Ga0070676_10007710 Ga0070676_100077104 622
330 3300005354 Ga0070675_100001486 Ga0070675_10000148615 622
331 3300005355 Ga0070671_100003732 Ga0070671_1000037323 622
332 3300005364 Ga0070673_100000369 Ga0070673_10000036915 622
333 3300005539 Ga0068853_100004329 Ga0068853_1000043296 622
334 3300005616 Ga0068852_100005100 Ga0068852_1000051002 622
335 3300005834 Ga0068851_10017676 Ga0068851_100176761 622
336 3300005841 Ga0068863_100006241 Ga0068863_1000062416 622
337 3300006237 Ga0097621_100033429 Ga0097621_1000334291 622
338 3300013296 Ga0157374_10080110 Ga0157374_100801101 622
339 3300025893 Ga0207682_10001581 Ga0207682_1000158111 622
340 3300025903 Ga0207680_10008445 Ga0207680_100084452 622
341 3300025907 Ga0207645_10000077 Ga0207645_1000007745 622
342 3300025940 Ga0207691_10000499 Ga0207691_1000049923 622
343 3300026023 Ga0207677_10014048 Ga0207677_100140484 622
344 3300026067 Ga0207678_10008888 Ga0207678_100088885 622
345 3300026089 Ga0207648_10000589 Ga0207648_1000058917 622
346 3300026118 Ga0207675_100012787 Ga0207675_1000127874 622
347 3300026121 Ga0207683_10000280 Ga0207683_1000028023 622
348 3300009177 Ga0105248_10043658 Ga0105248_100436582 623
349 3300014325 Ga0163163_10000642 Ga0163163_1000064224 623
350 3300014968 Ga0157379_10000555 Ga0157379_1000055520 623
351 3300048906 Ga0496103_0054345 Ga0496103_0054345_283_2205 623
352 3300013104 Ga0157370_10017427 Ga0157370_100174272 624
353 3300005563 Ga0068855_100126830 Ga0068855_1001268302 625
354 3300005577 Ga0068857_100133491 Ga0068857_1001334912 625
355 3300005331 Ga0070670_100045408 Ga0070670_1000454083 627
356 3300025925 Ga0207650_10031052 Ga0207650_100310522 627
357 3300005355 Ga0070671_100018327 Ga0070671_1000183272 629
358 3300009177 Ga0105248_10009560 Ga0105248_100095605 629
359 3300025903 Ga0207680_10003849 Ga0207680_100038492 629
360 3300025931 Ga0207644_10006501 Ga0207644_100065012 629
361 3300025933 Ga0207706_10067063 Ga0207706_100670632 629
362 3300025915 Ga0207693_10049661 Ga0207693_100496611 630
363 3300025913 Ga0207695_10029541 Ga0207695_100295416 631
364 3300005327 Ga0070658_10056038 Ga0070658_100560382 632
365 3300005331 Ga0070670_100028203 Ga0070670_1000282032 632
366 3300005334 Ga0068869_100000241 Ga0068869_10000024121 632
367 3300005344 Ga0070661_100008060 Ga0070661_1000080602 632
368 3300005347 Ga0070668_100001824 Ga0070668_10000182414 632
369 3300005353 Ga0070669_100010823 Ga0070669_1000108236 632
370 3300005367 Ga0070667_100001414 Ga0070667_10000141416 632
371 3300005455 Ga0070663_100018475 Ga0070663_1000184752 632
372 3300005459 Ga0068867_100009237 Ga0068867_1000092371 632
373 3300005616 Ga0068852_100001886 Ga0068852_10000188616 632
374 3300005617 Ga0068859_100001091 Ga0068859_10000109113 632
375 3300005618 Ga0068864_100000584 Ga0068864_10000058424 632
376 3300005719 Ga0068861_100000823 Ga0068861_10000082317 632
377 3300005834 Ga0068851_10000310 Ga0068851_1000031014 632
378 3300005841 Ga0068863_100001050 Ga0068863_1000010506 632
379 3300005843 Ga0068860_100001726 Ga0068860_10000172616 632
380 3300005844 Ga0068862_100002356 Ga0068862_10000235621 632
381 3300006931 Ga0097620_100001092 Ga0097620_10000109213 632
382 3300013296 Ga0157374_10068695 Ga0157374_100686952 632
383 3300025909 Ga0207705_10045156 Ga0207705_100451562 632
384 3300025925 Ga0207650_10047458 Ga0207650_100474582 632
385 3300025942 Ga0207689_10000003 Ga0207689_1000000378 632
386 3300025986 Ga0207658_10004601 Ga0207658_100046017 632
387 3300026035 Ga0207703_10000904 Ga0207703_1000090418 632
388 3300026088 Ga0207641_10002961 Ga0207641_1000296113 632
389 3300026089 Ga0207648_10002126 Ga0207648_1000212622 632
390 3300026095 Ga0207676_10000762 Ga0207676_1000076213 632
391 3300026116 Ga0207674_10019440 Ga0207674_100194404 632
392 3300026142 Ga0207698_10035501 Ga0207698_100355012 632
393 3300028380 Ga0268265_10004994 Ga0268265_100049942 632
394 3300028381 Ga0268264_10007085 Ga0268264_1000708511 632
395 3300001991 JGI24743J22301_10002764 JGI24743J22301_100027642 647
396 3300002076 JGI24749J21850_1002723 JGI24749J21850_10027231 647
397 3300005329 Ga0070683_100004039 Ga0070683_1000040396 647
398 3300005330 Ga0070690_100026835 Ga0070690_1000268352 647
399 3300005338 Ga0068868_100078105 Ga0068868_1000781052 647
400 3300005340 Ga0070689_100009420 Ga0070689_1000094204 647
401 3300005366 Ga0070659_100060471 Ga0070659_1000604712 647
402 3300005438 Ga0070701_10003210 Ga0070701_100032103 647
403 3300005455 Ga0070663_100012142 Ga0070663_1000121423 647
404 3300005457 Ga0070662_100010780 Ga0070662_1000107802 647
405 3300005466 Ga0070685_10003123 Ga0070685_100031232 647
406 3300005535 Ga0070684_100037056 Ga0070684_1000370562 647
407 3300005544 Ga0070686_100006481 Ga0070686_1000064815 647
408 3300005548 Ga0070665_100057008 Ga0070665_1000570081 647
409 3300005564 Ga0070664_100020841 Ga0070664_1000208412 647
410 3300005577 Ga0068857_100040945 Ga0068857_1000409452 647
411 3300005578 Ga0068854_100021837 Ga0068854_1000218375 647
412 3300005618 Ga0068864_100004990 Ga0068864_10000499010 647
413 3300005718 Ga0068866_10000796 Ga0068866_100007967 647
414 3300005840 Ga0068870_10015189 Ga0068870_100151892 647
415 3300005842 Ga0068858_100018130 Ga0068858_1000181302 647
416 3300005844 Ga0068862_100016027 Ga0068862_1000160276 647
417 3300006237 Ga0097621_100140224 Ga0097621_1001402241 647
418 3300006881 Ga0068865_100041746 Ga0068865_1000417462 647
419 3300009094 Ga0111539_10062512 Ga0111539_100625125 647
420 3300009148 Ga0105243_10022296 Ga0105243_100222964 647
421 3300014325 Ga0163163_10012468 Ga0163163_100124682 647
422 3300014326 Ga0157380_10005564 Ga0157380_1000556410 647
423 3300014745 Ga0157377_10005499 Ga0157377_100054992 647
424 3300025315 Ga0207697_10000552 Ga0207697_1000055215 647
425 3300025893 Ga0207682_10000696 Ga0207682_100006963 647
426 3300025907 Ga0207645_10001675 Ga0207645_100016755 647
427 3300025908 Ga0207643_10000579 Ga0207643_1000057913 647
428 3300025918 Ga0207662_10000516 Ga0207662_100005165 647
429 3300025925 Ga0207650_10001400 Ga0207650_100014003 647
430 3300025926 Ga0207659_10017397 Ga0207659_100173973 647
431 3300025933 Ga0207706_10002579 Ga0207706_100025795 647
432 3300025940 Ga0207691_10002929 Ga0207691_100029296 647
433 3300025942 Ga0207689_10001066 Ga0207689_1000106621 647
434 3300025944 Ga0207661_10055828 Ga0207661_100558281 647
435 3300025945 Ga0207679_10082504 Ga0207679_100825042 647
436 3300026035 Ga0207703_10041648 Ga0207703_100416482 647
437 3300026067 Ga0207678_10003679 Ga0207678_1000367914 647
438 3300026075 Ga0207708_10000693 Ga0207708_1000069317 647
439 3300026089 Ga0207648_10001872 Ga0207648_100018725 647
440 3300026121 Ga0207683_10006222 Ga0207683_1000622212 647
441 3300027907 Ga0207428_10014978 Ga0207428_100149787 647
442 3300036401 Ga0373937_0055171 Ga0373937_0055171_1111_3057 647
443 3300048903 Ga0496100_0024257 Ga0496100_0024257_473_2416 647
444 3300048907 Ga0496104_0098455 Ga0496104_0098455_235_2178 647
445 3300048909 Ga0496106_0109941 Ga0496106_0109941_49_1992 647
446 3300048912 Ga0496109_0047622 Ga0496109_0047622_1591_3534 647
447 3300048913 Ga0496110_0061978 Ga0496110_0061978_719_2662 647
448 3300050511 nmdc:mga08y16_34775_c1 nmdc:mga08y16_34775_c1_336_2279 647

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03950

tRNA-synt_1c_C

tRNA synthetases class I (E and Q), anti-codon binding domain

389

489

0.98

PF00749

tRNA-synt_1c

tRNA synthetases class I (E and Q), catalytic domain

67

387

0.95

PF20974

tRNA-synt_1c_C2

tRNA synthetases class I (E and Q), anti-codon binding domain

507

588

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bnz-assembly1.cif.gz_A crystal structure of glutamine-trna ligase /glutaminyl-trna synthetase (glnrs) from pseudomonas aeruginosa 0.9671 62 644
5bnz-assembly1.cif.gz_A crystal structure of glutamine-trna ligase /glutaminyl-trna synthetase (glnrs) from pseudomonas aeruginosa 0.9601 62 644
4jxx-assembly1.cif.gz_A crystal structure of e coli e. coli glutaminyl-trna synthetase bound to trna(gln)(cug) and atp from novel cryostabilization conditions 0.9555 61 642
4jyz-assembly1.cif.gz_A crystal structure of e. coli glutaminyl-trna synthetase bound to atp and native trna(gln) containing the cmnm5s2u34 anticodon wobble base 0.9546 61 642
1qtq-assembly1.cif.gz_A glutaminyl-trna synthetase complexed with trna and an amino acid analog 0.9537 61 641
ID Description Score Start End Superfamily
4p2bA02 Alpha Beta;Alpha-Beta Complex;Glutamyl-tRNA Synthetase; domain 3;Glutamyl-tRNA Synthetase; Domain 3 0.9658 155 262 3.90.800.10
af_O13775_172_516_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9598 79 400 3.40.50.620
af_Q58772_87_395_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9516 80 397 3.40.50.620
4p2bA02 Alpha Beta;Alpha-Beta Complex;Glutamyl-tRNA Synthetase; domain 3;Glutamyl-tRNA Synthetase; Domain 3 0.9474 155 262 3.90.800.10
2hz7A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9464 81 318 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2T4CRZ5-F1-model_v4 Glutamine--tRNA ligase (EC 6.1.1.18) 0.9958 115 295 GO:0004819
GO:0005524
GO:0005829
GO:0006425
AF-A0A536SES4-F1-model_v4 Glutamine--tRNA ligase 0.9955 81 256 GO:0004819
GO:0005524
GO:0005829
GO:0006425
AF-A0A2Z2GMI9-F1-model_v4 Glutaminyl-tRNA synthetase 0.9927 144 287 GO:0004819
GO:0005524
GO:0005829
GO:0006425
AF-A0A351VE97-F1-model_v4 Glutamine--tRNA ligase (EC 6.1.1.18) 0.9923 85 269 GO:0004819
GO:0005524
GO:0005829
GO:0006425
AF-A0A7X4AK46-F1-model_v4 Glutamine--tRNA ligase (EC 6.1.1.18) 0.9914 62 242 GO:0004819
GO:0005524
GO:0005829
GO:0006425

Feature Viewer

pLDDT pTM Quality
82.84 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map