F446263

General Info

Members Datasets Scaffolds Average Seq Length
448 330 896 179

Family's Representative Sequence

Representative Sequence 3300053160|Ga0500633_0002155|Ga0500633_0002155_383_922
Length 179
Sequence MNNTLSELAASIRSIPDYPKPGIIFRDITTLLGNPRAFRRAVDELVQPYAGLKVDKIAGMEARGFILGGAVAHQLSSGFVPIRKKGKLPHETVRIAYSLEYGVEMEMHRDAVQPGEKVILVDDLIATGGTAVGATQLLRQIGAEVVGACFVIDLPDLGGRKKLEDLGVEVHTLVEFAGH

Samples

Sample ID Description Type Environment
1 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
95 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
106 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
107 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
108 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
109 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
110 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
111 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
112 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
113 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
114 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
115 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
116 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
117 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
118 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
119 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
122 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
123 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
146 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
197 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
201 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
202 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
207 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
213 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
214 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
215 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
216 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
217 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
218 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
219 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
220 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
221 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
222 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
223 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
224 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
225 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
226 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
227 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
228 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
229 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
230 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
231 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
232 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
233 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
234 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
235 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
236 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
237 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
238 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
239 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
240 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
241 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
242 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
243 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
244 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
245 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
246 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
247 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
248 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
249 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
250 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
251 2643221651 Afipia sp. Root123D2 Isolate Unclassified
252 2643221733 Bosea sp. Root381 Isolate Unclassified
253 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
254 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
255 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
256 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
257 2738543024 Aminobacter sp. AP02 Isolate Unclassified
258 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
259 2773857925 Microvirga vignae BR3299 Isolate Unclassified
260 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
261 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
262 2802429633 Rhizobium anhuiense J3 Isolate Nodule
263 2802429634 Rhizobium anhuiense S10 Isolate Nodule
264 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
265 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
266 2802429637 Rhizobium anhuiense C15 Isolate Nodule
267 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
268 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
269 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
270 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
271 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
272 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
273 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
274 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
275 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
276 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
277 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
278 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
279 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
280 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
281 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
282 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
283 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
284 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
285 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
286 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
287 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
288 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
289 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
290 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
291 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
292 2904699407
293 2906610324
294 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
295 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
296 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
297 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
298 2922425934
299 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
300 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
301 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
302 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
303 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
304 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
305 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
306 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
307 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
308 2996887358 Rhizobium sp. R711 Isolate Nodule
309 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
310 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
311 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
312 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
313 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
314 8005258706 Rhizobium sp. R693 Isolate Nodule
315 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
316 8005321885 Rhizobium sp. R72 Isolate Nodule
317 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
318 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
319 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
320 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
321 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
322 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
323 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
324 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
325 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
326 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
327 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
328 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
329 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
330 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.03
Metatranscriptomes 0.9
Isolates 26.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.52
Nodule 18.75
Rhizoplane 4.02
Rhizosphere 40.85
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500633_0002155 3300053160 Bacteria 3977
2 JGI25152J39213_1001572 3300002773 Bacteria 9598
3 JGI25150J39212_1010047 3300002774 Bacteria 1775
4 JGI25151J46595_10000215 3300003187 Bacteria 69771
5 JGI25151J46595_10038563 3300003187 Bacteria 1776
6 JGI25406J46586_10045149 3300003203 Bacteria 1519
7 JGI25153J46596_10011725 3300003215 Bacteria 3849
8 JGI25160J50197_1001268 3300003354 Bacteria 12798
9 JGI25161J50226_1004147 3300003374 Bacteria 3105
10 Ga0055526_1009812 3300003771 Bacteria 4549
11 Ga0055524_1008167 3300003775 Bacteria 4371
12 Ga0055524_1066145 3300003775 Bacteria 720
13 Ga0055528_1010347 3300003790 Bacteria 3798
14 Ga0055528_1013364 3300003790 Bacteria 3113
15 Ga0055540_1010505 3300003792 Bacteria 3075
16 Ga0055543_1003814 3300004625 Bacteria 4283
17 Ga0065165_1009120 3300005262 Bacteria 4501
18 Ga0070658_10553003 3300005327 Bacteria 996
19 Ga0070680_100149813 3300005336 Bacteria 1958
20 Ga0068868_100173665 3300005338 Bacteria 1785
21 Ga0070660_100506614 3300005339 Bacteria 1004
22 Ga0070668_100007227 3300005347 Bacteria 8234
23 Ga0070671_100012299 3300005355 Bacteria 6890
24 Ga0070659_100068025 3300005366 Bacteria 2825
25 Ga0070659_100361492 3300005366 Bacteria 1219
26 Ga0070663_100023605 3300005455 Bacteria 4124
27 Ga0070662_100221734 3300005457 Bacteria 1509
28 Ga0070681_10129268 3300005458 Bacteria 2458
29 Ga0070679_100016225 3300005530 Bacteria 7175
30 Ga0070679_100753561 3300005530 Bacteria 917
31 Ga0070665_100285916 3300005548 Bacteria 1651
32 Ga0068855_100228123 3300005563 Bacteria 2086
33 Ga0068854_100905446 3300005578 Bacteria 775
34 Ga0068863_100924315 3300005841 Bacteria 873
35 Ga0068858_100256396 3300005842 Bacteria 1662
36 Ga0081455_10000522 3300005937 Bacteria 49869
37 Ga0081539_10000991 3300005985 Bacteria 52737
38 Ga0075365_10002132 3300006038 Bacteria 9494
39 Ga0075365_10002309 3300006038 Bacteria 9277
40 Ga0075368_10020134 3300006042 Bacteria 2523
41 Ga0075362_10017497 3300006177 Bacteria 2953
42 Ga0075362_10032409 3300006177 Bacteria 2267
43 Ga0075369_10000283 3300006186 Bacteria 15153
44 Ga0075369_10027735 3300006186 Bacteria 2369
45 Ga0075366_10004544 3300006195 Bacteria 7451
46 Ga0075366_10345429 3300006195 Bacteria 913
47 Ga0075370_10025376 3300006353 Bacteria 3278
48 Ga0099826_10002548 3300006948 Bacteria 11839
49 Ga0105240_10640942 3300009093 Bacteria 1166
50 Ga0105245_10646266 3300009098 Bacteria 1088
51 Ga0105248_10087162 3300009177 Bacteria 3513
52 Ga0105238_10469552 3300009551 Bacteria 1257
53 Ga0123341_1000124 3300009765 Bacteria 35033
54 Ga0105239_10652768 3300010375 Bacteria 1202
55 Ga0157373_10024646 3300013100 Bacteria 4357
56 Ga0157373_10806543 3300013100 Bacteria 692
57 Ga0157370_10939558 3300013104 Bacteria 784
58 Ga0163162_11202338 3300013306 Bacteria 860
59 Ga0157372_10388957 3300013307 Bacteria 1625
60 Ga0163163_10604927 3300014325 Bacteria 1159
61 Ga0157377_10532819 3300014745 Bacteria 826
62 Ga0213876_10000565 3300021384 Bacteria 27605
63 Ga0213876_10002161 3300021384 Bacteria 11622
64 Ga0207425_1014851 3300025245 Bacteria 1762
65 Ga0207425_1018095 3300025245 Bacteria 1535
66 Ga0209129_1001066 3300025258 Bacteria 16207
67 Ga0209129_1001350 3300025258 Bacteria 13855
68 Ga0209233_1019276 3300025261 Bacteria 1817
69 Ga0209673_1001610 3300025273 Bacteria 19758
70 Ga0209673_1004326 3300025273 Bacteria 7663
71 Ga0209673_1010661 3300025273 Bacteria 3854
72 Ga0209025_1000091 3300025294 Bacteria 250401
73 Ga0209025_1000213 3300025294 Bacteria 139002
74 Ga0209025_1000835 3300025294 Bacteria 48894
75 Ga0209025_1010603 3300025294 Bacteria 6219
76 Ga0209025_1035038 3300025294 Bacteria 2276
77 Ga0209025_1040242 3300025294 Bacteria 2025
78 Ga0209564_1001272 3300025295 Bacteria 27752
79 Ga0209564_1004592 3300025295 Bacteria 8344
80 Ga0209758_1082406 3300025297 Bacteria 968
81 Ga0209256_1000381 3300025299 Bacteria 70973
82 Ga0209256_1010267 3300025299 Bacteria 3949
83 Ga0207426_1000218 3300025302 Bacteria 135865
84 Ga0207426_1002039 3300025302 Bacteria 14113
85 Ga0209051_1002719 3300025303 Bacteria 12290
86 Ga0209051_1015576 3300025303 Bacteria 3488
87 Ga0209051_1035204 3300025303 Bacteria 1866
88 Ga0207647_10447616 3300025904 Bacteria 724
89 Ga0207705_10593551 3300025909 Bacteria 861
90 Ga0207707_10120479 3300025912 Bacteria 2294
91 Ga0207695_10115517 3300025913 Bacteria 2658
92 Ga0207695_10604563 3300025913 Bacteria 978
93 Ga0207660_10055773 3300025917 Bacteria 2825
94 Ga0207652_10041096 3300025921 Bacteria 3929
95 Ga0207687_10516883 3300025927 Bacteria 998
96 Ga0207690_10046147 3300025932 Bacteria 2884
97 Ga0207690_10604793 3300025932 Bacteria 895
98 Ga0207706_10589046 3300025933 Bacteria 956
99 Ga0207686_10019462 3300025934 Bacteria 3863
100 Ga0207711_10454368 3300025941 Bacteria 1192
101 Ga0207667_10318236 3300025949 Bacteria 1589
102 Ga0207712_10123215 3300025961 Bacteria 1965
103 Ga0207668_10039513 3300025972 Bacteria 3177
104 Ga0207668_10679899 3300025972 Bacteria 903
105 Ga0207677_10896016 3300026023 Bacteria 799
106 Ga0207703_10876282 3300026035 Bacteria 859
107 Ga0207639_11038043 3300026041 Bacteria 768
108 Ga0207678_10038331 3300026067 Bacteria 4164
109 Ga0209282_1001825 3300027666 Bacteria 11962
110 Ga0268266_10590458 3300028379 Bacteria 1066
111 Ga0307515_10004087 3300028794 Bacteria 30420
112 Ga0307515_10196827 3300028794 Bacteria 1905
113 Ga0265328_10000104 3300031239 Bacteria 41156
114 Ga0265328_10010733 3300031239 Bacteria 3679
115 Ga0265329_10021959 3300031242 Bacteria 2138
116 Ga0265331_10002828 3300031250 Bacteria 11505
117 Ga0265331_10002838 3300031250 Bacteria 11482
118 Ga0265327_10001631 3300031251 Bacteria 27036
119 Ga0265327_10040090 3300031251 Bacteria 2536
120 Ga0265316_10008481 3300031344 Bacteria 9531
121 Ga0265316_10062839 3300031344 Bacteria 2881
122 Ga0307513_10003237 3300031456 Bacteria 22198
123 Ga0307405_10057755 3300031731 Bacteria 2439
124 Ga0307410_10344593 3300031852 Bacteria 1189
125 Ga0307410_10365077 3300031852 Bacteria 1157
126 Ga0307412_10066388 3300031911 Bacteria 2445
127 Ga0307415_100274196 3300032126 Bacteria 1383
128 Ga0316583_10171452 3300032133 Bacteria 755
129 Ga0307510_10000009 3300033180 Bacteria 409702
130 Ga0316574_0163621 3300035398 Unclassified 1433
131 Ga0373927_0000307 3300035695 Bacteria 38435
132 Ga0373925_0004963 3300037068 Bacteria 9999
133 Ga0436364_0640138 3300037853 Bacteria 2229
134 Ga0395901_0688956 3300038443 Bacteria 1021
135 Ga0436365_0537031 3300039437 Bacteria 38995
136 Ga0436365_1687427 3300039437 Bacteria 16468
137 Ga0436360_0657226 3300039438 Bacteria 753
138 Ga0436361_0179031 3300039447 Bacteria 618
139 Ga0436361_0908039 3300039447 Bacteria 1120
140 Ga0436361_0924504 3300039447 Bacteria 7075
141 Ga0436361_0924840 3300039447 Bacteria 1077
142 Ga0436363_0441808 3300039450 Bacteria 780
143 Ga0451787_503319 3300041441 Bacteria 2289
144 Ga0451798_0680765 3300041458 Bacteria 1654
145 Ga0451833_0951010 3300041491 Bacteria 1638
146 Ga0451835_0189764 3300041492 Bacteria 3530
147 Ga0451839_0720158 3300041496 Bacteria 3067
148 Ga0451841_1166339 3300041498 Bacteria 1784
149 Ga0451845_0149389 3300041501 Bacteria 3208
150 Ga0451845_0762062 3300041501 Bacteria 666
151 Ga0451846_10437 3300041502 Bacteria 1623
152 Ga0451847_0062588 3300041503 Bacteria 3688
153 Ga0451849_1020799 3300041505 Bacteria 2360
154 Ga0451850_45105 3300041506 Bacteria 1075
155 Ga0451851_0598345 3300041507 Bacteria 3537
156 Ga0451851_1007515 3300041507 Bacteria 2026
157 Ga0451843_0052284 3300041509 Bacteria 1189
158 Ga0451854_10755 3300041510 Bacteria 3791
159 Ga0451855_1078906 3300041511 Bacteria 669
160 Ga0451855_1289819 3300041511 Bacteria 642
161 Ga0451853_0844797 3300041512 Bacteria 2506
162 Ga0452268_51541 3300041907 Bacteria 1764
163 Ga0439449_0024199 3300042007 Bacteria 2271
164 Ga0495590_0113555 3300046457 Bacteria 968
165 Ga0495650_0079493 3300046471 Bacteria 1268
166 Ga0495605_0118328 3300046474 Bacteria 1203
167 Ga0495585_0013524 3300046492 Bacteria 4771
168 Ga0495607_0050290 3300046501 Bacteria 2427
169 Ga0495583_0108541 3300046506 Bacteria 1178
170 Ga0495606_0031693 3300046507 Bacteria 3671
171 Ga0495606_0096946 3300046507 Bacteria 1803
172 Ga0495610_0009214 3300046512 Bacteria 6265
173 Ga0495610_0027453 3300046512 Bacteria 3024
174 Ga0495616_0209135 3300046513 Bacteria 854
175 Ga0495620_0009406 3300046515 Bacteria 5199
176 Ga0495620_0032395 3300046515 Bacteria 2382
177 Ga0495632_0021998 3300046519 Bacteria 3426
178 Ga0495643_0051704 3300046522 Bacteria 2208
179 Ga0495643_0092784 3300046522 Bacteria 1556
180 Ga0495643_0331047 3300046522 Bacteria 686
181 Ga0495648_0046686 3300046524 Bacteria 2682
182 Ga0495648_0058891 3300046524 Bacteria 2294
183 Ga0495597_0015006 3300046542 Bacteria 3676
184 Ga0495633_0026684 3300046558 Bacteria 2831
185 Ga0495667_0469477 3300046559 Bacteria 790
186 Ga0495668_0021991 3300046616 Bacteria 3649
187 Ga0495625_0026239 3300046660 Bacteria 4404
188 Ga0495649_0170427 3300046694 Bacteria 1139
189 Ga0495660_0040952 3300046810 Bacteria 2566
190 Ga0495687_015981 3300047443 Bacteria 3790
191 Ga0495686_0000049 3300047472 Bacteria 275004
192 Ga0495686_0028822 3300047472 Bacteria 3614
193 Ga0495615_0133784 3300048090 Bacteria 727
194 Ga0495626_0106151 3300048091 Bacteria 1220
195 Ga0496101_0282530 3300048904 Bacteria 1297
196 Ga0496102_0021338 3300048905 Bacteria 5728
197 Ga0496102_0119329 3300048905 Bacteria 2462
198 Ga0496103_0162999 3300048906 Bacteria 1430
199 Ga0496104_0073442 3300048907 Bacteria 3254
200 Ga0496105_0038985 3300048908 Bacteria 3915
201 Ga0496106_0001054 3300048909 Bacteria 20308
202 Ga0496107_0546899 3300048910 Bacteria 858
203 Ga0496108_0298797 3300048911 Bacteria 1402
204 Ga0496110_0082662 3300048913 Bacteria 2864
205 Ga0496110_0321313 3300048913 Bacteria 1410
206 Ga0496111_0132449 3300048914 Bacteria 1845
207 Ga0496113_0286931 3300048916 Bacteria 1316
208 Ga0496116_0012537 3300048919 Bacteria 6916
209 Ga0496116_0075850 3300048919 Bacteria 2108
210 Ga0496116_0127118 3300048919 Bacteria 1462
211 Ga0496117_0000099 3300048920 Bacteria 194987
212 Ga0496117_0049086 3300048920 Bacteria 3006
213 Ga0496117_0078105 3300048920 Bacteria 2187
214 Ga0496118_0000105 3300048921 Bacteria 156739
215 Ga0496118_0105172 3300048921 Bacteria 1893
216 Ga0496118_0180316 3300048921 Bacteria 1277
217 Ga0496118_0196355 3300048921 Bacteria 1201
218 Ga0496119_0002251 3300048922 Bacteria 21469
219 Ga0496119_0046092 3300048922 Bacteria 2726
220 Ga0496119_0216096 3300048922 Bacteria 983
221 Ga0496119_0259098 3300048922 Bacteria 873
222 Ga0496120_0001128 3300048923 Bacteria 34511
223 Ga0496120_0009615 3300048923 Bacteria 6832
224 Ga0496120_0043145 3300048923 Bacteria 2629
225 Ga0496120_0048750 3300048923 Bacteria 2436
226 Ga0496120_0067988 3300048923 Bacteria 1966
227 Ga0496121_0000003 3300048924 Bacteria 1191431
228 Ga0496121_0010745 3300048924 Bacteria 10262
229 Ga0496121_0040516 3300048924 Bacteria 4085
230 Ga0496121_0354298 3300048924 Bacteria 976
231 Ga0496122_0043254 3300048925 Bacteria 3531
232 Ga0496122_0161664 3300048925 Bacteria 1364
233 Ga0496123_0040280 3300048926 Bacteria 3256
234 Ga0496124_0000252 3300048927 Bacteria 103596
235 Ga0496124_0025625 3300048927 Bacteria 5338
236 Ga0496124_0128285 3300048927 Bacteria 2018
237 Ga0496124_0136606 3300048927 Bacteria 1940
238 Ga0496125_0000039 3300048928 Bacteria 318665
239 Ga0496125_0007051 3300048928 Bacteria 12008
240 Ga0496125_0058730 3300048928 Bacteria 3105
241 Ga0496125_0378356 3300048928 Bacteria 835
242 Ga0496126_0022504 3300048929 Bacteria 6131
243 Ga0496126_0050620 3300048929 Bacteria 3784
244 Ga0496126_0110683 3300048929 Bacteria 2392
245 Ga0496126_0147095 3300048929 Bacteria 2022
246 Ga0501031_0021797 3300049568 Bacteria 4175
247 Ga0501032_0000024 3300049569 Bacteria 143876
248 Ga0501032_0063577 3300049569 Bacteria 2471
249 Ga0501033_0000391 3300049570 Bacteria 42136
250 Ga0501033_0400770 3300049570 Bacteria 957
251 Ga0501034_0000140 3300049571 Bacteria 134996
252 Ga0501034_0016643 3300049571 Bacteria 7539
253 Ga0501034_0047328 3300049571 Bacteria 4343
254 Ga0501034_0188937 3300049571 Bacteria 2023
255 Ga0501036_0000443 3300049572 Bacteria 29542
256 Ga0501036_1015594 3300049572 Bacteria 679
257 Ga0501037_0000024 3300049573 Bacteria 146046
258 Ga0501037_0161576 3300049573 Bacteria 1597
259 Ga0501038_0000064 3300049574 Bacteria 87975
260 Ga0501038_0042836 3300049574 Bacteria 3941
261 Ga0501038_0272641 3300049574 Bacteria 1334
262 Ga0501039_0000017 3300049575 Bacteria 189412
263 Ga0501043_0000050 3300049579 Bacteria 107465
264 Ga0501043_0209467 3300049579 Bacteria 1511
265 Ga0501043_0210972 3300049579 Bacteria 1505
266 Ga0501043_0339274 3300049579 Bacteria 1143
267 Ga0501046_0049929 3300049580 Bacteria 3307
268 Ga0501046_0063945 3300049580 Bacteria 2873
269 Ga0501047_0021340 3300049581 Bacteria 6217
270 Ga0501047_0136902 3300049581 Bacteria 2329
271 Ga0501047_0152468 3300049581 Bacteria 2186
272 Ga0501047_0215573 3300049581 Bacteria 1777
273 Ga0501048_0686626 3300049582 Bacteria 735
274 Ga0501069_0015650 3300049585 Bacteria 4066
275 Ga0501069_0224927 3300049585 Bacteria 1091
276 Ga0501070_0003303 3300049586 Bacteria 14003
277 Ga0501070_0039544 3300049586 Bacteria 3934
278 Ga0501070_0054429 3300049586 Bacteria 3318
279 Ga0501070_0058209 3300049586 Bacteria 3203
280 Ga0501070_0073457 3300049586 Bacteria 2830
281 Ga0501071_0659020 3300049587 Bacteria 805
282 Ga0501072_0125924 3300049588 Bacteria 2041
283 Ga0501074_0128894 3300049590 Bacteria 1810
284 Ga0501074_0901985 3300049590 Bacteria 622
285 Ga0501080_0052088 3300049742 Bacteria 3810
286 Ga0501080_0123463 3300049742 Bacteria 2399
287 Ga0501080_0148609 3300049742 Bacteria 2166
288 Ga0501080_0840194 3300049742 Bacteria 803
289 Ga0501083_0042296 3300049744 Bacteria 3089
290 Ga0501035_0000021 3300049822 Bacteria 209085
291 Ga0501035_0004020 3300049822 Bacteria 14026
292 Ga0501035_0019720 3300049822 Bacteria 6195
293 Ga0501035_0142303 3300049822 Bacteria 2085
294 Ga0501035_0208599 3300049822 Bacteria 1672
295 Ga0501035_0550147 3300049822 Bacteria 945
296 Ga0501044_0019749 3300049823 Bacteria 7199
297 Ga0501044_0062696 3300049823 Bacteria 3799
298 Ga0501044_0067592 3300049823 Bacteria 3641
299 Ga0501044_0211650 3300049823 Bacteria 1893
300 Ga0501044_0324106 3300049823 Bacteria 1464
301 Ga0501044_0401336 3300049823 Bacteria 1283
302 nmdc:mga03683_166798_c1 3300050489 Bacteria 999
303 nmdc:mga03683_7622_c1 3300050489 Bacteria 3767
304 nmdc:mga00v17_720454_c1 3300050491 Bacteria 639
305 nmdc:mga0yw44_1036_c1 3300050492 Bacteria 10672
306 nmdc:mga0k408_4421_c1 3300050493 Bacteria 7459
307 nmdc:mga06z11_18599_c1 3300050494 Bacteria 3177
308 nmdc:mga04h51_17331_c1 3300050495 Bacteria 2105
309 nmdc:mga0sz30_408372_c1 3300050516 Bacteria 608
310 Ga0500578_0308374 3300053086 Bacteria 936
311 Ga0500643_001875 3300053087 Bacteria 11446
312 Ga0500583_0017637 3300053092 Bacteria 2882
313 Ga0500651_0397263 3300053093 Bacteria 775
314 Ga0500569_002466 3300053109 Bacteria 3647
315 Ga0500608_096943 3300053122 Bacteria 1371
316 Ga0500658_0000715 3300053134 Bacteria 13705
317 Ga0500659_0093707 3300053135 Bacteria 1564
318 Ga0500568_0000128 3300053139 Bacteria 68634
319 Ga0500568_0002244 3300053139 Bacteria 11561
320 Ga0500568_0013913 3300053139 Bacteria 3652
321 Ga0500590_183733 3300053148 Bacteria 905
322 Ga0500604_0013742 3300053151 Bacteria 2197
323 Ga0500616_0000577 3300053153 Bacteria 44621
324 Ga0500616_0114635 3300053153 Bacteria 1296
325 Ga0500636_0007042 3300053177 Bacteria 6485
326 Ga0501084_0058524 3300054114 Bacteria 3225
327 Ga0501084_0229038 3300054114 Bacteria 1568
328 Ga0501082_0025974 3300060353 Bacteria 5047
329 Ga0501082_0783567 3300060353 Bacteria 834
330 2509077581 2508501114 Bacteria 7082538
331 2509148793 2508501128 Bacteria 8613869
332 2509391850 2509276021 Bacteria 7634384
333 2509447294 2509276033 Bacteria 7180565
334 2510895567 2510461076 Bacteria 8618824
335 2511182522 2510917028 Bacteria 6185411
336 2513567791 2513237084 Bacteria 7231967
337 2513577129 2513237085 Bacteria 7695351
338 2513599948 2513237088 Bacteria 6927906
339 2513633201 2513237093 Bacteria 7545552
340 2513655763 2513237096 Bacteria 8722461
341 2513707796 2513237103 Bacteria 7647401
342 2513856743 2513237137 Bacteria 9558895
343 2513865874 2513237138 Bacteria 7368160
344 2513917324 2513237145 Bacteria 8979722
345 2513925228 2513237146 Bacteria 7166346
346 2514018120 2513237162 Bacteria 7468464
347 2515636811 2515154113 Bacteria 7807172
348 2515646323 2515154114 Bacteria 7848616
349 2515655161 2515154116 Bacteria 7552979
350 2515739662 2515154134 Bacteria 7220242
351 2517036900 2516653077 Bacteria 7555578
352 2517077259 2516653085 Bacteria 7346596
353 2517096017 2517093000 Bacteria 7412387
354 2517895390 2517572143 Bacteria 9484767
355 2524540508 2524023228 Bacteria 10118060
356 2535517057 2534681796 Bacteria 7146037
357 2585202042 2582581294 Bacteria 6626667
358 2585258323 2582581304 Bacteria 5831370
359 2585400907 2582581867 Bacteria 7184437
360 2585524686 2585427526 Bacteria 7258840
361 2585538374 2585427528 Bacteria 6842387
362 2585822191 2585427590 Bacteria 6824633
363 2585836327 2585427593 Bacteria 7141551
364 2585843412 2585427594 Bacteria 6180594
365 2599417135 2599185170 Bacteria 7295545
366 2601609954 2600255279 Bacteria 5605316
367 2601746729 2600255308 Bacteria 5611129
368 2644242518 2643221643 Bacteria 5749658
369 2644289443 2643221651 Bacteria 4798932
370 2644731753 2643221733 Bacteria 5690728
371 2671120307 2667528175 Bacteria 7532676
372 2715500949 2713897090 Bacteria 3353799
373 2725951422 2724679232 Bacteria 7646494
374 2739033015 2738541333 Bacteria 7106503
375 2739310080 2738543024 Bacteria 5603683
376 2766066057 2765235942 Bacteria 7445910
377 2774870396 2773857925 Bacteria 6472445
378 2776914129 2775507049 Bacteria 6284736
379 2793315912 2791355259 Bacteria 7254731
380 2806045154 2802429633 Bacteria 7341974
381 2806050051 2802429634 Bacteria 7083200
382 2806056889 2802429635 Bacteria 7650140
383 2806064270 2802429636 Bacteria 7597525
384 2806071538 2802429637 Bacteria 7067217
385 2838038658 2838035591 Bacteria 7166484
386 2838661420 2838661181 Bacteria 7385261
387 2838686868 2838686498 Bacteria 7807632
388 2838730174 2838729681 Bacteria 7400765
389 2838742811 2838742623 Bacteria 7396178
390 2841852314 2841851746 Bacteria 7532261
391 2842113082 2842110456 Bacteria 7656360
392 2842158228 2842156927 Bacteria 6894975
393 2842168613 2842163707 Bacteria 6916235
394 2842181848 2842180545 Bacteria 6888678
395 2842218126 2842217011 Bacteria 7497767
396 2842230101 2842229732 Bacteria 7475766
397 2842243990 2842243621 Bacteria 7421798
398 2842257925 2842257432 Bacteria 7401195
399 2842271594 2842271015 Bacteria 7807131
400 2842305225 2842304105 Bacteria 7023636
401 2842370217 2842363717 Bacteria 6844742
402 2844458165 2844454524 Bacteria 7952546
403 2857517241 2857516855 Bacteria 7787325
404 2885378945 2885374607 Bacteria 8927485
405 2894233840 2894232714 Bacteria 8834183
406 2899276172 2899275550 Bacteria 3958688
407 2899795926 2899792073 Bacteria 4926588
408 2903759070 2903748898 Bacteria 9972761
409 2904698732 2904690495 Bacteria 9412302
410 2904710851
411 2906616000
412 2906639087 2906635258 Bacteria 8601019
413 2906665232 2906660503 Bacteria 8595048
414 2908758972 2908756301 Bacteria 8864324
415 2917557308 2917554339 Bacteria 4987857
416 2922432032
417 2923559282 2923556063 Bacteria 6793593
418 2929140989 2929138655 Bacteria 5810547
419 2933571032 2933570622 Bacteria 7023390
420 2933588861 2933586486 Bacteria 7667493
421 2933596466 2933594066 Bacteria 5594265
422 2935901775 2935901341 Bacteria 7341747
423 2936371857 2936367885 Bacteria 7324495
424 2936379691 2936375103 Bacteria 6652732
425 2937844313 2937843397 Bacteria 5256375
426 2996892862 2996887358 Bacteria 5795980
427 3005476945 3005474847 Bacteria 9259049
428 639649358 639633055 Bacteria 7751309
429 643604833 643348564 Bacteria 8839022
430 8002061334 8002060224 Bacteria 4026565
431 8002289344 8002285264 Bacteria 6717907
432 8005259371 8005258706 Bacteria 6184835
433 8005309572 8005307578 Bacteria 7395396
434 8005327389 8005321885 Bacteria 5795980
435 8005381111 8005376324 Bacteria 6590079
436 8005545871 8005542996 Bacteria 7077758
437 8005556840 8005556819 Bacteria 6908598
438 8005568178 8005563573 Bacteria 7153261
439 8005573283 8005570704 Bacteria 6957481
440 8006934474 8006933436 Bacteria 10410654
441 8006974444 8006973647 Bacteria 10679141
442 8018164391 8018163183 Bacteria 7277977
443 8019564208 8019555841 Bacteria 9642137
444 8023682988 8023680758 Bacteria 7729763
445 8024482684 8024479707 Bacteria 6954785
446 8055432437 8055431914 Bacteria 4551896
447 8056690342 8056689827 Bacteria 6712655
448 8057878499 8057874678 Bacteria 7494653
449 Ga0500633_0002155
450 JGI25152J39213_1001572
451 JGI25150J39212_1010047
452 JGI25151J46595_10000215
453 JGI25151J46595_10038563
454 JGI25406J46586_10045149
455 JGI25153J46596_10011725
456 JGI25160J50197_1001268
457 JGI25161J50226_1004147
458 Ga0055526_1009812
459 Ga0055524_1008167
460 Ga0055524_1066145
461 Ga0055528_1010347
462 Ga0055528_1013364
463 Ga0055540_1010505
464 Ga0055543_1003814
465 Ga0065165_1009120
466 Ga0070658_10553003
467 Ga0070680_100149813
468 Ga0068868_100173665
469 Ga0070660_100506614
470 Ga0070668_100007227
471 Ga0070671_100012299
472 Ga0070659_100068025
473 Ga0070659_100361492
474 Ga0070663_100023605
475 Ga0070662_100221734
476 Ga0070681_10129268
477 Ga0070679_100016225
478 Ga0070679_100753561
479 Ga0070665_100285916
480 Ga0068855_100228123
481 Ga0068854_100905446
482 Ga0068863_100924315
483 Ga0068858_100256396
484 Ga0081455_10000522
485 Ga0081539_10000991
486 Ga0075365_10002132
487 Ga0075365_10002309
488 Ga0075368_10020134
489 Ga0075362_10017497
490 Ga0075362_10032409
491 Ga0075369_10000283
492 Ga0075369_10027735
493 Ga0075366_10004544
494 Ga0075366_10345429
495 Ga0075370_10025376
496 Ga0099826_10002548
497 Ga0105240_10640942
498 Ga0105245_10646266
499 Ga0105248_10087162
500 Ga0105238_10469552
501 Ga0123341_1000124
502 Ga0105239_10652768
503 Ga0157373_10024646
504 Ga0157373_10806543
505 Ga0157370_10939558
506 Ga0163162_11202338
507 Ga0157372_10388957
508 Ga0163163_10604927
509 Ga0157377_10532819
510 Ga0213876_10000565
511 Ga0213876_10002161
512 Ga0207425_1014851
513 Ga0207425_1018095
514 Ga0209129_1001066
515 Ga0209129_1001350
516 Ga0209233_1019276
517 Ga0209673_1001610
518 Ga0209673_1004326
519 Ga0209673_1010661
520 Ga0209025_1000091
521 Ga0209025_1000213
522 Ga0209025_1000835
523 Ga0209025_1010603
524 Ga0209025_1035038
525 Ga0209025_1040242
526 Ga0209564_1001272
527 Ga0209564_1004592
528 Ga0209758_1082406
529 Ga0209256_1000381
530 Ga0209256_1010267
531 Ga0207426_1000218
532 Ga0207426_1002039
533 Ga0209051_1002719
534 Ga0209051_1015576
535 Ga0209051_1035204
536 Ga0207647_10447616
537 Ga0207705_10593551
538 Ga0207707_10120479
539 Ga0207695_10115517
540 Ga0207695_10604563
541 Ga0207660_10055773
542 Ga0207652_10041096
543 Ga0207687_10516883
544 Ga0207690_10046147
545 Ga0207690_10604793
546 Ga0207706_10589046
547 Ga0207686_10019462
548 Ga0207711_10454368
549 Ga0207667_10318236
550 Ga0207712_10123215
551 Ga0207668_10039513
552 Ga0207668_10679899
553 Ga0207677_10896016
554 Ga0207703_10876282
555 Ga0207639_11038043
556 Ga0207678_10038331
557 Ga0209282_1001825
558 Ga0268266_10590458
559 Ga0307515_10004087
560 Ga0307515_10196827
561 Ga0265328_10000104
562 Ga0265328_10010733
563 Ga0265329_10021959
564 Ga0265331_10002828
565 Ga0265331_10002838
566 Ga0265327_10001631
567 Ga0265327_10040090
568 Ga0265316_10008481
569 Ga0265316_10062839
570 Ga0307513_10003237
571 Ga0307405_10057755
572 Ga0307410_10344593
573 Ga0307410_10365077
574 Ga0307412_10066388
575 Ga0307415_100274196
576 Ga0316583_10171452
577 Ga0307510_10000009
578 Ga0316574_0163621
579 Ga0373927_0000307
580 Ga0373925_0004963
581 Ga0436364_0640138
582 Ga0395901_0688956
583 Ga0436365_0537031
584 Ga0436365_1687427
585 Ga0436360_0657226
586 Ga0436361_0179031
587 Ga0436361_0908039
588 Ga0436361_0924504
589 Ga0436361_0924840
590 Ga0436363_0441808
591 Ga0451787_503319
592 Ga0451798_0680765
593 Ga0451833_0951010
594 Ga0451835_0189764
595 Ga0451839_0720158
596 Ga0451841_1166339
597 Ga0451845_0149389
598 Ga0451845_0762062
599 Ga0451846_10437
600 Ga0451847_0062588
601 Ga0451849_1020799
602 Ga0451850_45105
603 Ga0451851_0598345
604 Ga0451851_1007515
605 Ga0451843_0052284
606 Ga0451854_10755
607 Ga0451855_1078906
608 Ga0451855_1289819
609 Ga0451853_0844797
610 Ga0452268_51541
611 Ga0439449_0024199
612 Ga0495590_0113555
613 Ga0495650_0079493
614 Ga0495605_0118328
615 Ga0495585_0013524
616 Ga0495607_0050290
617 Ga0495583_0108541
618 Ga0495606_0031693
619 Ga0495606_0096946
620 Ga0495610_0009214
621 Ga0495610_0027453
622 Ga0495616_0209135
623 Ga0495620_0009406
624 Ga0495620_0032395
625 Ga0495632_0021998
626 Ga0495643_0051704
627 Ga0495643_0092784
628 Ga0495643_0331047
629 Ga0495648_0046686
630 Ga0495648_0058891
631 Ga0495597_0015006
632 Ga0495633_0026684
633 Ga0495667_0469477
634 Ga0495668_0021991
635 Ga0495625_0026239
636 Ga0495649_0170427
637 Ga0495660_0040952
638 Ga0495687_015981
639 Ga0495686_0000049
640 Ga0495686_0028822
641 Ga0495615_0133784
642 Ga0495626_0106151
643 Ga0496101_0282530
644 Ga0496102_0021338
645 Ga0496102_0119329
646 Ga0496103_0162999
647 Ga0496104_0073442
648 Ga0496105_0038985
649 Ga0496106_0001054
650 Ga0496107_0546899
651 Ga0496108_0298797
652 Ga0496110_0082662
653 Ga0496110_0321313
654 Ga0496111_0132449
655 Ga0496113_0286931
656 Ga0496116_0012537
657 Ga0496116_0075850
658 Ga0496116_0127118
659 Ga0496117_0000099
660 Ga0496117_0049086
661 Ga0496117_0078105
662 Ga0496118_0000105
663 Ga0496118_0105172
664 Ga0496118_0180316
665 Ga0496118_0196355
666 Ga0496119_0002251
667 Ga0496119_0046092
668 Ga0496119_0216096
669 Ga0496119_0259098
670 Ga0496120_0001128
671 Ga0496120_0009615
672 Ga0496120_0043145
673 Ga0496120_0048750
674 Ga0496120_0067988
675 Ga0496121_0000003
676 Ga0496121_0010745
677 Ga0496121_0040516
678 Ga0496121_0354298
679 Ga0496122_0043254
680 Ga0496122_0161664
681 Ga0496123_0040280
682 Ga0496124_0000252
683 Ga0496124_0025625
684 Ga0496124_0128285
685 Ga0496124_0136606
686 Ga0496125_0000039
687 Ga0496125_0007051
688 Ga0496125_0058730
689 Ga0496125_0378356
690 Ga0496126_0022504
691 Ga0496126_0050620
692 Ga0496126_0110683
693 Ga0496126_0147095
694 Ga0501031_0021797
695 Ga0501032_0000024
696 Ga0501032_0063577
697 Ga0501033_0000391
698 Ga0501033_0400770
699 Ga0501034_0000140
700 Ga0501034_0016643
701 Ga0501034_0047328
702 Ga0501034_0188937
703 Ga0501036_0000443
704 Ga0501036_1015594
705 Ga0501037_0000024
706 Ga0501037_0161576
707 Ga0501038_0000064
708 Ga0501038_0042836
709 Ga0501038_0272641
710 Ga0501039_0000017
711 Ga0501043_0000050
712 Ga0501043_0209467
713 Ga0501043_0210972
714 Ga0501043_0339274
715 Ga0501046_0049929
716 Ga0501046_0063945
717 Ga0501047_0021340
718 Ga0501047_0136902
719 Ga0501047_0152468
720 Ga0501047_0215573
721 Ga0501048_0686626
722 Ga0501069_0015650
723 Ga0501069_0224927
724 Ga0501070_0003303
725 Ga0501070_0039544
726 Ga0501070_0054429
727 Ga0501070_0058209
728 Ga0501070_0073457
729 Ga0501071_0659020
730 Ga0501072_0125924
731 Ga0501074_0128894
732 Ga0501074_0901985
733 Ga0501080_0052088
734 Ga0501080_0123463
735 Ga0501080_0148609
736 Ga0501080_0840194
737 Ga0501083_0042296
738 Ga0501035_0000021
739 Ga0501035_0004020
740 Ga0501035_0019720
741 Ga0501035_0142303
742 Ga0501035_0208599
743 Ga0501035_0550147
744 Ga0501044_0019749
745 Ga0501044_0062696
746 Ga0501044_0067592
747 Ga0501044_0211650
748 Ga0501044_0324106
749 Ga0501044_0401336
750 nmdc:mga03683_166798_c1
751 nmdc:mga03683_7622_c1
752 nmdc:mga00v17_720454_c1
753 nmdc:mga0yw44_1036_c1
754 nmdc:mga0k408_4421_c1
755 nmdc:mga06z11_18599_c1
756 nmdc:mga04h51_17331_c1
757 nmdc:mga0sz30_408372_c1
758 Ga0500578_0308374
759 Ga0500643_001875
760 Ga0500583_0017637
761 Ga0500651_0397263
762 Ga0500569_002466
763 Ga0500608_096943
764 Ga0500658_0000715
765 Ga0500659_0093707
766 Ga0500568_0000128
767 Ga0500568_0002244
768 Ga0500568_0013913
769 Ga0500590_183733
770 Ga0500604_0013742
771 Ga0500616_0000577
772 Ga0500616_0114635
773 Ga0500636_0007042
774 Ga0501084_0058524
775 Ga0501084_0229038
776 Ga0501082_0025974
777 Ga0501082_0783567
778 2509077581
779 2509148793
780 2509391850
781 2509447294
782 2510895567
783 2511182522
784 2513567791
785 2513577129
786 2513599948
787 2513633201
788 2513655763
789 2513707796
790 2513856743
791 2513865874
792 2513917324
793 2513925228
794 2514018120
795 2515636811
796 2515646323
797 2515655161
798 2515739662
799 2517036900
800 2517077259
801 2517096017
802 2517895390
803 2524540508
804 2535517057
805 2585202042
806 2585258323
807 2585400907
808 2585524686
809 2585538374
810 2585822191
811 2585836327
812 2585843412
813 2599417135
814 2601609954
815 2601746729
816 2644242518
817 2644289443
818 2644731753
819 2671120307
820 2715500949
821 2725951422
822 2739033015
823 2739310080
824 2766066057
825 2774870396
826 2776914129
827 2793315912
828 2806045154
829 2806050051
830 2806056889
831 2806064270
832 2806071538
833 2838038658
834 2838661420
835 2838686868
836 2838730174
837 2838742811
838 2841852314
839 2842113082
840 2842158228
841 2842168613
842 2842181848
843 2842218126
844 2842230101
845 2842243990
846 2842257925
847 2842271594
848 2842305225
849 2842370217
850 2844458165
851 2857517241
852 2885378945
853 2894233840
854 2899276172
855 2899795926
856 2903759070
857 2904698732
858 2904710851
859 2906616000
860 2906639087
861 2906665232
862 2908758972
863 2917557308
864 2922432032
865 2923559282
866 2929140989
867 2933571032
868 2933588861
869 2933596466
870 2935901775
871 2936371857
872 2936379691
873 2937844313
874 2996892862
875 3005476945
876 639649358
877 643604833
878 8002061334
879 8002289344
880 8005259371
881 8005309572
882 8005327389
883 8005381111
884 8005545871
885 8005556840
886 8005568178
887 8005573283
888 8006934474
889 8006974444
890 8018164391
891 8019564208
892 8023682988
893 8024482684
894 8055432437
895 8056690342
896 8057878499

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

27

175

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y4a-assembly1.cif.gz_B cadmium directed assembly of adenine phosphoribosyltransferase from yersinia pseudotuberculosis. 0.9676 2 179
4mb6-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from yersinia pseudotuberculosis. 0.966 2 177
4lza-assembly1.cif.gz_B crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9639 5 177
4lza-assembly1.cif.gz_A crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. 0.9612 5 177
7xi2-assembly1.cif.gz_B crystal structure of escherichia coli adenine phosphoribosyltransferase (aprt) in complex with phosphate 0.9609 1 180
ID Description Score Start End Superfamily
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.975 1 180 3.40.50.2020
af_A0A0P0WCD3_31_176_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9708 2 139 3.40.50.2020
af_P69503_1_183_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9697 1 180 3.40.50.2020
4m0kC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9527 1 177 3.40.50.2020
af_P91455_5_184_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9518 4 177 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A0F4FS05-F1-model_v4 deleted 0.992 4 180
AF-A0A3E0NA20-F1-model_v4 deleted 0.9901 114 180
AF-A0A430PZ97-F1-model_v4 adenine phosphoribosyltransferase (EC 2.4.2.7) 0.9893 111 177 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209
AF-A0A3M1A3U6-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.9885 8 179 GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0044209
AF-A0A7L9WLN0-F1-model_v4 Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) 0.987 8 180 GO:0002055
GO:0003999
GO:0005737
GO:0006166
GO:0006168
GO:0016208
GO:0044209

Map