metagRoot

F446284

General Info

Members	Datasets	Scaffolds	Average Seq Length
448	363	287	314

Family's Representative Sequence

Representative Sequence	iso_pu_bacteria\|8019530166\|8019531823
Length	352
Sequence	AVSESGHRLKPLSPAMLRELSSRSNFQGAARSLCHYGLITLVGALIWKVTATYGVLWALPLVAVQGYFVAFLFMAVHETAHKTAFRSRGLNLAVGYLSGFIIGLPYEYYCLFHWDHHRYTQDPDKDPELVVGVKPKSDTQLALAYSGLLQVVGRVWLMFGHAVTGKVVVPWIPENRRAIIVTEARAYVALYALLLVLSLWFSSALLLWVWIVPLMIGQLFLRPYLYAEHTGCERTRSAFQNTRTTYTGAIVKWLTWNMPYHVEHHAYPSIPFHALPKLNVIVDGEILYRGRGYIRTTRETWAWFRRQRQGRLAQTQSSGRGATGALSWRRSISRRRRRRHSPCGRAGRGGSG

Samples

	Sample ID	Description	Type	Environment
1	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
2	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
3	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
4	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
5	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
6	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
7	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
8	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
9	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
10	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
11	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
12	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
13	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
14	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
15	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
16	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
17	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
18	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
19	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
20	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
21	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
22	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
23	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
24	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
25	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
26	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
27	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
28	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
29	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
30	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
31	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
32	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
33	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
34	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
35	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
36	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
37	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
38	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
39	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
40	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
41	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
42	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
43	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
44	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
45	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
46	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
47	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
48	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
49	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
50	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
51	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
52	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
53	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
54	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
55	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
56	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
57	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
58	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
59	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
60	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
61	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
62	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
63	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
64	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
65	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
66	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
67	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
68	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
69	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
70	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
71	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
72	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
73	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
74	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
75	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
76	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
77	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
78	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
79	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
80	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
81	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
82	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
83	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
84	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
85	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
86	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
87	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
88	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
89	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
90	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
91	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
92	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
93	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
94	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
95	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
96	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
97	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
98	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
99	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
100	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
101	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
102	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
103	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
104	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
105	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
106	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
107	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
108	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
109	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
110	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
111	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
112	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
113	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
114	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
115	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
116	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
117	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
118	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
119	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
120	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
121	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
122	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
123	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
124	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
125	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
126	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
127	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
128	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
129	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
130	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
131	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
132	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
133	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
134	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
135	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
136	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
137	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
138	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
139	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
140	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
141	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
142	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
143	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
144	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
145	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
146	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
147	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
148	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
149	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
150	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
151	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
152	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
153	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
154	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
155	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
156	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
157	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
158	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
159	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
160	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
161	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
162	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
163	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
164	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
165	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
166	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
167	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
168	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
169	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
170	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
171	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
172	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
177	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
179	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
204	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
205	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
206	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
207	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
210	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
211	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
212	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
213	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
214	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
215	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
216	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
217	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
218	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
219	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
220	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
221	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
222	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
223	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
224	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
225	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
226	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
227	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
228	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
229	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
230	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
231	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
232	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
233	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
234	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
235	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
236	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
237	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
238	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
239	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
240	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
241	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
242	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
243	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
244	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
245	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
246	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
247	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
248	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
249	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
250	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
251	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
252	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
253	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
254	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
255	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
256	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
257	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
258	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
259	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
260	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
261	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
262	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
263	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
264	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
265	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
266	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
267	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
268	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
269	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
270	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
271	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
272	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
273	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
274	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
275	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
276	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
277	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
278	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
279	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
280	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
281	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
282	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
283	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
284	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
285	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
286	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
287	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
288	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
289	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
290	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
291	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
292	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
293	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
294	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
295	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
296	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
297	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
298	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
299	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
300	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
301	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
302	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
303	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
304	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
305	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
306	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
307	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
308	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
309	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
310	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
311	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
312	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
313	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
314	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
315	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
316	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
317	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
318	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
319	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
320	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
321	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
322	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
323	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
324	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
325	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
326	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
327	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
328	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
329	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
330	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
331	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
332	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
333	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
334	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
335	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
336	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
337	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
338	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
339	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
340	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
341	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
342	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
343	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
344	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
345	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
346	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
347	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
348	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
349	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
350	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
351	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
352	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
353	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
354	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
355	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
356	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
357	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
358	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
359	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
360	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
361	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
362	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
363	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	64.06
Metatranscriptomes	0
Isolates	35.94

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	23.66
Nodule	32.37
Rhizoplane	3.57
Rhizosphere	29.46
Stem	0
Stem Tuber	0
Unclassified	10.94

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25153J46596_10000388	3300003215	Bacteria	29917
2	JGI25160J50197_1000761	3300003354	Bacteria	17408
3	Ga0055539_1002100	3300003752	Bacteria	3240
4	Ga0055531_10002095	3300003794	Bacteria	13694
5	Ga0055543_1002435	3300004625	Bacteria	6158
6	Ga0065165_1000917	3300005262	Bacteria	37935
7	Ga0065165_1001167	3300005262	Bacteria	30545
8	Ga0065165_1002784	3300005262	Bacteria	13826
9	Ga0070658_10190491	3300005327	Bacteria	1728
10	Ga0070670_100077259	3300005331	Bacteria	2861
11	Ga0070714_100121803	3300005435	Bacteria	2321
12	Ga0068867_100296715	3300005459	Bacteria	1331
13	Ga0070707_100103047	3300005468	Bacteria	2765
14	Ga0068855_100719589	3300005563	Bacteria	1067
15	Ga0068857_100119742	3300005577	Bacteria	2369
16	Ga0068854_100188204	3300005578	Bacteria	1616
17	Ga0068854_100194274	3300005578	Bacteria	1592
18	Ga0068852_100002834	3300005616	Bacteria	12021
19	Ga0068859_100273413	3300005617	Bacteria	1782
20	Ga0068864_100471330	3300005618	Bacteria	1204
21	Ga0081540_1049916	3300005983	Bacteria	2083
22	Ga0075365_10050841	3300006038	Bacteria	2735
23	Ga0075365_10073816	3300006038	Bacteria	2300
24	Ga0075365_10077236	3300006038	Bacteria	2250
25	Ga0075365_10165412	3300006038	Bacteria	1543
26	Ga0075365_10251471	3300006038	Bacteria	1242
27	Ga0075368_10034668	3300006042	Bacteria	1967
28	Ga0075363_100084555	3300006048	Bacteria	1740
29	Ga0075367_10283569	3300006178	Bacteria	1041
30	Ga0075370_10175435	3300006353	Bacteria	1261
31	Ga0097620_100273405	3300006931	Bacteria	1782
32	Ga0099824_1009019	3300006942	Bacteria	12482
33	Ga0099822_1004530	3300006943	Bacteria	18094
34	Ga0105240_10002492	3300009093	Bacteria	29572
35	Ga0105245_10022532	3300009098	Bacteria	5529
36	Ga0105247_10061779	3300009101	Bacteria	2323
37	Ga0105247_10090617	3300009101	Bacteria	1940
38	Ga0105243_10046546	3300009148	Bacteria	3413
39	Ga0105241_10017816	3300009174	Bacteria	5225
40	Ga0105241_10248582	3300009174	Bacteria	1507
41	Ga0105241_10275586	3300009174	Bacteria	1435
42	Ga0105248_10145190	3300009177	Bacteria	2677
43	Ga0105237_10018111	3300009545	Bacteria	7292
44	Ga0105237_10169970	3300009545	Bacteria	2180
45	Ga0105238_10154813	3300009551	Bacteria	2267
46	Ga0105239_10096712	3300010375	Bacteria	3262
47	Ga0105239_10159564	3300010375	Bacteria	2519
48	Ga0105239_10532968	3300010375	Bacteria	1336
49	Ga0105246_10132379	3300011119	Bacteria	1864
50	Ga0157369_10364988	3300013105	Bacteria	1499
51	Ga0157374_10374362	3300013296	Bacteria	1418
52	Ga0157378_10011296	3300013297	Bacteria	7817
53	Ga0157375_10550947	3300013308	Bacteria	1315
54	Ga0163163_10108032	3300014325	Bacteria	2809
55	Ga0163163_10471879	3300014325	Bacteria	1315
56	Ga0157379_10558032	3300014968	Bacteria	1066
57	Ga0214542_1000018	3300021321	Bacteria	202226
58	Ga0214545_1000009	3300021324	Bacteria	202915
59	Ga0214545_1016884	3300021324	Bacteria	7307
60	Ga0214543_1000037	3300021327	Bacteria	182113
61	Ga0214543_1020491	3300021327	Bacteria	5308
62	Ga0213872_10086732	3300021361	Bacteria	1403
63	Ga0209563_103627	3300025230	Bacteria	3143
64	Ga0209677_100281	3300025253	Bacteria	33858
65	Ga0209148_1000267	3300025254	Bacteria	81839
66	Ga0209455_1001026	3300025272	Bacteria	13894
67	Ga0209455_1007076	3300025272	Bacteria	3217
68	Ga0209564_1001577	3300025295	Bacteria	22295
69	Ga0209564_1008470	3300025295	Bacteria	5067
70	Ga0209758_1000015	3300025297	Bacteria	851943
71	Ga0209758_1000711	3300025297	Bacteria	49164
72	Ga0209758_1000764	3300025297	Bacteria	46385
73	Ga0209758_1025140	3300025297	Bacteria	2622
74	Ga0209256_1007749	3300025299	Bacteria	5197
75	Ga0209256_1030329	3300025299	Bacteria	1494
76	Ga0207426_1000217	3300025302	Bacteria	136180
77	Ga0207426_1000368	3300025302	Bacteria	79715
78	Ga0207426_1008702	3300025302	Bacteria	4069
79	Ga0207426_1009800	3300025302	Bacteria	3760
80	Ga0209257_1002989	3300025304	Bacteria	15349
81	Ga0207647_10002015	3300025904	Bacteria	15536
82	Ga0207695_10000059	3300025913	Bacteria	363920
83	Ga0207671_10015529	3300025914	Bacteria	5956
84	Ga0207657_10027225	3300025919	Bacteria	5238
85	Ga0207646_10086907	3300025922	Bacteria	2798
86	Ga0207694_10149354	3300025924	Bacteria	1882
87	Ga0207650_10195690	3300025925	Bacteria	1617
88	Ga0207687_10023050	3300025927	Bacteria	4146
89	Ga0207706_10056489	3300025933	Bacteria	3460
90	Ga0207686_10049139	3300025934	Bacteria	2617
91	Ga0207665_10230790	3300025939	Bacteria	1360
92	Ga0207711_10024893	3300025941	Bacteria	5021
93	Ga0207689_10181114	3300025942	Bacteria	1737
94	Ga0207667_10459593	3300025949	Bacteria	1293
95	Ga0207640_10078109	3300025981	Bacteria	2252
96	Ga0207678_10008490	3300026067	Bacteria	9055
97	Ga0207702_10190096	3300026078	Bacteria	1896
98	Ga0207641_10228680	3300026088	Bacteria	1728
99	Ga0207676_10351080	3300026095	Bacteria	1364
100	Ga0207675_100183251	3300026118	Bacteria	2006
101	Ga0207683_10196845	3300026121	Bacteria	1831
102	Ga0207698_10015076	3300026142	Bacteria	5164
103	Ga0207698_10180416	3300026142	Bacteria	1870
104	Ga0209389_1000012	3300027296	Bacteria	213243
105	Ga0209389_1000069	3300027296	Bacteria	98063
106	Ga0209389_1000110	3300027296	Bacteria	72586
107	Ga0209589_1000002	3300027357	Bacteria	708598
108	Ga0209589_1000077	3300027357	Bacteria	98063
109	Ga0209489_100002	3300027361	Bacteria	708609
110	Ga0209489_100019	3300027361	Bacteria	213243
111	Ga0209489_100020	3300027361	Bacteria	207541
112	Ga0209489_100524	3300027361	Bacteria	72457
113	Ga0209700_100002	3300027363	Bacteria	708598
114	Ga0209700_100018	3300027363	Bacteria	238200
115	Ga0209700_100334	3300027363	Bacteria	84979
116	Ga0268265_10072727	3300028380	Bacteria	2683
117	Ga0268264_10302370	3300028381	Bacteria	1506
118	Ga0307412_10054735	3300031911	Bacteria	2650
119	Ga0307414_10026223	3300032004	Bacteria	3748
120	Ga0307510_10000955	3300033180	Bacteria	30549
121	Ga0307510_10128254	3300033180	Bacteria	2219
122	Ga0373932_0064450	3300035112	Bacteria	1122
123	Ga0373931_0067191	3300035691	Bacteria	1947
124	Ga0373927_0045835	3300035695	Bacteria	2829
125	Ga0373947_0073858	3300035725	Bacteria	2097
126	Ga0395898_0074527	3300037466	Bacteria	3278
127	Ga0395905_0012940	3300037471	Bacteria	8021
128	Ga0395905_0018823	3300037471	Bacteria	6550
129	Ga0395905_0029843	3300037471	Bacteria	5140
130	Ga0395905_0272087	3300037471	Bacteria	1580
131	Ga0395901_0121081	3300038443	Bacteria	2750
132	Ga0395901_0231540	3300038443	Bacteria	1929
133	Ga0436360_1046985	3300039438	Bacteria	3986
134	Ga0436360_1323907	3300039438	Bacteria	1331
135	Ga0436361_0497917	3300039447	Bacteria	2155
136	Ga0451797_1481642	3300041453	Bacteria	2041
137	Ga0466972_0000100	3300044658	Bacteria	76018
138	Ga0466965_0029501	3300044683	Bacteria	2670
139	Ga0466966_0000264	3300044684	Bacteria	35017
140	Ga0466966_0042551	3300044684	Bacteria	2915
141	Ga0466961_0000601	3300044693	Bacteria	22652
142	Ga0466961_0232622	3300044693	Bacteria	1134
143	Ga0466963_0010159	3300044694	Bacteria	5692
144	Ga0466964_0038275	3300044706	Bacteria	1928
145	Ga0466970_0043639	3300044765	Bacteria	2387
146	Ga0466970_0061788	3300044765	Bacteria	2008
147	Ga0466957_0048937	3300044842	Bacteria	2569
148	Ga0466957_0178309	3300044842	Bacteria	1387
149	Ga0466959_0001585	3300045049	Bacteria	14013
150	Ga0466959_0155146	3300045049	Bacteria	1612
151	Ga0466967_0015185	3300045976	Bacteria	6029
152	Ga0495617_016596	3300046452	Bacteria	2491
153	Ga0495592_0030834	3300046454	Bacteria	4056
154	Ga0495651_0001679	3300046462	Bacteria	17119
155	Ga0495584_0076461	3300046491	Bacteria	1684
156	Ga0495606_0043859	3300046507	Bacteria	2978
157	Ga0495606_0085416	3300046507	Bacteria	1952
158	Ga0495610_0056396	3300046512	Bacteria	1889
159	Ga0495628_0084664	3300046516	Bacteria	2460
160	Ga0495631_0026562	3300046518	Bacteria	2657
161	Ga0495632_0020241	3300046519	Bacteria	3606
162	Ga0495644_0068582	3300046523	Bacteria	1332
163	Ga0495648_0004884	3300046524	Bacteria	11293
164	Ga0495652_0158302	3300046529	Bacteria	1761
165	Ga0495640_0019966	3300046533	Bacteria	4941
166	Ga0495633_0145922	3300046558	Bacteria	1093
167	Ga0495667_0087277	3300046559	Bacteria	2023
168	Ga0495656_0001349	3300046615	Bacteria	8008
169	Ga0495668_0071446	3300046616	Bacteria	1907
170	Ga0495634_0137645	3300046642	Bacteria	1553
171	Ga0495661_0113717	3300046665	Bacteria	1505
172	Ga0495588_0083230	3300046674	Bacteria	1671
173	Ga0495657_0001803	3300046675	Bacteria	18337
174	Ga0495670_0049720	3300046691	Bacteria	2098
175	Ga0495671_0053293	3300046692	Bacteria	2008
176	Ga0495649_0034815	3300046694	Bacteria	2770
177	Ga0495600_0004279	3300046809	Bacteria	8533
178	Ga0495604_0000678	3300047317	Bacteria	28877
179	Ga0495680_0001164	3300047322	Bacteria	28965
180	Ga0495685_020503	3300047447	Bacteria	2272
181	Ga0495673_0042144	3300047469	Bacteria	2051
182	Ga0495686_0042258	3300047472	Bacteria	2900
183	Ga0495686_0053906	3300047472	Bacteria	2519
184	Ga0495602_0074445	3300048088	Bacteria	2886
185	Ga0495615_0010041	3300048090	Bacteria	1881
186	Ga0496100_0110831	3300048903	Bacteria	1906
187	Ga0496101_0207592	3300048904	Bacteria	1516
188	Ga0496101_0226417	3300048904	Bacteria	1453
189	Ga0496103_0156172	3300048906	Bacteria	1462
190	Ga0496105_0042769	3300048908	Bacteria	3735
191	Ga0496106_0103915	3300048909	Bacteria	2206
192	Ga0496108_0128745	3300048911	Bacteria	2175
193	Ga0496109_0044706	3300048912	Bacteria	4018
194	Ga0496110_0114819	3300048913	Bacteria	2423
195	Ga0496111_0121108	3300048914	Bacteria	1932
196	Ga0496112_0434742	3300048915	Bacteria	1250
197	Ga0496113_0030630	3300048916	Bacteria	3896
198	Ga0496113_0140392	3300048916	Bacteria	1900
199	Ga0496114_0030955	3300048917	Bacteria	4401
200	Ga0496115_0047457	3300048918	Bacteria	3435
201	Ga0496117_0104464	3300048920	Bacteria	1783
202	Ga0496118_0137601	3300048921	Bacteria	1555
203	Ga0496118_0156585	3300048921	Bacteria	1416
204	Ga0496121_0004526	3300048924	Bacteria	18614
205	Ga0496121_0004595	3300048924	Bacteria	18391
206	Ga0496121_0012634	3300048924	Bacteria	9173
207	Ga0496121_0118476	3300048924	Bacteria	2004
208	Ga0496122_0032056	3300048925	Bacteria	4354
209	Ga0496123_0019219	3300048926	Bacteria	5391
210	Ga0496125_0042920	3300048928	Bacteria	3845
211	Ga0496126_0129944	3300048929	Bacteria	2177
212	Ga0496126_0268727	3300048929	Bacteria	1416
213	Ga0501067_0139481	3300049583	Bacteria	1350
214	Ga0501069_0145052	3300049585	Bacteria	1363
215	nmdc:mga03683_73189_c1	3300050489	Bacteria	1468
216	nmdc:mga03n38_13783_c2	3300050490	Bacteria	2705
217	nmdc:mga0yw44_133199_c1	3300050492	Bacteria	1610
218	nmdc:mga0yw44_180857_c1	3300050492	Bacteria	1388
219	nmdc:mga0yw44_21562_c1	3300050492	Bacteria	3596
220	nmdc:mga0yw44_61659_c1	3300050492	Bacteria	2302
221	nmdc:mga0yw44_90529_c1	3300050492	Bacteria	1933
222	nmdc:mga0yw44_92412_c1	3300050492	Bacteria	1915
223	nmdc:mga0rr50_487297_c1	3300050513	Bacteria	1047
224	nmdc:mga0sz30_23327_c2	3300050516	Bacteria	2274
225	Ga0495619_0136861	3300053085	Bacteria	1685
226	Ga0500578_0073436	3300053086	Bacteria	2179
227	Ga0500578_0259543	3300053086	Bacteria	1044
228	Ga0500643_004137	3300053087	Bacteria	6663
229	Ga0500647_0001990	3300053091	Bacteria	7386
230	Ga0500583_0004623	3300053092	Bacteria	4513
231	Ga0500651_0014537	3300053093	Bacteria	4818
232	Ga0500651_0106959	3300053093	Bacteria	1710
233	Ga0500651_0140383	3300053093	Bacteria	1457
234	Ga0500566_0000005	3300053094	Bacteria	159299
235	Ga0500566_0000567	3300053094	Bacteria	20789
236	Ga0500566_0016449	3300053094	Bacteria	4343
237	Ga0500566_0076041	3300053094	Bacteria	1877
238	Ga0500554_006574	3300053102	Bacteria	2618
239	Ga0500555_008619	3300053103	Bacteria	2908
240	Ga0500557_000088	3300053105	Bacteria	31829
241	Ga0500569_089887	3300053109	Bacteria	993
242	Ga0500572_000016	3300053111	Bacteria	51017
243	Ga0500572_000102	3300053111	Bacteria	27944
244	Ga0500572_037886	3300053111	Bacteria	1384
245	Ga0500592_005053	3300053116	Bacteria	2095
246	Ga0500593_125428	3300053117	Bacteria	1034
247	Ga0500595_000364	3300053119	Bacteria	29229
248	Ga0500595_015453	3300053119	Bacteria	2864
249	Ga0500607_111628	3300053121	Bacteria	1338
250	Ga0500608_000945	3300053122	Bacteria	10382
251	Ga0500608_001762	3300053122	Bacteria	7729
252	Ga0500614_003290	3300053123	Bacteria	3495
253	Ga0500614_027052	3300053123	Bacteria	1375
254	Ga0500618_003876	3300053125	Bacteria	4983
255	Ga0500642_0000037	3300053130	Bacteria	98684
256	Ga0500642_0000143	3300053130	Bacteria	31709
257	Ga0500658_0020463	3300053134	Bacteria	2498
258	Ga0500658_0057227	3300053134	Bacteria	1611
259	Ga0500559_0000165	3300053136	Bacteria	52143
260	Ga0500559_0000629	3300053136	Bacteria	23942
261	Ga0500559_0080010	3300053136	Bacteria	1484
262	Ga0500577_0002096	3300053142	Bacteria	5095
263	Ga0500590_054209	3300053148	Bacteria	2031
264	Ga0500603_000097	3300053150	Bacteria	20631
265	Ga0500603_005749	3300053150	Bacteria	2680
266	Ga0500616_0000014	3300053153	Bacteria	637918
267	Ga0500622_0004423	3300053156	Bacteria	8835
268	Ga0500627_0069025	3300053158	Bacteria	1563
269	Ga0500630_003521	3300053159	Bacteria	7567
270	Ga0500634_0008234	3300053161	Bacteria	5202
271	Ga0500634_0040546	3300053161	Bacteria	2531
272	Ga0500638_004388	3300053162	Bacteria	5420
273	Ga0500638_028818	3300053162	Bacteria	2669
274	Ga0500638_076231	3300053162	Bacteria	1597
275	Ga0500639_000106	3300053163	Bacteria	39379
276	Ga0500639_010998	3300053163	Bacteria	4747
277	Ga0500636_0000148	3300053177	Bacteria	36338
278	Ga0500636_0087094	3300053177	Bacteria	1793
279	Ga0500637_0002424	3300053178	Bacteria	8296
280	Ga0500637_0030296	3300053178	Bacteria	3009
281	Ga0500625_006380	3300053729	Bacteria	5021
282	Ga0500645_030651	3300053730	Bacteria	1618
283	Ga0500609_000971	3300053731	Bacteria	4304
284	Ga0500596_001241	3300053735	Bacteria	5162
285	Ga0500596_002246	3300053735	Bacteria	3833
286	Ga0500601_000150	3300053737	Bacteria	14492
287	Ga0500661_000645	3300055283	Bacteria	6513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	iso_pu_bacteria	8016603502	8016605737	246
2	3300032004	Ga0307414_10026223	Ga0307414_100262233	279
3	3300050513	nmdc:mga0rr50_487297_c1	nmdc:mga0rr50_487297_c1_81_1037	280
4	3300053729	Ga0500625_006380	Ga0500625_006380_35_925	290
5	3300053109	Ga0500569_089887	Ga0500569_089887_72_962	291
6	3300044658	Ga0466972_0000100	Ga0466972_0000100_18732_19679	292
7	3300044683	Ga0466965_0029501	Ga0466965_0029501_1563_2510	292
8	3300044693	Ga0466961_0232622	Ga0466961_0232622_97_1044	292
9	3300044765	Ga0466970_0043639	Ga0466970_0043639_203_1150	292
10	iso_pu_bacteria	2935864058	2935864448	292
11	3300039438	Ga0436360_1323907	Ga0436360_1323907_377_1279	294
12	3300053177	Ga0500636_0087094	Ga0500636_0087094_253_1203	294
13	3300053737	Ga0500601_000150	Ga0500601_000150_7477_8424	294
14	3300044842	Ga0466957_0178309	Ga0466957_0178309_45_941	295
15	3300053111	Ga0500572_000102	Ga0500572_000102_17650_18546	295
16	3300053136	Ga0500559_0000629	Ga0500559_0000629_19180_20076	295
17	3300053163	Ga0500639_010998	Ga0500639_010998_2899_3795	295
18	3300053735	Ga0500596_002246	Ga0500596_002246_451_1347	295
19	3300009093	Ga0105240_10002492	Ga0105240_1000249217	296
20	3300009098	Ga0105245_10022532	Ga0105245_100225326	296
21	3300009545	Ga0105237_10018111	Ga0105237_100181115	296
22	3300047472	Ga0495686_0042258	Ga0495686_0042258_28_918	296
23	3300053121	Ga0500607_111628	Ga0500607_111628_398_1297	296
24	3300006038	Ga0075365_10050841	Ga0075365_100508413	298
25	3300028381	Ga0268264_10302370	Ga0268264_103023703	298
26	3300004625	Ga0055543_1002435	Ga0055543_10024354	307
27	3300005262	Ga0065165_1000917	Ga0065165_100091715	307
28	3300006038	Ga0075365_10073816	Ga0075365_100738162	307
29	3300013105	Ga0157369_10364988	Ga0157369_103649882	307
30	3300026078	Ga0207702_10190096	Ga0207702_101900963	307
31	3300050492	nmdc:mga0yw44_21562_c1	nmdc:mga0yw44_21562_c1_2242_3189	307
32	iso_pu_bacteria	2617270741	2617377334	307
33	iso_pu_bacteria	2517093001	2517105351	308
34	iso_pu_bacteria	2824732956	2824734911	308
35	iso_pu_bacteria	2824746037	2824750271	308
36	iso_pu_bacteria	2841957949	2841961168	308
37	iso_pu_bacteria	2847930680	2847930786	308
38	iso_pu_bacteria	2879083081	2879089928	308
39	iso_pu_bacteria	2906643746	2906651079	308
40	iso_pu_bacteria	2922386360	2922387754	308
41	iso_pu_bacteria	3005483717	3005484765	308
42	iso_pu_bacteria	3005587118	3005593403	308
43	iso_pu_bacteria	8006964411	8006966815	308
44	iso_pu_bacteria	8056673599	8056680858	308
45	3300053105	Ga0500557_000088	Ga0500557_000088_9355_10302	309
46	3300053130	Ga0500642_0000143	Ga0500642_0000143_9399_10346	309
47	iso_pu_bacteria	2904690495	2904698846	309
48	iso_pu_bacteria	8006933436	8006934597	309
49	iso_pu_bacteria	8006973647	8006974567	309
50	3300005435	Ga0070714_100121803	Ga0070714_1001218032	310
51	3300013297	Ga0157378_10011296	Ga0157378_100112966	310
52	3300025253	Ga0209677_100281	Ga0209677_10028125	310
53	3300031911	Ga0307412_10054735	Ga0307412_100547351	310
54	3300046665	Ga0495661_0113717	Ga0495661_0113717_300_1250	310
55	3300048920	Ga0496117_0104464	Ga0496117_0104464_254_1204	310
56	3300048921	Ga0496118_0137601	Ga0496118_0137601_497_1447	310
57	3300048924	Ga0496121_0012634	Ga0496121_0012634_912_1862	310
58	3300048929	Ga0496126_0268727	Ga0496126_0268727_309_1247	310
59	3300053093	Ga0500651_0106959	Ga0500651_0106959_643_1590	310
60	3300053153	Ga0500616_0000014	Ga0500616_0000014_513759_514709	310
61	3300053731	Ga0500609_000971	Ga0500609_000971_831_1778	310
62	iso_pu_bacteria	2876761206	2876767718	310
63	iso_pu_bacteria	8006926726	8006932561	310
64	iso_pu_bacteria	2507262055	2507505875	311
65	iso_pu_bacteria	2508501009	2508540067	311
66	iso_pu_bacteria	2508501042	2508696137	311
67	iso_pu_bacteria	2513237094	2513638800	311
68	iso_pu_bacteria	2513237095	2513649849	311
69	iso_pu_bacteria	2513237161	2514011225	311
70	iso_pu_bacteria	2515154112	2515631706	311
71	iso_pu_bacteria	2528768022	2528851324	311
72	iso_pu_bacteria	2617270735	2617347760	311
73	iso_pu_bacteria	2816332527	2818240849	311
74	iso_pu_bacteria	2824671348	2824676129	311
75	iso_pu_bacteria	2824687955	2824692482	311
76	iso_pu_bacteria	2824696289	2824699904	311
77	iso_pu_bacteria	2824704595	2824706086	311
78	iso_pu_bacteria	2824753945	2824760281	311
79	iso_pu_bacteria	2824763712	2824771520	311
80	iso_pu_bacteria	2824773399	2824775760	311
81	iso_pu_bacteria	2838122688	2838125133	311
82	iso_pu_bacteria	2841949485	2841956802	311
83	iso_pu_bacteria	2841966195	2841973318	311
84	iso_pu_bacteria	2841983080	2841989357	311
85	iso_pu_bacteria	2842038055	2842044347	311
86	iso_pu_bacteria	2842045827	2842051664	311
87	iso_pu_bacteria	2847930680	2847939489	311
88	iso_pu_bacteria	2847939898	2847941237	311
89	iso_pu_bacteria	2849076700	2849082229	311
90	iso_pu_bacteria	2857524615	2857529065	311
91	iso_pu_bacteria	2874590934	2874596388	311
92	iso_pu_bacteria	2874612657	2874620200	311
93	iso_pu_bacteria	2874620515	2874622423	311
94	iso_pu_bacteria	2874628541	2874633359	311
95	iso_pu_bacteria	2874645413	2874650375	311
96	iso_pu_bacteria	2876771140	2876776853	311
97	iso_pu_bacteria	2876818435	2876824643	311
98	iso_pu_bacteria	2879074833	2879080990	311
99	iso_pu_bacteria	2879083081	2879091069	311
100	iso_pu_bacteria	2879127579	2879128220	311
101	iso_pu_bacteria	2879142872	2879143537	311
102	iso_pu_bacteria	2881364244	2881369647	311
103	iso_pu_bacteria	2881665667	2881670171	311
104	iso_pu_bacteria	2888378607	2888387760	311
105	iso_pu_bacteria	2888388044	2888389978	311
106	iso_pu_bacteria	2893066018	2893070508	311
107	iso_pu_bacteria	2904666416	2904671570	311
108	iso_pu_bacteria	2904711408	2904718113	311
109	iso_pu_bacteria	2906626472	2906631926	311
110	iso_pu_bacteria	2906643746	2906648645	311
111	iso_pu_bacteria	2919073203	2919076466	311
112	iso_pu_bacteria	2929624759	2929630096	311
113	iso_pu_bacteria	2932784394	2932787971	311
114	iso_pu_bacteria	2932794094	2932799495	311
115	iso_pu_bacteria	2932801729	2932805199	311
116	iso_pu_bacteria	2932828146	2932832893	311
117	iso_pu_bacteria	2935608549	2935614300	311
118	iso_pu_bacteria	2935616580	2935620378	311
119	iso_pu_bacteria	2935638405	2935640702	311
120	iso_pu_bacteria	2935648319	2935649328	311
121	iso_pu_bacteria	2935656913	2935657900	311
122	iso_pu_bacteria	2935665750	2935668894	311
123	iso_pu_bacteria	2935703347	2935709082	311
124	iso_pu_bacteria	2935769743	2935770166	311
125	iso_pu_bacteria	2935777560	2935777804	311
126	iso_pu_bacteria	2935785616	2935786780	311
127	iso_pu_bacteria	2935793552	2935794834	311
128	iso_pu_bacteria	2935801545	2935804812	311
129	iso_pu_bacteria	2935810662	2935815961	311
130	iso_pu_bacteria	2935819856	2935826518	311
131	iso_pu_bacteria	2935827899	2935832209	311
132	iso_pu_bacteria	2935837841	2935840961	311
133	iso_pu_bacteria	2935847175	2935851188	311
134	iso_pu_bacteria	2935855204	2935859264	311
135	iso_pu_bacteria	2935873716	2935875200	311
136	iso_pu_bacteria	2935883170	2935887711	311
137	iso_pu_bacteria	2935908558	2935913237	311
138	iso_pu_bacteria	2935916978	2935922659	311
139	iso_pu_bacteria	2935926038	2935930838	311
140	iso_pu_bacteria	2935934488	2935939828	311
141	iso_pu_bacteria	2935942939	2935946777	311
142	iso_pu_bacteria	2935951376	2935956022	311
143	iso_pu_bacteria	2935959822	2935963901	311
144	iso_pu_bacteria	2935967501	2935972815	311
145	iso_pu_bacteria	2935975950	2935978269	311
146	iso_pu_bacteria	2935984226	2935985604	311
147	iso_pu_bacteria	2935992306	2935995825	311
148	iso_pu_bacteria	2936002035	2936005736	311
149	iso_pu_bacteria	2936011229	2936012119	311
150	iso_pu_bacteria	2936019824	2936020800	311
151	iso_pu_bacteria	2936028420	2936029412	311
152	iso_pu_bacteria	2936037263	2936041864	311
153	iso_pu_bacteria	2936046547	2936048264	311
154	iso_pu_bacteria	2936055302	2936056625	311
155	iso_pu_bacteria	2941531003	2941532085	311
156	iso_pu_bacteria	2941538514	2941541777	311
157	iso_pu_bacteria	3005506211	3005510865	311
158	iso_pu_bacteria	3005710791	3005717609	311
159	iso_pu_bacteria	3005718088	3005724662	311
160	iso_pu_bacteria	8016511872	8016517311	311
161	iso_pu_bacteria	8016522445	8016526922	311
162	iso_pu_bacteria	8016530956	8016532005	311
163	iso_pu_bacteria	8016548790	8016556871	311
164	iso_pu_bacteria	8016566248	8016570294	311
165	iso_pu_bacteria	8016575299	8016582842	311
166	iso_pu_bacteria	8016583857	8016585465	311
167	iso_pu_bacteria	8016595262	8016602867	311
168	iso_pu_bacteria	8016622563	8016623926	311
169	iso_pu_bacteria	8016630954	8016634943	311
170	iso_pu_bacteria	8017057580	8017059287	311
171	iso_pu_bacteria	8019530166	8019531823	311
172	iso_pu_bacteria	8019538911	8019539705	311
173	iso_pu_bacteria	8019547302	8019550944	311
174	iso_pu_bacteria	8019576017	8019576343	311
175	iso_pu_bacteria	8019586578	8019594218	311
176	iso_pu_bacteria	8019597564	8019607349	311
177	iso_pu_bacteria	8019608314	8019611170	311
178	iso_pu_bacteria	8019619141	8019622014	311
179	iso_pu_bacteria	8019629233	8019631308	311
180	iso_pu_bacteria	8019638758	8019639315	311
181	iso_pu_bacteria	8019659431	8019668113	311
182	iso_pu_bacteria	8019668869	8019677577	311
183	iso_pu_bacteria	8019678201	8019687371	311
184	iso_pu_bacteria	8019687851	8019693347	311
185	3300006038	Ga0075365_10165412	Ga0075365_101654122	312
186	3300021321	Ga0214542_1000018	Ga0214542_100001885	312
187	3300021324	Ga0214545_1000009	Ga0214545_100000997	312
188	3300021324	Ga0214545_1016884	Ga0214545_10168845	312
189	3300021327	Ga0214543_1000037	Ga0214543_100003776	312
190	3300021327	Ga0214543_1020491	Ga0214543_10204914	312
191	3300025272	Ga0209455_1007076	Ga0209455_10070762	312
192	3300026118	Ga0207675_100183251	Ga0207675_1001832512	312
193	3300027296	Ga0209389_1000110	Ga0209389_100011012	312
194	3300027361	Ga0209489_100524	Ga0209489_10052412	312
195	3300027363	Ga0209700_100334	Ga0209700_10033467	312
196	3300037471	Ga0395905_0018823	Ga0395905_0018823_5370_6329	312
197	3300041453	Ga0451797_1481642	Ga0451797_1481642_603_1562	312
198	3300046452	Ga0495617_016596	Ga0495617_016596_1210_2169	312
199	3300046491	Ga0495584_0076461	Ga0495584_0076461_628_1587	312
200	3300046518	Ga0495631_0026562	Ga0495631_0026562_1042_1998	312
201	3300046519	Ga0495632_0020241	Ga0495632_0020241_142_1098	312
202	3300046523	Ga0495644_0068582	Ga0495644_0068582_110_1078	312
203	3300046558	Ga0495633_0145922	Ga0495633_0145922_68_1036	312
204	3300046615	Ga0495656_0001349	Ga0495656_0001349_1334_2302	312
205	3300046616	Ga0495668_0071446	Ga0495668_0071446_564_1532	312
206	3300046691	Ga0495670_0049720	Ga0495670_0049720_864_1832	312
207	3300047447	Ga0495685_020503	Ga0495685_020503_837_1805	312
208	3300048090	Ga0495615_0010041	Ga0495615_0010041_188_1156	312
209	3300049583	Ga0501067_0139481	Ga0501067_0139481_261_1220	312
210	3300049585	Ga0501069_0145052	Ga0501069_0145052_101_1060	312
211	3300050489	nmdc:mga03683_73189_c1	nmdc:mga03683_73189_c1_152_1111	312
212	3300050492	nmdc:mga0yw44_133199_c1	nmdc:mga0yw44_133199_c1_422_1381	312
213	3300050516	nmdc:mga0sz30_23327_c2	nmdc:mga0sz30_23327_c2_816_1775	312
214	3300053091	Ga0500647_0001990	Ga0500647_0001990_2020_2964	312
215	3300053092	Ga0500583_0004623	Ga0500583_0004623_3307_4266	312
216	3300053094	Ga0500566_0000005	Ga0500566_0000005_59535_60479	312
217	3300053094	Ga0500566_0076041	Ga0500566_0076041_795_1757	312
218	3300053102	Ga0500554_006574	Ga0500554_006574_754_1716	312
219	3300053111	Ga0500572_000016	Ga0500572_000016_9432_10376	312
220	3300053119	Ga0500595_000364	Ga0500595_000364_13716_14678	312
221	3300053122	Ga0500608_001762	Ga0500608_001762_6547_7491	312
222	3300053123	Ga0500614_003290	Ga0500614_003290_1723_2667	312
223	3300053134	Ga0500658_0057227	Ga0500658_0057227_171_1130	312
224	3300053136	Ga0500559_0080010	Ga0500559_0080010_253_1215	312
225	3300053150	Ga0500603_000097	Ga0500603_000097_14498_15442	312
226	3300053150	Ga0500603_005749	Ga0500603_005749_762_1724	312
227	3300053159	Ga0500630_003521	Ga0500630_003521_2582_3526	312
228	3300053162	Ga0500638_004388	Ga0500638_004388_2297_3259	312
229	3300053162	Ga0500638_028818	Ga0500638_028818_1546_2490	312
230	3300053163	Ga0500639_000106	Ga0500639_000106_15057_16001	312
231	3300053178	Ga0500637_0002424	Ga0500637_0002424_391_1353	312
232	3300053735	Ga0500596_001241	Ga0500596_001241_2602_3546	312
233	3300055283	Ga0500661_000645	Ga0500661_000645_667_1629	312
234	iso_pu_bacteria	2824661429	2824663750	312
235	iso_pu_bacteria	2879099564	2879106633	312
236	iso_pu_bacteria	2929615660	2929622257	312
237	iso_pu_bacteria	2932809354	2932813346	312
238	iso_pu_bacteria	2932818245	2932820043	312
239	iso_pu_bacteria	2933577622	2933584129	312
240	iso_pu_bacteria	2935675223	2935681381	312
241	iso_pu_bacteria	2935684952	2935687202	312
242	iso_pu_bacteria	2935694250	2935696826	312
243	iso_pu_bacteria	2935713505	2935716890	312
244	iso_pu_bacteria	2935722832	2935722985	312
245	iso_pu_bacteria	2935732158	2935734542	312
246	iso_pu_bacteria	2935741537	2935744667	312
247	iso_pu_bacteria	2935750917	2935753168	312
248	iso_pu_bacteria	2935760218	2935767573	312
249	iso_pu_bacteria	2940556831	2940559081	312
250	iso_pu_bacteria	8055742211	8055743494	312
251	3300005468	Ga0070707_100103047	Ga0070707_1001030472	313
252	3300006943	Ga0099822_1004530	Ga0099822_10045304	313
253	3300021361	Ga0213872_10086732	Ga0213872_100867321	313
254	3300025922	Ga0207646_10086907	Ga0207646_100869074	313
255	3300027357	Ga0209589_1000002	Ga0209589_1000002114	313
256	3300027361	Ga0209489_100002	Ga0209489_100002114	313
257	3300027363	Ga0209700_100002	Ga0209700_100002114	313
258	3300039438	Ga0436360_1046985	Ga0436360_1046985_485_1459	313
259	3300039447	Ga0436361_0497917	Ga0436361_0497917_28_987	313
260	3300044684	Ga0466966_0042551	Ga0466966_0042551_1830_2789	313
261	3300044765	Ga0466970_0061788	Ga0466970_0061788_909_1868	313
262	3300045049	Ga0466959_0155146	Ga0466959_0155146_166_1125	313
263	3300047469	Ga0495673_0042144	Ga0495673_0042144_98_1054	313
264	3300053148	Ga0500590_054209	Ga0500590_054209_493_1440	313
265	3300053178	Ga0500637_0030296	Ga0500637_0030296_1549_2496	313
266	iso_pu_bacteria	2513237139	2513877288	313
267	iso_pu_bacteria	2802429603	2805916112	313
268	3300006038	Ga0075365_10251471	Ga0075365_102514712	314
269	3300025295	Ga0209564_1001577	Ga0209564_100157717	314
270	3300037466	Ga0395898_0074527	Ga0395898_0074527_1864_2808	314
271	3300037471	Ga0395905_0272087	Ga0395905_0272087_197_1141	314
272	3300038443	Ga0395901_0121081	Ga0395901_0121081_510_1454	314
273	3300048924	Ga0496121_0118476	Ga0496121_0118476_972_1919	314
274	iso_pu_bacteria	8019648815	8019651732	314
275	3300003215	JGI25153J46596_10000388	JGI25153J46596_1000038812	315
276	3300003354	JGI25160J50197_1000761	JGI25160J50197_10007615	315
277	3300003752	Ga0055539_1002100	Ga0055539_10021003	315
278	3300003794	Ga0055531_10002095	Ga0055531_100020958	315
279	3300005262	Ga0065165_1001167	Ga0065165_100116730	315
280	3300005262	Ga0065165_1002784	Ga0065165_10027847	315
281	3300005327	Ga0070658_10190491	Ga0070658_101904911	315
282	3300005331	Ga0070670_100077259	Ga0070670_1000772592	315
283	3300005459	Ga0068867_100296715	Ga0068867_1002967151	315
284	3300005563	Ga0068855_100719589	Ga0068855_1007195891	315
285	3300005577	Ga0068857_100119742	Ga0068857_1001197423	315
286	3300005578	Ga0068854_100188204	Ga0068854_1001882042	315
287	3300005578	Ga0068854_100194274	Ga0068854_1001942742	315
288	3300005616	Ga0068852_100002834	Ga0068852_1000028347	315
289	3300005617	Ga0068859_100273413	Ga0068859_1002734133	315
290	3300005618	Ga0068864_100471330	Ga0068864_1004713302	315
291	3300005983	Ga0081540_1049916	Ga0081540_10499163	315
292	3300006038	Ga0075365_10077236	Ga0075365_100772363	315
293	3300006042	Ga0075368_10034668	Ga0075368_100346682	315
294	3300006048	Ga0075363_100084555	Ga0075363_1000845552	315
295	3300006178	Ga0075367_10283569	Ga0075367_102835691	315
296	3300006353	Ga0075370_10175435	Ga0075370_101754351	315
297	3300006931	Ga0097620_100273405	Ga0097620_1002734053	315
298	3300006942	Ga0099824_1009019	Ga0099824_10090192	315
299	3300009101	Ga0105247_10061779	Ga0105247_100617792	315
300	3300009101	Ga0105247_10090617	Ga0105247_100906173	315
301	3300009148	Ga0105243_10046546	Ga0105243_100465462	315
302	3300009174	Ga0105241_10017816	Ga0105241_100178163	315
303	3300009174	Ga0105241_10248582	Ga0105241_102485821	315
304	3300009174	Ga0105241_10275586	Ga0105241_102755861	315
305	3300009177	Ga0105248_10145190	Ga0105248_101451902	315
306	3300009545	Ga0105237_10169970	Ga0105237_101699702	315
307	3300009551	Ga0105238_10154813	Ga0105238_101548133	315
308	3300010375	Ga0105239_10096712	Ga0105239_100967122	315
309	3300010375	Ga0105239_10159564	Ga0105239_101595642	315
310	3300010375	Ga0105239_10532968	Ga0105239_105329682	315
311	3300011119	Ga0105246_10132379	Ga0105246_101323793	315
312	3300013296	Ga0157374_10374362	Ga0157374_103743621	315
313	3300013308	Ga0157375_10550947	Ga0157375_105509472	315
314	3300014325	Ga0163163_10108032	Ga0163163_101080324	315
315	3300014325	Ga0163163_10471879	Ga0163163_104718791	315
316	3300014968	Ga0157379_10558032	Ga0157379_105580321	315
317	3300025230	Ga0209563_103627	Ga0209563_1036272	315
318	3300025254	Ga0209148_1000267	Ga0209148_100026732	315
319	3300025272	Ga0209455_1001026	Ga0209455_10010268	315
320	3300025295	Ga0209564_1008470	Ga0209564_10084705	315
321	3300025297	Ga0209758_1000015	Ga0209758_1000015780	315
322	3300025297	Ga0209758_1000711	Ga0209758_100071152	315
323	3300025297	Ga0209758_1000764	Ga0209758_100076423	315
324	3300025297	Ga0209758_1025140	Ga0209758_10251403	315
325	3300025299	Ga0209256_1007749	Ga0209256_10077492	315
326	3300025299	Ga0209256_1030329	Ga0209256_10303292	315
327	3300025302	Ga0207426_1000217	Ga0207426_100021716	315
328	3300025302	Ga0207426_1000368	Ga0207426_100036821	315
329	3300025302	Ga0207426_1008702	Ga0207426_10087024	315
330	3300025302	Ga0207426_1009800	Ga0207426_10098001	315
331	3300025304	Ga0209257_1002989	Ga0209257_10029893	315
332	3300025904	Ga0207647_10002015	Ga0207647_100020153	315
333	3300025913	Ga0207695_10000059	Ga0207695_1000005980	315
334	3300025914	Ga0207671_10015529	Ga0207671_100155295	315
335	3300025919	Ga0207657_10027225	Ga0207657_100272256	315
336	3300025924	Ga0207694_10149354	Ga0207694_101493542	315
337	3300025925	Ga0207650_10195690	Ga0207650_101956902	315
338	3300025927	Ga0207687_10023050	Ga0207687_100230502	315
339	3300025933	Ga0207706_10056489	Ga0207706_100564893	315
340	3300025934	Ga0207686_10049139	Ga0207686_100491392	315
341	3300025939	Ga0207665_10230790	Ga0207665_102307902	315
342	3300025941	Ga0207711_10024893	Ga0207711_100248933	315
343	3300025942	Ga0207689_10181114	Ga0207689_101811143	315
344	3300025949	Ga0207667_10459593	Ga0207667_104595931	315
345	3300025981	Ga0207640_10078109	Ga0207640_100781092	315
346	3300026067	Ga0207678_10008490	Ga0207678_100084905	315
347	3300026088	Ga0207641_10228680	Ga0207641_102286802	315
348	3300026095	Ga0207676_10351080	Ga0207676_103510801	315
349	3300026121	Ga0207683_10196845	Ga0207683_101968452	315
350	3300026142	Ga0207698_10015076	Ga0207698_100150766	315
351	3300026142	Ga0207698_10180416	Ga0207698_101804161	315
352	3300027296	Ga0209389_1000012	Ga0209389_1000012140	315
353	3300027296	Ga0209389_1000069	Ga0209389_100006929	315
354	3300027357	Ga0209589_1000077	Ga0209589_100007729	315
355	3300027361	Ga0209489_100019	Ga0209489_100019140	315
356	3300027361	Ga0209489_100020	Ga0209489_10002050	315
357	3300027363	Ga0209700_100018	Ga0209700_100018159	315
358	3300028380	Ga0268265_10072727	Ga0268265_100727272	315
359	3300033180	Ga0307510_10000955	Ga0307510_1000095526	315
360	3300033180	Ga0307510_10128254	Ga0307510_101282542	315
361	3300035112	Ga0373932_0064450	Ga0373932_0064450_22_990	315
362	3300035691	Ga0373931_0067191	Ga0373931_0067191_176_1144	315
363	3300035695	Ga0373927_0045835	Ga0373927_0045835_703_1671	315
364	3300035725	Ga0373947_0073858	Ga0373947_0073858_438_1406	315
365	3300037471	Ga0395905_0012940	Ga0395905_0012940_4511_5458	315
366	3300037471	Ga0395905_0029843	Ga0395905_0029843_1936_2886	315
367	3300038443	Ga0395901_0231540	Ga0395901_0231540_737_1684	315
368	3300044684	Ga0466966_0000264	Ga0466966_0000264_32481_33428	315
369	3300044693	Ga0466961_0000601	Ga0466961_0000601_7416_8363	315
370	3300044694	Ga0466963_0010159	Ga0466963_0010159_3294_4247	315
371	3300044706	Ga0466964_0038275	Ga0466964_0038275_807_1769	315
372	3300044842	Ga0466957_0048937	Ga0466957_0048937_21_974	315
373	3300045049	Ga0466959_0001585	Ga0466959_0001585_8700_9647	315
374	3300045976	Ga0466967_0015185	Ga0466967_0015185_5054_6007	315
375	3300046454	Ga0495592_0030834	Ga0495592_0030834_2216_3163	315
376	3300046462	Ga0495651_0001679	Ga0495651_0001679_14095_15042	315
377	3300046507	Ga0495606_0043859	Ga0495606_0043859_785_1732	315
378	3300046507	Ga0495606_0085416	Ga0495606_0085416_587_1537	315
379	3300046512	Ga0495610_0056396	Ga0495610_0056396_365_1312	315
380	3300046516	Ga0495628_0084664	Ga0495628_0084664_595_1542	315
381	3300046524	Ga0495648_0004884	Ga0495648_0004884_4400_5347	315
382	3300046529	Ga0495652_0158302	Ga0495652_0158302_683_1630	315
383	3300046533	Ga0495640_0019966	Ga0495640_0019966_2789_3736	315
384	3300046559	Ga0495667_0087277	Ga0495667_0087277_602_1549	315
385	3300046642	Ga0495634_0137645	Ga0495634_0137645_593_1540	315
386	3300046674	Ga0495588_0083230	Ga0495588_0083230_560_1510	315
387	3300046675	Ga0495657_0001803	Ga0495657_0001803_15582_16529	315
388	3300046692	Ga0495671_0053293	Ga0495671_0053293_637_1584	315
389	3300046694	Ga0495649_0034815	Ga0495649_0034815_1379_2326	315
390	3300046809	Ga0495600_0004279	Ga0495600_0004279_4568_5515	315
391	3300047317	Ga0495604_0000678	Ga0495604_0000678_15216_16163	315
392	3300047322	Ga0495680_0001164	Ga0495680_0001164_14642_15589	315
393	3300047472	Ga0495686_0053906	Ga0495686_0053906_384_1331	315
394	3300048088	Ga0495602_0074445	Ga0495602_0074445_1918_2865	315
395	3300048903	Ga0496100_0110831	Ga0496100_0110831_400_1368	315
396	3300048904	Ga0496101_0207592	Ga0496101_0207592_310_1278	315
397	3300048904	Ga0496101_0226417	Ga0496101_0226417_147_1094	315
398	3300048906	Ga0496103_0156172	Ga0496103_0156172_113_1081	315
399	3300048908	Ga0496105_0042769	Ga0496105_0042769_1738_2706	315
400	3300048909	Ga0496106_0103915	Ga0496106_0103915_506_1453	315
401	3300048911	Ga0496108_0128745	Ga0496108_0128745_995_1963	315
402	3300048912	Ga0496109_0044706	Ga0496109_0044706_668_1636	315
403	3300048913	Ga0496110_0114819	Ga0496110_0114819_977_1945	315
404	3300048914	Ga0496111_0121108	Ga0496111_0121108_443_1411	315
405	3300048915	Ga0496112_0434742	Ga0496112_0434742_131_1099	315
406	3300048916	Ga0496113_0030630	Ga0496113_0030630_1455_2402	315
407	3300048916	Ga0496113_0140392	Ga0496113_0140392_17_985	315
408	3300048917	Ga0496114_0030955	Ga0496114_0030955_499_1467	315
409	3300048918	Ga0496115_0047457	Ga0496115_0047457_1096_2064	315
410	3300048921	Ga0496118_0156585	Ga0496118_0156585_418_1365	315
411	3300048924	Ga0496121_0004526	Ga0496121_0004526_2834_3784	315
412	3300048924	Ga0496121_0004595	Ga0496121_0004595_9845_10795	315
413	3300048925	Ga0496122_0032056	Ga0496122_0032056_2393_3343	315
414	3300048926	Ga0496123_0019219	Ga0496123_0019219_1001_1951	315
415	3300048928	Ga0496125_0042920	Ga0496125_0042920_1327_2274	315
416	3300048929	Ga0496126_0129944	Ga0496126_0129944_1158_2108	315
417	3300050490	nmdc:mga03n38_13783_c2	nmdc:mga03n38_13783_c2_230_1177	315
418	3300050492	nmdc:mga0yw44_180857_c1	nmdc:mga0yw44_180857_c1_276_1223	315
419	3300050492	nmdc:mga0yw44_61659_c1	nmdc:mga0yw44_61659_c1_377_1327	315
420	3300050492	nmdc:mga0yw44_90529_c1	nmdc:mga0yw44_90529_c1_12_959	315
421	3300050492	nmdc:mga0yw44_92412_c1	nmdc:mga0yw44_92412_c1_763_1710	315
422	3300053085	Ga0495619_0136861	Ga0495619_0136861_189_1136	315
423	3300053086	Ga0500578_0073436	Ga0500578_0073436_449_1396	315
424	3300053086	Ga0500578_0259543	Ga0500578_0259543_15_962	315
425	3300053087	Ga0500643_004137	Ga0500643_004137_1281_2231	315
426	3300053093	Ga0500651_0014537	Ga0500651_0014537_3471_4421	315
427	3300053093	Ga0500651_0140383	Ga0500651_0140383_372_1328	315
428	3300053094	Ga0500566_0000567	Ga0500566_0000567_8428_9381	315
429	3300053094	Ga0500566_0016449	Ga0500566_0016449_2061_3011	315
430	3300053103	Ga0500555_008619	Ga0500555_008619_1267_2214	315
431	3300053111	Ga0500572_037886	Ga0500572_037886_200_1156	315
432	3300053116	Ga0500592_005053	Ga0500592_005053_475_1425	315
433	3300053117	Ga0500593_125428	Ga0500593_125428_40_990	315
434	3300053119	Ga0500595_015453	Ga0500595_015453_1855_2802	315
435	3300053122	Ga0500608_000945	Ga0500608_000945_2946_3896	315
436	3300053123	Ga0500614_027052	Ga0500614_027052_199_1155	315
437	3300053125	Ga0500618_003876	Ga0500618_003876_1925_2875	315
438	3300053130	Ga0500642_0000037	Ga0500642_0000037_77587_78537	315
439	3300053134	Ga0500658_0020463	Ga0500658_0020463_1205_2155	315
440	3300053136	Ga0500559_0000165	Ga0500559_0000165_14845_15795	315
441	3300053142	Ga0500577_0002096	Ga0500577_0002096_1683_2636	315
442	3300053156	Ga0500622_0004423	Ga0500622_0004423_1685_2635	315
443	3300053158	Ga0500627_0069025	Ga0500627_0069025_301_1248	315
444	3300053161	Ga0500634_0008234	Ga0500634_0008234_901_1851	315
445	3300053161	Ga0500634_0040546	Ga0500634_0040546_296_1246	315
446	3300053162	Ga0500638_076231	Ga0500638_076231_324_1280	315
447	3300053177	Ga0500636_0000148	Ga0500636_0000148_29323_30279	315
448	3300053730	Ga0500645_030651	Ga0500645_030651_57_1004	315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

51

298

0.82 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8sbb-assembly1.cif.gz_A	cryo-em structure of ftalkb	0.5853	17	289
8sbb-assembly1.cif.gz_A	cryo-em structure of ftalkb	0.5212	17	289
8e0o-assembly1.cif.gz_C	heterotrimeric variant of tctrp9, hetbgl03-15-18	0.3317	32	193
8e0o-assembly1.cif.gz_C	heterotrimeric variant of tctrp9, hetbgl03-15-18	0.2917	32	193
8fbj-assembly1.cif.gz_A	improving the secretion of designed protein assemblies through negative design of cryptic transmembrane domains	0.2867	31	315

ID	Description	Score	Start	End	Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10	Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger)	0.7194	66	296	3.30.40.10
af_A0A0R4J2X1_81_350_3.30.40.10	Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger)	0.6248	66	296	3.30.40.10
af_Q4DB10_34_240_1.20.120.1770	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);	0.3255	32	224	1.20.120.1770
af_Q4DB10_34_240_1.20.120.1770	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);	0.3088	32	224	1.20.120.1770
af_Q8C5X1_59_187_1.20.1420.10	Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain	0.3071	19	167	1.20.1420.10

ID	Description	Score	Start	End	GO Terms
AF-A0A0S6UM55-F1-model_v4	Fatty acid desaturase	0.9514	20	315	GO:0016020 GO:0042284 GO:0046513
AF-A0A0S6UM55-F1-model_v4	Fatty acid desaturase	0.9483	20	315	GO:0016020 GO:0042284 GO:0046513
AF-A0A368Y825-F1-model_v4	Fatty acid desaturase	0.9412	16	311	GO:0016020 GO:0042284 GO:0046513
AF-A0A1I4TL01-F1-model_v4	Fatty acid desaturase	0.9396	60	315	GO:0016020 GO:0042284 GO:0046513
AF-A0A5C0AXF9-F1-model_v4	Fatty acid desaturase	0.9353	16	314	GO:0016020 GO:0042284 GO:0046513

Feature Viewer

pLDDT	pTM	Quality
87.3	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F446284

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00487

FA_desaturase

Fatty acid desaturase

51

298

0.82

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map