F446299

General Info

Members Datasets Scaffolds Average Seq Length
449 247 898 177

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1004180|Ga0055526_100418010
Length 195
Sequence MSAEAQVAWAQMLVGALSWSELGALMLHFLMLSLLSIGGAITTAPDMHRYLVDERHWLTDQSFTSSIALAQAAPGPNILFVAVLGFNVSGLLGAAAAMAGILLPSTTLVVAATRWARNNREHLGVRAFTVGMAPLTLGLMIATGWLLAAPYLVEPSHRWATLAMIVATVVLTMRTKIGIVWMVLAGGVLGALGVV

Samples

Sample ID Description Type Environment
1 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
153 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
195 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
210 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
211 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
212 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
213 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
214 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
220 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
221 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
222 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
226 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
229 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
230 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
231 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
234 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 2643221585 Pelomonas sp. Root662 Isolate Unclassified
243 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
244 2643221656 Pelomonas sp. Root405 Isolate Unclassified
245 2738541337 Pelomonas sp. BT06 Isolate Unclassified
246 2831864461 Roseateles noduli HZ7 Isolate Nodule
247 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 0.22
Rhizoplane 4.23
Rhizosphere 82.18
Stem 0
Stem Tuber 0
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1004180 3300003771 Bacteria 8782
2 rootH1_10010320 3300003316 Bacteria 29974
3 rootH1_10085216 3300003316 Bacteria 1011
4 rootH1_10119123 3300003316 Bacteria 1206
5 rootL2_10000057 3300003322 Bacteria 97630
6 rootL2_10004912 3300003322 Bacteria 2813
7 rootL2_10006108 3300003322 Bacteria 12742
8 rootL2_10008165 3300003322 Bacteria 1976
9 rootH1_10100139 3300003323 Bacteria 1621
10 rootH1_10184542 3300003323 Bacteria 1363
11 JGI25161J50226_1014909 3300003374 Bacteria 859
12 Ga0055543_1001773 3300004625 Bacteria 8044
13 Ga0065165_1000281 3300005262 Bacteria 86863
14 Ga0070658_10081757 3300005327 Bacteria 2654
15 Ga0070676_10017399 3300005328 Bacteria 3980
16 Ga0070676_10070977 3300005328 Bacteria 2091
17 Ga0070676_10100126 3300005328 Bacteria 1789
18 Ga0070670_100001412 3300005331 Bacteria 19300
19 Ga0070677_10101885 3300005333 Bacteria 1267
20 Ga0068869_100000344 3300005334 Bacteria 24865
21 Ga0068869_100083525 3300005334 Bacteria 2389
22 Ga0070680_100560957 3300005336 Bacteria 979
23 Ga0070680_100738503 3300005336 Bacteria 847
24 Ga0070682_100352700 3300005337 Bacteria 1097
25 Ga0068868_100051037 3300005338 Bacteria 3251
26 Ga0068868_100061610 3300005338 Bacteria 2972
27 Ga0068868_100254086 3300005338 Unclassified 1480
28 Ga0068868_100427570 3300005338 Bacteria 1148
29 Ga0070660_100015075 3300005339 Bacteria 5577
30 Ga0070660_101147068 3300005339 Bacteria 658
31 Ga0070689_100001735 3300005340 Bacteria 13949
32 Ga0070689_100535797 3300005340 Bacteria 1007
33 Ga0070691_10019015 3300005341 Bacteria 3166
34 Ga0070691_10342104 3300005341 Bacteria 828
35 Ga0070687_100023358 3300005343 Bacteria 2938
36 Ga0070692_10115114 3300005345 Bacteria 1492
37 Ga0070668_100000854 3300005347 Bacteria 21147
38 Ga0070668_101066442 3300005347 Bacteria 728
39 Ga0070669_100004774 3300005353 Bacteria 9776
40 Ga0070675_100072211 3300005354 Bacteria 2865
41 Ga0070675_100482403 3300005354 Unclassified 1115
42 Ga0070671_100040900 3300005355 Bacteria 3852
43 Ga0070674_100311319 3300005356 Bacteria 1259
44 Ga0070673_100101174 3300005364 Unclassified 2374
45 Ga0070673_100114180 3300005364 Bacteria 2244
46 Ga0070673_100655945 3300005364 Unclassified 961
47 Ga0070673_101424574 3300005364 Unclassified 652
48 Ga0070667_100009725 3300005367 Bacteria 7971
49 Ga0070667_100062162 3300005367 Bacteria 3163
50 Ga0070667_100630395 3300005367 Bacteria 989
51 Ga0070703_10063494 3300005406 Bacteria 1214
52 Ga0070701_10006021 3300005438 Bacteria 5066
53 Ga0070705_100041305 3300005440 Bacteria 2629
54 Ga0070700_100000629 3300005441 Bacteria 17515
55 Ga0070700_100006522 3300005441 Bacteria 6241
56 Ga0070694_100039109 3300005444 Bacteria 3155
57 Ga0070663_100134697 3300005455 Bacteria 1880
58 Ga0070663_100388259 3300005455 Bacteria 1138
59 Ga0070678_100147100 3300005456 Unclassified 1893
60 Ga0070678_100449605 3300005456 Bacteria 1128
61 Ga0070681_10054594 3300005458 Bacteria 3981
62 Ga0070681_11058276 3300005458 Bacteria 732
63 Ga0068867_100000047 3300005459 Bacteria 74014
64 Ga0068867_100001610 3300005459 Bacteria 15686
65 Ga0068867_100004244 3300005459 Bacteria 10087
66 Ga0068867_100062431 3300005459 Bacteria 2768
67 Ga0068867_100079070 3300005459 Bacteria 2475
68 Ga0068867_100955796 3300005459 Bacteria 774
69 Ga0070685_10071949 3300005466 Unclassified 2051
70 Ga0070685_10257257 3300005466 Bacteria 1159
71 Ga0070707_100761513 3300005468 Bacteria 932
72 Ga0070679_100001812 3300005530 Bacteria 19273
73 Ga0070679_100048008 3300005530 Bacteria 4254
74 Ga0070679_100298626 3300005530 Bacteria 1561
75 Ga0070679_100813097 3300005530 Bacteria 878
76 Ga0070684_100072405 3300005535 Bacteria 3034
77 Ga0068853_100011967 3300005539 Bacteria 7057
78 Ga0068853_100073295 3300005539 Bacteria 2985
79 Ga0068853_100123283 3300005539 Bacteria 2314
80 Ga0068853_101189587 3300005539 Unclassified 736
81 Ga0070686_100001090 3300005544 Bacteria 15641
82 Ga0070695_100322553 3300005545 Bacteria 1149
83 Ga0070695_100885394 3300005545 Unclassified 720
84 Ga0070696_100004741 3300005546 Bacteria 9090
85 Ga0070693_100062355 3300005547 Bacteria 2170
86 Ga0070665_100141279 3300005548 Bacteria 2411
87 Ga0070665_100252165 3300005548 Bacteria 1765
88 Ga0070704_100452778 3300005549 Bacteria 1105
89 Ga0068855_100001026 3300005563 Bacteria 34816
90 Ga0068855_100248194 3300005563 Bacteria 1986
91 Ga0068857_100008028 3300005577 Bacteria 9103
92 Ga0068857_100127683 3300005577 Bacteria 2292
93 Ga0068857_100243194 3300005577 Bacteria 1648
94 Ga0068854_100058911 3300005578 Bacteria 2774
95 Ga0068854_100168893 3300005578 Bacteria 1700
96 Ga0068856_100123805 3300005614 Bacteria 2588
97 Ga0068856_100141568 3300005614 Bacteria 2413
98 Ga0068856_100310950 3300005614 Bacteria 1593
99 Ga0070702_100000117 3300005615 Bacteria 24144
100 Ga0070702_100143187 3300005615 Bacteria 1525
101 Ga0068859_100002546 3300005617 Bacteria 18510
102 Ga0068859_100019479 3300005617 Bacteria 6816
103 Ga0068859_100041774 3300005617 Bacteria 4605
104 Ga0068859_100171587 3300005617 Bacteria 2250
105 Ga0068859_100564739 3300005617 Bacteria 1232
106 Ga0068864_100002924 3300005618 Bacteria 14129
107 Ga0068864_100033287 3300005618 Bacteria 4382
108 Ga0068864_100108869 3300005618 Unclassified 2466
109 Ga0068866_10000515 3300005718 Bacteria 17880
110 Ga0068861_100002077 3300005719 Bacteria 12987
111 Ga0068861_100044832 3300005719 Bacteria 3327
112 Ga0068861_100229144 3300005719 Bacteria 1575
113 Ga0068870_10031148 3300005840 Bacteria 2700
114 Ga0068870_10191496 3300005840 Unclassified 1234
115 Ga0068863_100132046 3300005841 Unclassified 2384
116 Ga0068863_100648723 3300005841 Bacteria 1047
117 Ga0068863_101213636 3300005841 Bacteria 760
118 Ga0068858_100000492 3300005842 Bacteria 41287
119 Ga0068858_100007798 3300005842 Bacteria 10334
120 Ga0068858_100075788 3300005842 Unclassified 3125
121 Ga0068858_100146554 3300005842 Bacteria 2217
122 Ga0068860_100758390 3300005843 Bacteria 982
123 Ga0068860_100906571 3300005843 Bacteria 898
124 Ga0068862_100005405 3300005844 Bacteria 10674
125 Ga0068862_100006282 3300005844 Bacteria 9887
126 Ga0068862_100884247 3300005844 Unclassified 877
127 Ga0075366_10006826 3300006195 Bacteria 6278
128 Ga0075366_10280830 3300006195 Bacteria 1018
129 Ga0097621_100002682 3300006237 Bacteria 12178
130 Ga0075370_10062746 3300006353 Bacteria 2118
131 Ga0068871_100002071 3300006358 Bacteria 13572
132 Ga0068871_100027480 3300006358 Bacteria 4451
133 Ga0068865_100000773 3300006881 Bacteria 17950
134 Ga0068865_100073674 3300006881 Bacteria 2429
135 Ga0068865_100091997 3300006881 Unclassified 2203
136 Ga0068865_100271332 3300006881 Bacteria 1347
137 Ga0097620_100002546 3300006931 Bacteria 18510
138 Ga0097620_100019479 3300006931 Bacteria 6816
139 Ga0097620_100041775 3300006931 Bacteria 4605
140 Ga0097620_100171593 3300006931 Bacteria 2250
141 Ga0097620_100564736 3300006931 Bacteria 1232
142 Ga0105240_10003193 3300009093 Bacteria 25753
143 Ga0105240_10009597 3300009093 Bacteria 13694
144 Ga0105240_10549511 3300009093 Bacteria 1278
145 Ga0105245_10000368 3300009098 Bacteria 42262
146 Ga0105245_10055490 3300009098 Bacteria 3558
147 Ga0105245_11241490 3300009098 Bacteria 793
148 Ga0105247_10003423 3300009101 Bacteria 10360
149 Ga0105247_10124346 3300009101 Bacteria 1675
150 Ga0105247_10199421 3300009101 Unclassified 1344
151 Ga0105243_10002735 3300009148 Bacteria 14665
152 Ga0105243_10088185 3300009148 Bacteria 2548
153 Ga0105243_10122102 3300009148 Bacteria 2198
154 Ga0105243_10942748 3300009148 Bacteria 862
155 Ga0105241_10005603 3300009174 Bacteria 9272
156 Ga0105241_10260585 3300009174 Bacteria 1473
157 Ga0105241_10898973 3300009174 Bacteria 822
158 Ga0105242_10007095 3300009176 Bacteria 8653
159 Ga0105242_10729350 3300009176 Bacteria 973
160 Ga0105242_10795224 3300009176 Bacteria 936
161 Ga0105248_10001495 3300009177 Bacteria 26017
162 Ga0105248_10001649 3300009177 Bacteria 24825
163 Ga0105248_10109049 3300009177 Unclassified 3121
164 Ga0105237_10002497 3300009545 Bacteria 22814
165 Ga0105237_10160272 3300009545 Bacteria 2248
166 Ga0105237_11438260 3300009545 Bacteria 696
167 Ga0105238_10006261 3300009551 Bacteria 11823
168 Ga0105249_10106778 3300009553 Bacteria 2642
169 Ga0105239_10001816 3300010375 Bacteria 27990
170 Ga0105239_10021225 3300010375 Bacteria 7161
171 Ga0105239_10195770 3300010375 Bacteria 2263
172 Ga0105246_10123159 3300011119 Bacteria 1924
173 Ga0105246_10248924 3300011119 Bacteria 1409
174 Ga0157369_10403255 3300013105 Bacteria 1418
175 Ga0157374_10114454 3300013296 Bacteria 2597
176 Ga0157374_10175476 3300013296 Bacteria 2092
177 Ga0157378_10002007 3300013297 Bacteria 18205
178 Ga0157378_10184600 3300013297 Bacteria 1964
179 Ga0157378_11004792 3300013297 Bacteria 869
180 Ga0163162_10035556 3300013306 Bacteria 4962
181 Ga0163162_10137002 3300013306 Bacteria 2559
182 Ga0157372_11151193 3300013307 Unclassified 897
183 Ga0157375_10055649 3300013308 Bacteria 3902
184 Ga0157375_10160893 3300013308 Bacteria 2387
185 Ga0157375_10370793 3300013308 Bacteria 1598
186 Ga0157375_10402476 3300013308 Bacteria 1535
187 Ga0157375_10776737 3300013308 Bacteria 1108
188 Ga0163163_10001402 3300014325 Bacteria 20329
189 Ga0163163_10762776 3300014325 Bacteria 1031
190 Ga0157380_10000610 3300014326 Bacteria 22041
191 Ga0157380_10724813 3300014326 Unclassified 1002
192 Ga0157379_10000172 3300014968 Bacteria 48686
193 Ga0157379_10584778 3300014968 Unclassified 1041
194 Ga0157376_10017647 3300014969 Bacteria 5451
195 Ga0157376_10650083 3300014969 Unclassified 1055
196 Ga0213872_10000618 3300021361 Bacteria 26906
197 Ga0213872_10001074 3300021361 Bacteria 18845
198 Ga0213872_10017178 3300021361 Bacteria 3348
199 Ga0209673_1016431 3300025273 Bacteria 2768
200 Ga0209564_1000005 3300025295 Bacteria 1147192
201 Ga0207642_10010931 3300025899 Bacteria 3220
202 Ga0207642_10103293 3300025899 Unclassified 1435
203 Ga0207710_10094865 3300025900 Unclassified 1401
204 Ga0207710_10258466 3300025900 Bacteria 872
205 Ga0207645_10058003 3300025907 Bacteria 2472
206 Ga0207645_10452389 3300025907 Bacteria 867
207 Ga0207643_10068104 3300025908 Bacteria 2044
208 Ga0207705_10520790 3300025909 Bacteria 924
209 Ga0207654_10141194 3300025911 Bacteria 1536
210 Ga0207654_10484403 3300025911 Bacteria 871
211 Ga0207707_10008586 3300025912 Bacteria 8856
212 Ga0207695_10016902 3300025913 Bacteria 8515
213 Ga0207695_10147181 3300025913 Bacteria 2298
214 Ga0207671_10023801 3300025914 Bacteria 4615
215 Ga0207671_10115830 3300025914 Bacteria 2043
216 Ga0207671_10301626 3300025914 Bacteria 1266
217 Ga0207660_10629190 3300025917 Bacteria 875
218 Ga0207662_10057723 3300025918 Bacteria 2320
219 Ga0207657_10114239 3300025919 Bacteria 2227
220 Ga0207657_10885770 3300025919 Bacteria 688
221 Ga0207652_10090657 3300025921 Bacteria 2687
222 Ga0207652_10581586 3300025921 Bacteria 1005
223 Ga0207652_10800495 3300025921 Unclassified 837
224 Ga0207652_11025296 3300025921 Unclassified 724
225 Ga0207646_10461446 3300025922 Bacteria 1146
226 Ga0207681_10004236 3300025923 Bacteria 8858
227 Ga0207681_10345933 3300025923 Bacteria 1189
228 Ga0207694_10171828 3300025924 Bacteria 1755
229 Ga0207650_10016851 3300025925 Bacteria 5111
230 Ga0207659_10151764 3300025926 Bacteria 1810
231 Ga0207687_10005786 3300025927 Bacteria 8182
232 Ga0207687_10038342 3300025927 Bacteria 3274
233 Ga0207687_10796082 3300025927 Bacteria 806
234 Ga0207644_10028602 3300025931 Bacteria 3861
235 Ga0207644_10069311 3300025931 Bacteria 2575
236 Ga0207686_10001174 3300025934 Bacteria 15148
237 Ga0207709_10175363 3300025935 Bacteria 1509
238 Ga0207709_10247997 3300025935 Bacteria 1299
239 Ga0207709_10425728 3300025935 Bacteria 1021
240 Ga0207670_10156491 3300025936 Bacteria 1697
241 Ga0207670_10409325 3300025936 Bacteria 1086
242 Ga0207704_10000449 3300025938 Bacteria 18375
243 Ga0207704_10123929 3300025938 Bacteria 1775
244 Ga0207704_10322242 3300025938 Unclassified 1193
245 Ga0207711_10013200 3300025941 Bacteria 6863
246 Ga0207711_10021688 3300025941 Bacteria 5366
247 Ga0207689_10000075 3300025942 Bacteria 80691
248 Ga0207689_10000088 3300025942 Bacteria 74315
249 Ga0207689_10003137 3300025942 Bacteria 15170
250 Ga0207689_10019375 3300025942 Bacteria 5736
251 Ga0207667_10046696 3300025949 Bacteria 4586
252 Ga0207667_10200945 3300025949 Bacteria 2045
253 Ga0207651_10096487 3300025960 Bacteria 2180
254 Ga0207651_10939471 3300025960 Bacteria 771
255 Ga0207712_10063466 3300025961 Bacteria 2630
256 Ga0207668_10000941 3300025972 Bacteria 17535
257 Ga0207658_10005528 3300025986 Bacteria 8663
258 Ga0207658_10209361 3300025986 Bacteria 1633
259 Ga0207677_10008513 3300026023 Bacteria 5736
260 Ga0207677_10009819 3300026023 Bacteria 5394
261 Ga0207677_10299044 3300026023 Bacteria 1329
262 Ga0207677_10409622 3300026023 Bacteria 1152
263 Ga0207703_10010856 3300026035 Bacteria 7102
264 Ga0207703_10013688 3300026035 Bacteria 6322
265 Ga0207703_10047196 3300026035 Unclassified 3472
266 Ga0207639_10040154 3300026041 Bacteria 3491
267 Ga0207639_10224026 3300026041 Bacteria 1626
268 Ga0207678_10152198 3300026067 Bacteria 1975
269 Ga0207708_10000090 3300026075 Bacteria 71734
270 Ga0207708_10035474 3300026075 Bacteria 3795
271 Ga0207708_10101907 3300026075 Bacteria 2222
272 Ga0207702_10089132 3300026078 Bacteria 2697
273 Ga0207702_10105409 3300026078 Bacteria 2497
274 Ga0207641_10035156 3300026088 Bacteria 4173
275 Ga0207641_10801882 3300026088 Bacteria 931
276 Ga0207648_10000202 3300026089 Bacteria 63315
277 Ga0207648_10001429 3300026089 Bacteria 26298
278 Ga0207648_10046887 3300026089 Unclassified 3788
279 Ga0207648_10104808 3300026089 Bacteria 2481
280 Ga0207676_10004655 3300026095 Bacteria 9716
281 Ga0207676_10021123 3300026095 Bacteria 4774
282 Ga0207676_10092454 3300026095 Unclassified 2488
283 Ga0207674_10005461 3300026116 Bacteria 15097
284 Ga0207674_10032261 3300026116 Bacteria 5496
285 Ga0207674_10346839 3300026116 Bacteria 1435
286 Ga0207675_100001897 3300026118 Bacteria 20889
287 Ga0207675_100011121 3300026118 Bacteria 8433
288 Ga0207675_100032818 3300026118 Bacteria 4837
289 Ga0207675_101104650 3300026118 Bacteria 813
290 Ga0207683_10797303 3300026121 Bacteria 877
291 Ga0209371_1021943 3300027312 Bacteria 1537
292 Ga0268266_10142346 3300028379 Bacteria 2153
293 Ga0268266_10442224 3300028379 Bacteria 1235
294 Ga0268265_10006025 3300028380 Bacteria 8249
295 Ga0268265_10006089 3300028380 Bacteria 8191
296 Ga0268265_10801805 3300028380 Unclassified 918
297 Ga0268264_10006452 3300028381 Bacteria 9876
298 Ga0268264_10007073 3300028381 Bacteria 9403
299 Ga0268264_11187495 3300028381 Bacteria 772
300 Ga0307517_10000150 3300028786 Bacteria 110446
301 Ga0307517_10138965 3300028786 Bacteria 1714
302 Ga0307515_10017631 3300028794 Bacteria 12990
303 Ga0307515_10095902 3300028794 Bacteria 3644
304 Ga0307515_10401528 3300028794 Bacteria 996
305 Ga0268256_1026721 3300030500 Bacteria 1447
306 Ga0265329_10073394 3300031242 Bacteria 1083
307 Ga0265331_10001374 3300031250 Bacteria 17891
308 Ga0265327_10000078 3300031251 Bacteria 207398
309 Ga0265327_10166224 3300031251 Bacteria 1016
310 Ga0307513_10744393 3300031456 Unclassified 686
311 Ga0307509_10000092 3300031507 Bacteria 124019
312 Ga0307509_10005769 3300031507 Bacteria 17025
313 Ga0307509_10005994 3300031507 Bacteria 16597
314 Ga0307509_10085390 3300031507 Bacteria 3248
315 Ga0307408_100000030 3300031548 Bacteria 223389
316 Ga0307408_100239691 3300031548 Bacteria 1490
317 Ga0307408_100535172 3300031548 Bacteria 1031
318 Ga0307508_10000594 3300031616 Bacteria 43299
319 Ga0307508_10001639 3300031616 Bacteria 24934
320 Ga0307508_10277295 3300031616 Bacteria 1270
321 Ga0307508_10449300 3300031616 Bacteria 881
322 Ga0307516_10139529 3300031730 Bacteria 2195
323 Ga0307516_10233061 3300031730 Bacteria 1544
324 Ga0307507_10122437 3300033179 Bacteria 2074
325 Ga0373948_0001121 3300034817 Bacteria 3631
326 Ga0373959_0115853 3300034820 Bacteria 651
327 Ga0373949_0288856 3300035090 Bacteria 517
328 Ga0373923_0308081 3300035111 Unclassified 750
329 Ga0373939_0000869 3300035114 Bacteria 7476
330 Ga0373960_0001233 3300035121 Bacteria 5605
331 Ga0373960_0049560 3300035121 Unclassified 1242
332 Ga0373942_0191705 3300035207 Bacteria 674
333 Ga0373961_0238238 3300035241 Bacteria 654
334 Ga0373931_0000150 3300035691 Bacteria 30766
335 Ga0373937_0397416 3300036401 Bacteria 1308
336 Ga0395900_0570188 3300037418 Bacteria 1075
337 Ga0395898_1027746 3300037466 Bacteria 759
338 Ga0395905_0000678 3300037471 Bacteria 45181
339 Ga0395905_0029615 3300037471 Bacteria 5159
340 Ga0395905_0099816 3300037471 Bacteria 2726
341 Ga0436361_0008791 3300039447 Bacteria 1664
342 Ga0436361_0371806 3300039447 Bacteria 51714
343 Ga0436361_0507490 3300039447 Bacteria 19202
344 Ga0436361_0513759 3300039447 Bacteria 41887
345 Ga0436361_0794512 3300039447 Bacteria 6538
346 Ga0450890_002146 3300042127 Bacteria 2754
347 Ga0451577_0068516 3300042876 Bacteria 3164
348 Ga0466963_0294861 3300044694 Bacteria 1140
349 Ga0453684_1364278 3300044712 Bacteria 737
350 Ga0451576_0000545 3300045051 Bacteria 80903
351 Ga0451576_0039796 3300045051 Bacteria 4976
352 Ga0495592_0009238 3300046454 Bacteria 7415
353 Ga0495590_0005009 3300046457 Bacteria 5282
354 Ga0495620_0163973 3300046515 Bacteria 863
355 Ga0495632_0097872 3300046519 Bacteria 1384
356 Ga0495648_0165222 3300046524 Bacteria 1140
357 Ga0495625_0477217 3300046660 Bacteria 766
358 Ga0495658_0013961 3300046683 Bacteria 4096
359 Ga0495658_0234840 3300046683 Bacteria 1151
360 Ga0495658_0771687 3300046683 Bacteria 615
361 Ga0495670_0068328 3300046691 Bacteria 1795
362 Ga0495660_0391314 3300046810 Bacteria 610
363 Ga0495676_0175151 3300047321 Bacteria 1507
364 Ga0495593_0014040 3300047673 Bacteria 4560
365 Ga0496101_0342024 3300048904 Bacteria 1175
366 Ga0496101_0799320 3300048904 Bacteria 744
367 Ga0496102_0103684 3300048905 Bacteria 2645
368 Ga0496103_0237852 3300048906 Bacteria 1171
369 Ga0496104_0026843 3300048907 Bacteria 5323
370 Ga0496104_0664344 3300048907 Bacteria 951
371 Ga0496105_0582957 3300048908 Bacteria 870
372 Ga0496106_0003730 3300048909 Bacteria 11366
373 Ga0496106_0073063 3300048909 Bacteria 2623
374 Ga0496106_0349214 3300048909 Bacteria 1188
375 Ga0496108_0229209 3300048911 Bacteria 1615
376 Ga0496108_0367545 3300048911 Bacteria 1256
377 Ga0496108_0723163 3300048911 Bacteria 862
378 Ga0496109_0008085 3300048912 Bacteria 8917
379 Ga0496109_0134443 3300048912 Bacteria 2310
380 Ga0496111_0097453 3300048914 Bacteria 2159
381 Ga0496112_0198476 3300048915 Bacteria 1966
382 Ga0496113_0091989 3300048916 Bacteria 2339
383 Ga0496113_0823150 3300048916 Bacteria 737
384 Ga0496124_0041812 3300048927 Bacteria 3951
385 Ga0501291_050593 3300049514 Bacteria 756
386 Ga0501300_002646 3300049523 Bacteria 2685
387 Ga0501032_0159379 3300049569 Bacteria 1482
388 Ga0501032_0180549 3300049569 Bacteria 1382
389 Ga0501034_0000643 3300049571 Bacteria 54170
390 Ga0501034_0014697 3300049571 Bacteria 8059
391 Ga0501034_0605908 3300049571 Bacteria 1000
392 Ga0501039_0024530 3300049575 Bacteria 4633
393 Ga0501039_0451945 3300049575 Bacteria 1009
394 Ga0501039_0809164 3300049575 Bacteria 731
395 Ga0501040_0870858 3300049576 Bacteria 652
396 Ga0501041_0266058 3300049577 Bacteria 1078
397 Ga0501041_0846745 3300049577 Bacteria 587
398 Ga0501043_0458940 3300049579 Bacteria 956
399 Ga0501068_0181852 3300049584 Bacteria 1329
400 Ga0501071_0425339 3300049587 Bacteria 1015
401 Ga0501072_0157082 3300049588 Bacteria 1813
402 Ga0501073_0005486 3300049589 Bacteria 9504
403 Ga0501074_0148710 3300049590 Bacteria 1675
404 Ga0501076_0308442 3300049592 Bacteria 1298
405 Ga0501076_0319277 3300049592 Bacteria 1274
406 Ga0501077_0160745 3300049593 Bacteria 1426
407 Ga0501199_008275 3300049650 Bacteria 1086
408 Ga0501207_061297 3300049654 Bacteria 690
409 Ga0501222_016930 3300049662 Bacteria 965
410 Ga0501223_013344 3300049663 Bacteria 1637
411 Ga0501255_000334 3300049684 Bacteria 3075
412 Ga0501221_002392 3300049704 Bacteria 3101
413 Ga0501225_0057608 3300049705 Bacteria 1089
414 Ga0501229_000814 3300049706 Bacteria 3527
415 Ga0501079_0204918 3300049741 Bacteria 1541
416 Ga0501079_0288631 3300049741 Bacteria 1283
417 Ga0501080_0037832 3300049742 Bacteria 4505
418 Ga0501262_011055 3300049759 Bacteria 1137
419 Ga0501267_003218 3300049764 Bacteria 1481
420 Ga0501272_011952 3300049769 Bacteria 982
421 Ga0501283_020376 3300049779 Bacteria 1057
422 nmdc:mga0k408_227868_c1 3300050493 Bacteria 1112
423 nmdc:mga0k408_6744_c1 3300050493 Bacteria 6126
424 nmdc:mga07m45_82386_c1 3300050496 Bacteria 1837
425 Ga0500578_0011609 3300053086 Bacteria 5690
426 Ga0500644_0007056 3300053088 Bacteria 2909
427 Ga0500651_0038434 3300053093 Bacteria 3015
428 Ga0500648_205437 3300053097 Unclassified 984
429 Ga0500562_114431 3300053108 Bacteria 735
430 Ga0500594_0009737 3300053118 Bacteria 2218
431 Ga0500559_0000017 3300053136 Bacteria 143646
432 Ga0500568_0223702 3300053139 Bacteria 687
433 Ga0500590_002156 3300053148 Bacteria 8560
434 Ga0500590_026449 3300053148 Bacteria 3010
435 Ga0500604_0239873 3300053151 Bacteria 627
436 Ga0500616_0070706 3300053153 Bacteria 1781
437 Ga0500619_000044 3300053154 Bacteria 38579
438 Ga0500622_0001793 3300053156 Bacteria 16373
439 Ga0500622_0007066 3300053156 Bacteria 6417
440 Ga0500637_0433691 3300053178 Bacteria 672
441 Ga0500645_002006 3300053730 Bacteria 9541
442 Ga0501084_1024754 3300054114 Bacteria 693
443 Ga0501082_0591205 3300060353 Bacteria 971
444 2643936689 2643221585 Bacteria 5812563
445 2644305202 2643221654 Bacteria 5273570
446 2644318588 2643221656 Bacteria 5809961
447 2739058717 2738541337 Bacteria 6183410
448 2831866512 2831864461 Bacteria 6502356
449 2886854547 2886848708 Bacteria 5632523
450 Ga0055526_1004180
451 rootH1_10010320
452 rootH1_10085216
453 rootH1_10119123
454 rootL2_10000057
455 rootL2_10004912
456 rootL2_10006108
457 rootL2_10008165
458 rootH1_10100139
459 rootH1_10184542
460 JGI25161J50226_1014909
461 Ga0055543_1001773
462 Ga0065165_1000281
463 Ga0070658_10081757
464 Ga0070676_10017399
465 Ga0070676_10070977
466 Ga0070676_10100126
467 Ga0070670_100001412
468 Ga0070677_10101885
469 Ga0068869_100000344
470 Ga0068869_100083525
471 Ga0070680_100560957
472 Ga0070680_100738503
473 Ga0070682_100352700
474 Ga0068868_100051037
475 Ga0068868_100061610
476 Ga0068868_100254086
477 Ga0068868_100427570
478 Ga0070660_100015075
479 Ga0070660_101147068
480 Ga0070689_100001735
481 Ga0070689_100535797
482 Ga0070691_10019015
483 Ga0070691_10342104
484 Ga0070687_100023358
485 Ga0070692_10115114
486 Ga0070668_100000854
487 Ga0070668_101066442
488 Ga0070669_100004774
489 Ga0070675_100072211
490 Ga0070675_100482403
491 Ga0070671_100040900
492 Ga0070674_100311319
493 Ga0070673_100101174
494 Ga0070673_100114180
495 Ga0070673_100655945
496 Ga0070673_101424574
497 Ga0070667_100009725
498 Ga0070667_100062162
499 Ga0070667_100630395
500 Ga0070703_10063494
501 Ga0070701_10006021
502 Ga0070705_100041305
503 Ga0070700_100000629
504 Ga0070700_100006522
505 Ga0070694_100039109
506 Ga0070663_100134697
507 Ga0070663_100388259
508 Ga0070678_100147100
509 Ga0070678_100449605
510 Ga0070681_10054594
511 Ga0070681_11058276
512 Ga0068867_100000047
513 Ga0068867_100001610
514 Ga0068867_100004244
515 Ga0068867_100062431
516 Ga0068867_100079070
517 Ga0068867_100955796
518 Ga0070685_10071949
519 Ga0070685_10257257
520 Ga0070707_100761513
521 Ga0070679_100001812
522 Ga0070679_100048008
523 Ga0070679_100298626
524 Ga0070679_100813097
525 Ga0070684_100072405
526 Ga0068853_100011967
527 Ga0068853_100073295
528 Ga0068853_100123283
529 Ga0068853_101189587
530 Ga0070686_100001090
531 Ga0070695_100322553
532 Ga0070695_100885394
533 Ga0070696_100004741
534 Ga0070693_100062355
535 Ga0070665_100141279
536 Ga0070665_100252165
537 Ga0070704_100452778
538 Ga0068855_100001026
539 Ga0068855_100248194
540 Ga0068857_100008028
541 Ga0068857_100127683
542 Ga0068857_100243194
543 Ga0068854_100058911
544 Ga0068854_100168893
545 Ga0068856_100123805
546 Ga0068856_100141568
547 Ga0068856_100310950
548 Ga0070702_100000117
549 Ga0070702_100143187
550 Ga0068859_100002546
551 Ga0068859_100019479
552 Ga0068859_100041774
553 Ga0068859_100171587
554 Ga0068859_100564739
555 Ga0068864_100002924
556 Ga0068864_100033287
557 Ga0068864_100108869
558 Ga0068866_10000515
559 Ga0068861_100002077
560 Ga0068861_100044832
561 Ga0068861_100229144
562 Ga0068870_10031148
563 Ga0068870_10191496
564 Ga0068863_100132046
565 Ga0068863_100648723
566 Ga0068863_101213636
567 Ga0068858_100000492
568 Ga0068858_100007798
569 Ga0068858_100075788
570 Ga0068858_100146554
571 Ga0068860_100758390
572 Ga0068860_100906571
573 Ga0068862_100005405
574 Ga0068862_100006282
575 Ga0068862_100884247
576 Ga0075366_10006826
577 Ga0075366_10280830
578 Ga0097621_100002682
579 Ga0075370_10062746
580 Ga0068871_100002071
581 Ga0068871_100027480
582 Ga0068865_100000773
583 Ga0068865_100073674
584 Ga0068865_100091997
585 Ga0068865_100271332
586 Ga0097620_100002546
587 Ga0097620_100019479
588 Ga0097620_100041775
589 Ga0097620_100171593
590 Ga0097620_100564736
591 Ga0105240_10003193
592 Ga0105240_10009597
593 Ga0105240_10549511
594 Ga0105245_10000368
595 Ga0105245_10055490
596 Ga0105245_11241490
597 Ga0105247_10003423
598 Ga0105247_10124346
599 Ga0105247_10199421
600 Ga0105243_10002735
601 Ga0105243_10088185
602 Ga0105243_10122102
603 Ga0105243_10942748
604 Ga0105241_10005603
605 Ga0105241_10260585
606 Ga0105241_10898973
607 Ga0105242_10007095
608 Ga0105242_10729350
609 Ga0105242_10795224
610 Ga0105248_10001495
611 Ga0105248_10001649
612 Ga0105248_10109049
613 Ga0105237_10002497
614 Ga0105237_10160272
615 Ga0105237_11438260
616 Ga0105238_10006261
617 Ga0105249_10106778
618 Ga0105239_10001816
619 Ga0105239_10021225
620 Ga0105239_10195770
621 Ga0105246_10123159
622 Ga0105246_10248924
623 Ga0157369_10403255
624 Ga0157374_10114454
625 Ga0157374_10175476
626 Ga0157378_10002007
627 Ga0157378_10184600
628 Ga0157378_11004792
629 Ga0163162_10035556
630 Ga0163162_10137002
631 Ga0157372_11151193
632 Ga0157375_10055649
633 Ga0157375_10160893
634 Ga0157375_10370793
635 Ga0157375_10402476
636 Ga0157375_10776737
637 Ga0163163_10001402
638 Ga0163163_10762776
639 Ga0157380_10000610
640 Ga0157380_10724813
641 Ga0157379_10000172
642 Ga0157379_10584778
643 Ga0157376_10017647
644 Ga0157376_10650083
645 Ga0213872_10000618
646 Ga0213872_10001074
647 Ga0213872_10017178
648 Ga0209673_1016431
649 Ga0209564_1000005
650 Ga0207642_10010931
651 Ga0207642_10103293
652 Ga0207710_10094865
653 Ga0207710_10258466
654 Ga0207645_10058003
655 Ga0207645_10452389
656 Ga0207643_10068104
657 Ga0207705_10520790
658 Ga0207654_10141194
659 Ga0207654_10484403
660 Ga0207707_10008586
661 Ga0207695_10016902
662 Ga0207695_10147181
663 Ga0207671_10023801
664 Ga0207671_10115830
665 Ga0207671_10301626
666 Ga0207660_10629190
667 Ga0207662_10057723
668 Ga0207657_10114239
669 Ga0207657_10885770
670 Ga0207652_10090657
671 Ga0207652_10581586
672 Ga0207652_10800495
673 Ga0207652_11025296
674 Ga0207646_10461446
675 Ga0207681_10004236
676 Ga0207681_10345933
677 Ga0207694_10171828
678 Ga0207650_10016851
679 Ga0207659_10151764
680 Ga0207687_10005786
681 Ga0207687_10038342
682 Ga0207687_10796082
683 Ga0207644_10028602
684 Ga0207644_10069311
685 Ga0207686_10001174
686 Ga0207709_10175363
687 Ga0207709_10247997
688 Ga0207709_10425728
689 Ga0207670_10156491
690 Ga0207670_10409325
691 Ga0207704_10000449
692 Ga0207704_10123929
693 Ga0207704_10322242
694 Ga0207711_10013200
695 Ga0207711_10021688
696 Ga0207689_10000075
697 Ga0207689_10000088
698 Ga0207689_10003137
699 Ga0207689_10019375
700 Ga0207667_10046696
701 Ga0207667_10200945
702 Ga0207651_10096487
703 Ga0207651_10939471
704 Ga0207712_10063466
705 Ga0207668_10000941
706 Ga0207658_10005528
707 Ga0207658_10209361
708 Ga0207677_10008513
709 Ga0207677_10009819
710 Ga0207677_10299044
711 Ga0207677_10409622
712 Ga0207703_10010856
713 Ga0207703_10013688
714 Ga0207703_10047196
715 Ga0207639_10040154
716 Ga0207639_10224026
717 Ga0207678_10152198
718 Ga0207708_10000090
719 Ga0207708_10035474
720 Ga0207708_10101907
721 Ga0207702_10089132
722 Ga0207702_10105409
723 Ga0207641_10035156
724 Ga0207641_10801882
725 Ga0207648_10000202
726 Ga0207648_10001429
727 Ga0207648_10046887
728 Ga0207648_10104808
729 Ga0207676_10004655
730 Ga0207676_10021123
731 Ga0207676_10092454
732 Ga0207674_10005461
733 Ga0207674_10032261
734 Ga0207674_10346839
735 Ga0207675_100001897
736 Ga0207675_100011121
737 Ga0207675_100032818
738 Ga0207675_101104650
739 Ga0207683_10797303
740 Ga0209371_1021943
741 Ga0268266_10142346
742 Ga0268266_10442224
743 Ga0268265_10006025
744 Ga0268265_10006089
745 Ga0268265_10801805
746 Ga0268264_10006452
747 Ga0268264_10007073
748 Ga0268264_11187495
749 Ga0307517_10000150
750 Ga0307517_10138965
751 Ga0307515_10017631
752 Ga0307515_10095902
753 Ga0307515_10401528
754 Ga0268256_1026721
755 Ga0265329_10073394
756 Ga0265331_10001374
757 Ga0265327_10000078
758 Ga0265327_10166224
759 Ga0307513_10744393
760 Ga0307509_10000092
761 Ga0307509_10005769
762 Ga0307509_10005994
763 Ga0307509_10085390
764 Ga0307408_100000030
765 Ga0307408_100239691
766 Ga0307408_100535172
767 Ga0307508_10000594
768 Ga0307508_10001639
769 Ga0307508_10277295
770 Ga0307508_10449300
771 Ga0307516_10139529
772 Ga0307516_10233061
773 Ga0307507_10122437
774 Ga0373948_0001121
775 Ga0373959_0115853
776 Ga0373949_0288856
777 Ga0373923_0308081
778 Ga0373939_0000869
779 Ga0373960_0001233
780 Ga0373960_0049560
781 Ga0373942_0191705
782 Ga0373961_0238238
783 Ga0373931_0000150
784 Ga0373937_0397416
785 Ga0395900_0570188
786 Ga0395898_1027746
787 Ga0395905_0000678
788 Ga0395905_0029615
789 Ga0395905_0099816
790 Ga0436361_0008791
791 Ga0436361_0371806
792 Ga0436361_0507490
793 Ga0436361_0513759
794 Ga0436361_0794512
795 Ga0450890_002146
796 Ga0451577_0068516
797 Ga0466963_0294861
798 Ga0453684_1364278
799 Ga0451576_0000545
800 Ga0451576_0039796
801 Ga0495592_0009238
802 Ga0495590_0005009
803 Ga0495620_0163973
804 Ga0495632_0097872
805 Ga0495648_0165222
806 Ga0495625_0477217
807 Ga0495658_0013961
808 Ga0495658_0234840
809 Ga0495658_0771687
810 Ga0495670_0068328
811 Ga0495660_0391314
812 Ga0495676_0175151
813 Ga0495593_0014040
814 Ga0496101_0342024
815 Ga0496101_0799320
816 Ga0496102_0103684
817 Ga0496103_0237852
818 Ga0496104_0026843
819 Ga0496104_0664344
820 Ga0496105_0582957
821 Ga0496106_0003730
822 Ga0496106_0073063
823 Ga0496106_0349214
824 Ga0496108_0229209
825 Ga0496108_0367545
826 Ga0496108_0723163
827 Ga0496109_0008085
828 Ga0496109_0134443
829 Ga0496111_0097453
830 Ga0496112_0198476
831 Ga0496113_0091989
832 Ga0496113_0823150
833 Ga0496124_0041812
834 Ga0501291_050593
835 Ga0501300_002646
836 Ga0501032_0159379
837 Ga0501032_0180549
838 Ga0501034_0000643
839 Ga0501034_0014697
840 Ga0501034_0605908
841 Ga0501039_0024530
842 Ga0501039_0451945
843 Ga0501039_0809164
844 Ga0501040_0870858
845 Ga0501041_0266058
846 Ga0501041_0846745
847 Ga0501043_0458940
848 Ga0501068_0181852
849 Ga0501071_0425339
850 Ga0501072_0157082
851 Ga0501073_0005486
852 Ga0501074_0148710
853 Ga0501076_0308442
854 Ga0501076_0319277
855 Ga0501077_0160745
856 Ga0501199_008275
857 Ga0501207_061297
858 Ga0501222_016930
859 Ga0501223_013344
860 Ga0501255_000334
861 Ga0501221_002392
862 Ga0501225_0057608
863 Ga0501229_000814
864 Ga0501079_0204918
865 Ga0501079_0288631
866 Ga0501080_0037832
867 Ga0501262_011055
868 Ga0501267_003218
869 Ga0501272_011952
870 Ga0501283_020376
871 nmdc:mga0k408_227868_c1
872 nmdc:mga0k408_6744_c1
873 nmdc:mga07m45_82386_c1
874 Ga0500578_0011609
875 Ga0500644_0007056
876 Ga0500651_0038434
877 Ga0500648_205437
878 Ga0500562_114431
879 Ga0500594_0009737
880 Ga0500559_0000017
881 Ga0500568_0223702
882 Ga0500590_002156
883 Ga0500590_026449
884 Ga0500604_0239873
885 Ga0500616_0070706
886 Ga0500619_000044
887 Ga0500622_0001793
888 Ga0500622_0007066
889 Ga0500637_0433691
890 Ga0500645_002006
891 Ga0501084_1024754
892 Ga0501082_0591205
893 2643936689
894 2644305202
895 2644318588
896 2739058717
897 2831866512
898 2886854547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

23

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r0y-assembly1.cif.gz_N thermus thermophilus v/a-type atpase/synthase, rotational state 3 0.1992 4 159
7lq4-assembly1.cif.gz_A rr (rsig)2-(c-di-gmp)2-whig complex 0.1909 4 142
6r0y-assembly1.cif.gz_N thermus thermophilus v/a-type atpase/synthase, rotational state 3 0.1777 4 159
7lq4-assembly1.cif.gz_A rr (rsig)2-(c-di-gmp)2-whig complex 0.1769 4 142
ID Description Score Start End Superfamily
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.4036 47 117 1.20.81.30
af_Q18177_8_222_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3109 5 108 1.20.140.150
af_Q4CM68_117_263_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.3074 1 105 1.20.120.550
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.2788 47 117 1.20.81.30
5osbE02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.2633 2 102 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A7U9A9R9-F1-model_v4 deleted 0.9312 1 97
AF-A0A6P1B007-F1-model_v4 deleted 0.9155 3 90
AF-A0A239AIM3-F1-model_v4 Chromate transporter, chromate ion transporter (CHR) family 0.9154 6 105 GO:0005886
GO:0015109
AF-A0A399SQ28-F1-model_v4 Chromate efflux transporter 0.9126 1 102 GO:0005886
GO:0015109
AF-A0A7J5V7S9-F1-model_v4 Chromate transporter 0.8989 3 95 GO:0005886
GO:0015109

Map