F446309

General Info

Members Datasets Scaffolds Average Seq Length
449 240 449 247

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100192899|Ga0070680_1001928992
Length 252
Sequence MRLFRHELKGELLLYVRSRELAFFTFLLPMIFFLLLASVYGNDRIKSEGNVRSAPFLQAGMIGYGAISIAFAGLAIVVVIRREAGILKRLRATPLPAPVYLISLLSAFLAAFALEVVGLLLLGRLFFSIGFPGRPLSLALALILGAVAFCGLGIGLTAVIKSAEGASAVVNAIYLPMAFICGAFFSPHSYPAFLRGIAAVLPLTYFLRLVRNVMLHGHEIWSQGTNVAVLAAWGIGGLLVAVRSFRWEPTEG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
116 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.46
Rhizosphere 91.09
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10003550 3300003373 Bacteria 3745
2 JGI25407J50210_10015639 3300003373 Bacteria 1961
3 Ga0070683_100008282 3300005329 Bacteria 8837
4 Ga0070683_100017182 3300005329 Bacteria 6390
5 Ga0070683_100095037 3300005329 Bacteria 2802
6 Ga0070680_100192899 3300005336 Bacteria 1717
7 Ga0070682_100388790 3300005337 Bacteria 1051
8 Ga0068868_100032049 3300005338 Bacteria 4041
9 Ga0068868_100151559 3300005338 Bacteria 1909
10 Ga0070691_10046854 3300005341 Bacteria 2054
11 Ga0070687_100100018 3300005343 Bacteria 1622
12 Ga0070668_100004587 3300005347 Bacteria 10238
13 Ga0070668_100351460 3300005347 Bacteria 1248
14 Ga0070671_100155705 3300005355 Bacteria 1930
15 Ga0070659_100091030 3300005366 Bacteria 2445
16 Ga0070659_100176930 3300005366 Bacteria 1750
17 Ga0070713_100026736 3300005436 Bacteria 4535
18 Ga0070713_100533779 3300005436 Bacteria 1110
19 Ga0070705_100123520 3300005440 Unclassified 1676
20 Ga0070705_100166842 3300005440 Bacteria 1478
21 Ga0070678_100026127 3300005456 Bacteria 3942
22 Ga0070678_100069609 3300005456 Bacteria 2628
23 Ga0070678_100199115 3300005456 Bacteria 1652
24 Ga0070662_100071738 3300005457 Bacteria 2555
25 Ga0070662_100109255 3300005457 Unclassified 2104
26 Ga0070662_100206939 3300005457 Unclassified 1559
27 Ga0070681_10214171 3300005458 Bacteria 1843
28 Ga0068867_100073062 3300005459 Bacteria 2568
29 Ga0070685_10253489 3300005466 Bacteria 1167
30 Ga0070706_100016125 3300005467 Bacteria 6899
31 Ga0070706_100226383 3300005467 Bacteria 1745
32 Ga0070707_100136002 3300005468 Bacteria 2391
33 Ga0070707_100630955 3300005468 Unclassified 1034
34 Ga0070707_100713070 3300005468 Bacteria 966
35 Ga0070698_100018471 3300005471 Bacteria 7341
36 Ga0070698_100189653 3300005471 Bacteria 1994
37 Ga0070698_100610657 3300005471 Unclassified 1031
38 Ga0070699_100015644 3300005518 Bacteria 6516
39 Ga0070679_100364413 3300005530 Bacteria 1392
40 Ga0070684_100005963 3300005535 Bacteria 9387
41 Ga0070684_100456965 3300005535 Unclassified 1181
42 Ga0070684_100514859 3300005535 Bacteria 1109
43 Ga0070684_100520231 3300005535 Bacteria 1103
44 Ga0070697_100184946 3300005536 Bacteria 1767
45 Ga0068853_100465200 3300005539 Bacteria 1191
46 Ga0070672_100197121 3300005543 Bacteria 1683
47 Ga0070686_100110124 3300005544 Bacteria 1875
48 Ga0070686_100183734 3300005544 Bacteria 1487
49 Ga0070695_100206970 3300005545 Bacteria 1406
50 Ga0070696_100025706 3300005546 Bacteria 4005
51 Ga0070693_100003253 3300005547 Bacteria 7541
52 Ga0070693_100022592 3300005547 Bacteria 3347
53 Ga0070704_100162461 3300005549 Bacteria 1768
54 Ga0070704_100388945 3300005549 Unclassified 1187
55 Ga0068855_100030414 3300005563 Bacteria 6460
56 Ga0068855_100225840 3300005563 Bacteria 2098
57 Ga0070664_100672441 3300005564 Bacteria 963
58 Ga0068857_100080991 3300005577 Bacteria 2899
59 Ga0068857_100493306 3300005577 Bacteria 1149
60 Ga0068854_100100917 3300005578 Bacteria 2164
61 Ga0068856_100081404 3300005614 Bacteria 3212
62 Ga0068856_100159290 3300005614 Bacteria 2267
63 Ga0068859_100343556 3300005617 Bacteria 1587
64 Ga0068861_100010835 3300005719 Bacteria 6337
65 Ga0068862_100154469 3300005844 Bacteria 2044
66 Ga0081455_10029952 3300005937 Bacteria 4954
67 Ga0081455_10047942 3300005937 Bacteria 3695
68 Ga0081455_10049903 3300005937 Bacteria 3604
69 Ga0081455_10122181 3300005937 Bacteria 2050
70 Ga0081455_10135695 3300005937 Bacteria 1918
71 Ga0081538_10000175 3300005981 Bacteria 69198
72 Ga0081538_10000873 3300005981 Bacteria 32578
73 Ga0081538_10001591 3300005981 Bacteria 23294
74 Ga0081538_10001935 3300005981 Bacteria 20723
75 Ga0081538_10005139 3300005981 Bacteria 11864
76 Ga0081538_10029740 3300005981 Bacteria 3725
77 Ga0081538_10100827 3300005981 Bacteria 1455
78 Ga0081540_1012601 3300005983 Bacteria 5551
79 Ga0081540_1020691 3300005983 Bacteria 3947
80 Ga0081540_1029262 3300005983 Bacteria 3073
81 Ga0081539_10000913 3300005985 Bacteria 55913
82 Ga0070717_10012032 3300006028 Bacteria 6590
83 Ga0070717_10023017 3300006028 Bacteria 4930
84 Ga0075432_10014770 3300006058 Bacteria 2659
85 Ga0070715_10028498 3300006163 Bacteria 2240
86 Ga0070716_100033721 3300006173 Bacteria 2802
87 Ga0070712_100080096 3300006175 Bacteria 2363
88 Ga0070712_100387263 3300006175 Bacteria 1152
89 Ga0097621_100287314 3300006237 Unclassified 1449
90 Ga0068871_100163323 3300006358 Bacteria 1905
91 Ga0075428_100010256 3300006844 Bacteria 10403
92 Ga0075428_100097682 3300006844 Bacteria 3202
93 Ga0075431_100121660 3300006847 Bacteria 2693
94 Ga0075431_100661077 3300006847 Bacteria 1025
95 Ga0075433_10149173 3300006852 Bacteria 2080
96 Ga0075433_10210818 3300006852 Bacteria 1726
97 Ga0075433_10428765 3300006852 Bacteria 1166
98 Ga0075433_10604708 3300006852 Bacteria 962
99 Ga0075433_10748204 3300006852 Bacteria 855
100 Ga0075434_100308319 3300006871 Bacteria 1603
101 Ga0075429_100056229 3300006880 Bacteria 3424
102 Ga0075429_100167301 3300006880 Bacteria 1926
103 Ga0075436_100026753 3300006914 Bacteria 3972
104 Ga0097620_100343524 3300006931 Bacteria 1587
105 Ga0075435_100013928 3300007076 Bacteria 5997
106 Ga0075435_100033158 3300007076 Bacteria 4081
107 Ga0075435_100172704 3300007076 Bacteria 1824
108 Ga0105240_10372170 3300009093 Bacteria 1615
109 Ga0111539_10044197 3300009094 Bacteria 5337
110 Ga0111539_10389067 3300009094 Bacteria 1624
111 Ga0111539_10393261 3300009094 Bacteria 1615
112 Ga0105245_10036992 3300009098 Bacteria 4338
113 Ga0105245_10072459 3300009098 Bacteria 3130
114 Ga0105245_10153137 3300009098 Bacteria 2182
115 Ga0105245_10558481 3300009098 Unclassified 1167
116 Ga0114129_10013239 3300009147 Bacteria 11748
117 Ga0114129_10524567 3300009147 Bacteria 1544
118 Ga0105243_10035709 3300009148 Bacteria 3854
119 Ga0105241_10107928 3300009174 Bacteria 2224
120 Ga0105242_10120932 3300009176 Bacteria 2247
121 Ga0105249_10028829 3300009553 Bacteria 5011
122 Ga0105239_10012162 3300010375 Bacteria 9595
123 Ga0105239_10061963 3300010375 Bacteria 4106
124 Ga0105239_10305813 3300010375 Bacteria 1791
125 Ga0105246_10671697 3300011119 Bacteria 904
126 Ga0157322_1006145 3300012490 Bacteria 850
127 Ga0157371_10131276 3300013102 Bacteria 1782
128 Ga0157378_10649183 3300013297 Bacteria 1071
129 Ga0163162_10157777 3300013306 Bacteria 2390
130 Ga0163162_10162298 3300013306 Bacteria 2356
131 Ga0163162_10227562 3300013306 Bacteria 1995
132 Ga0157372_10003201 3300013307 Bacteria 17676
133 Ga0157375_10209189 3300013308 Bacteria 2108
134 Ga0157375_11006326 3300013308 Unclassified 973
135 Ga0163163_10494881 3300014325 Bacteria 1284
136 Ga0157376_10381592 3300014969 Unclassified 1358
137 Ga0163161_10311538 3300017792 Bacteria 1242
138 Ga0207685_10012859 3300025905 Bacteria 2570
139 Ga0207645_10178884 3300025907 Unclassified 1391
140 Ga0207684_10077701 3300025910 Bacteria 2823
141 Ga0207684_10122284 3300025910 Bacteria 2232
142 Ga0207695_10480362 3300025913 Bacteria 1125
143 Ga0207671_10328542 3300025914 Unclassified 1211
144 Ga0207660_10241092 3300025917 Bacteria 1424
145 Ga0207662_10081980 3300025918 Bacteria 1970
146 Ga0207646_10259828 3300025922 Bacteria 1569
147 Ga0207646_10335250 3300025922 Bacteria 1366
148 Ga0207687_10029795 3300025927 Bacteria 3673
149 Ga0207700_10302801 3300025928 Bacteria 1381
150 Ga0207644_10511238 3300025931 Bacteria 992
151 Ga0207706_10014516 3300025933 Bacteria 7139
152 Ga0207706_10039818 3300025933 Bacteria 4167
153 Ga0207686_10423585 3300025934 Unclassified 1019
154 Ga0207709_10033049 3300025935 Bacteria 3034
155 Ga0207669_10166755 3300025937 Bacteria 1563
156 Ga0207704_10526068 3300025938 Unclassified 957
157 Ga0207665_10005605 3300025939 Bacteria 8368
158 Ga0207711_10234761 3300025941 Bacteria 1680
159 Ga0207711_10476215 3300025941 Bacteria 1163
160 Ga0207661_10105087 3300025944 Bacteria 2379
161 Ga0207661_10220683 3300025944 Bacteria 1675
162 Ga0207661_10522184 3300025944 Bacteria 1086
163 Ga0207679_10650905 3300025945 Bacteria 953
164 Ga0207667_10291845 3300025949 Bacteria 1666
165 Ga0207667_10835250 3300025949 Bacteria 916
166 Ga0207712_10009692 3300025961 Bacteria 6105
167 Ga0207640_10118502 3300025981 Bacteria 1891
168 Ga0207640_10180507 3300025981 Bacteria 1582
169 Ga0207677_10147833 3300026023 Unclassified 1808
170 Ga0207677_10187831 3300026023 Bacteria 1632
171 Ga0207703_10187014 3300026035 Bacteria 1832
172 Ga0207708_10002970 3300026075 Bacteria 12504
173 Ga0207702_10097601 3300026078 Bacteria 2586
174 Ga0207648_10006997 3300026089 Bacteria 11154
175 Ga0207648_10030363 3300026089 Bacteria 4787
176 Ga0207674_10002488 3300026116 Bacteria 23230
177 Ga0207674_10613686 3300026116 Unclassified 1050
178 Ga0207675_100002514 3300026118 Bacteria 18148
179 Ga0207675_100011847 3300026118 Bacteria 8149
180 Ga0207675_100364647 3300026118 Unclassified 1418
181 Ga0207683_10000623 3300026121 Bacteria 32551
182 Ga0207683_10137471 3300026121 Bacteria 2200
183 Ga0207698_10393339 3300026142 Unclassified 1322
184 Ga0207428_10006284 3300027907 Bacteria 10983
185 Ga0268265_10104095 3300028380 Bacteria 2300
186 Ga0307409_100101962 3300031995 Bacteria 2383
187 Ga0307416_100233637 3300032002 Bacteria 1775
188 Ga0307416_100243640 3300032002 Bacteria 1744
189 Ga0307415_100074150 3300032126 Bacteria 2404
190 Ga0307415_100405591 3300032126 Bacteria 1165
191 Ga0373958_0009954 3300034819 Bacteria 1576
192 Ga0373959_0049333 3300034820 Bacteria 905
193 Ga0373949_0003734 3300035090 Bacteria 3557
194 Ga0373932_0031428 3300035112 Bacteria 1479
195 Ga0373960_0004035 3300035121 Bacteria 3351
196 Ga0373943_0232623 3300035170 Bacteria 1030
197 Ga0373946_0053404 3300035171 Bacteria 1697
198 Ga0373962_0088846 3300035242 Bacteria 949
199 Ga0373931_0036219 3300035691 Bacteria 2571
200 Ga0373947_0025490 3300035725 Bacteria 3449
201 Ga0373937_0291049 3300036401 Bacteria 1543
202 Ga0373925_0055367 3300037068 Bacteria 2969
203 Ga0395899_0003491 3300037312 Bacteria 12458
204 Ga0395899_0005155 3300037312 Bacteria 10163
205 Ga0395899_0008581 3300037312 Bacteria 7868
206 Ga0395899_0010989 3300037312 Bacteria 6934
207 Ga0395899_0032937 3300037312 Bacteria 3894
208 Ga0395899_0145685 3300037312 Bacteria 1682
209 Ga0395900_0009143 3300037418 Bacteria 10149
210 Ga0395900_0009571 3300037418 Bacteria 9933
211 Ga0395900_0012221 3300037418 Bacteria 8778
212 Ga0395900_0021032 3300037418 Bacteria 6667
213 Ga0395900_0031356 3300037418 Bacteria 5460
214 Ga0395900_0039221 3300037418 Bacteria 4880
215 Ga0395900_0210370 3300037418 Bacteria 1964
216 Ga0395900_0615771 3300037418 Bacteria 1025
217 Ga0395900_0788856 3300037418 Bacteria 878
218 Ga0395898_0005135 3300037466 Bacteria 14165
219 Ga0395898_0008414 3300037466 Bacteria 10908
220 Ga0395898_0010080 3300037466 Bacteria 9890
221 Ga0395898_0013069 3300037466 Bacteria 8557
222 Ga0395898_0022678 3300037466 Bacteria 6355
223 Ga0395898_0026261 3300037466 Bacteria 5862
224 Ga0395898_0051893 3300037466 Bacteria 4008
225 Ga0395898_0483868 3300037466 Bacteria 1177
226 Ga0395898_0542923 3300037466 Bacteria 1104
227 Ga0395905_0002978 3300037471 Bacteria 18388
228 Ga0395905_0003417 3300037471 Bacteria 16981
229 Ga0395905_0016538 3300037471 Bacteria 7012
230 Ga0395905_0030243 3300037471 Bacteria 5105
231 Ga0395905_0042959 3300037471 Bacteria 4240
232 Ga0395905_0193545 3300037471 Bacteria 1907
233 Ga0395905_0367615 3300037471 Bacteria 1331
234 Ga0395901_0000500 3300038443 Bacteria 45375
235 Ga0395901_0000717 3300038443 Bacteria 37735
236 Ga0395901_0004515 3300038443 Bacteria 14036
237 Ga0395901_0020163 3300038443 Bacteria 6823
238 Ga0395901_0026873 3300038443 Bacteria 5909
239 Ga0395901_0030141 3300038443 Bacteria 5588
240 Ga0395901_0033107 3300038443 Bacteria 5333
241 Ga0395901_0117806 3300038443 Bacteria 2790
242 Ga0395901_0392878 3300038443 Bacteria 1426
243 Ga0395901_0400965 3300038443 Unclassified 1409
244 Ga0395901_0432647 3300038443 Bacteria 1348
245 Ga0451802_0837705 3300041460 Bacteria 1176
246 Ga0451853_0457980 3300041512 Bacteria 2116
247 Ga0451853_2311355 3300041512 Bacteria 2893
248 Ga0439448_0013632 3300042005 Bacteria 2444
249 Ga0439448_0022587 3300042005 Bacteria 1957
250 Ga0439455_0047597 3300042012 Unclassified 1113
251 Ga0439458_0017804 3300042157 Bacteria 1624
252 Ga0450908_022615 3300042184 Bacteria 1101
253 Ga0466964_0097757 3300044706 Bacteria 1289
254 Ga0466960_0309014 3300044901 Bacteria 893
255 Ga0451576_0196247 3300045051 Bacteria 2108
256 Ga0495592_0096588 3300046454 Bacteria 2112
257 Ga0495603_0005465 3300046455 Bacteria 7585
258 Ga0495603_0112936 3300046455 Bacteria 1584
259 Ga0495590_0098749 3300046457 Bacteria 1037
260 Ga0495641_0013192 3300046461 Bacteria 4562
261 Ga0495653_0083343 3300046463 Bacteria 2358
262 Ga0495580_0084197 3300046472 Bacteria 2215
263 Ga0495582_0028772 3300046473 Bacteria 3050
264 Ga0495582_0181476 3300046473 Bacteria 1199
265 Ga0495605_0058334 3300046474 Unclassified 1856
266 Ga0495605_0124911 3300046474 Bacteria 1164
267 Ga0495639_0046595 3300046475 Bacteria 1963
268 Ga0495639_0049047 3300046475 Bacteria 1916
269 Ga0495639_0212118 3300046475 Bacteria 950
270 Ga0495584_0040048 3300046491 Bacteria 2367
271 Ga0495584_0079280 3300046491 Bacteria 1652
272 Ga0495584_0191027 3300046491 Bacteria 1041
273 Ga0495594_0001108 3300046499 Bacteria 14063
274 Ga0495608_0084101 3300046511 Bacteria 2065
275 Ga0495616_0181602 3300046513 Bacteria 935
276 Ga0495630_0122467 3300046517 Bacteria 1973
277 Ga0495631_0082851 3300046518 Bacteria 1383
278 Ga0495631_0083811 3300046518 Bacteria 1374
279 Ga0495644_0070131 3300046523 Bacteria 1317
280 Ga0495666_0049912 3300046526 Bacteria 2012
281 Ga0495642_0102374 3300046528 Bacteria 1220
282 Ga0495652_0240698 3300046529 Bacteria 1346
283 Ga0495665_0100902 3300046531 Bacteria 1515
284 Ga0495640_0154595 3300046533 Bacteria 1473
285 Ga0495598_0054092 3300046537 Unclassified 1218
286 Ga0495609_0073867 3300046538 Unclassified 1496
287 Ga0495609_0110476 3300046538 Bacteria 1187
288 Ga0495622_0081156 3300046557 Bacteria 1492
289 Ga0495656_0008666 3300046615 Bacteria 3638
290 Ga0495656_0070255 3300046615 Bacteria 1553
291 Ga0495611_0028518 3300046648 Bacteria 2445
292 Ga0495635_0474501 3300046663 Bacteria 825
293 Ga0495659_0017750 3300046664 Bacteria 2363
294 Ga0495659_0059072 3300046664 Bacteria 1413
295 Ga0495659_0127884 3300046664 Bacteria 1006
296 Ga0495661_0146159 3300046665 Bacteria 1281
297 Ga0495588_0008444 3300046674 Bacteria 4727
298 Ga0495599_0115233 3300046678 Bacteria 1672
299 Ga0495670_0081107 3300046691 Bacteria 1653
300 Ga0495670_0171372 3300046691 Bacteria 1143
301 Ga0495589_0068579 3300046794 Bacteria 1735
302 Ga0495581_0022244 3300047315 Bacteria 3674
303 Ga0495676_0003051 3300047321 Bacteria 15152
304 Ga0495676_0361584 3300047321 Bacteria 969
305 Ga0495679_084702 3300047446 Bacteria 896
306 Ga0495685_057705 3300047447 Unclassified 1311
307 Ga0495684_0024605 3300047471 Bacteria 4633
308 Ga0496100_0244174 3300048903 Bacteria 1326
309 Ga0496101_0032582 3300048904 Bacteria 3670
310 Ga0496101_0111765 3300048904 Bacteria 2057
311 Ga0496102_0305866 3300048905 Bacteria 1498
312 Ga0496102_0348627 3300048905 Bacteria 1394
313 Ga0496102_0454236 3300048905 Bacteria 1202
314 Ga0496103_0053398 3300048906 Bacteria 2505
315 Ga0496103_0057328 3300048906 Bacteria 2418
316 Ga0496104_0000811 3300048907 Bacteria 26887
317 Ga0496104_0000845 3300048907 Bacteria 26457
318 Ga0496104_0028834 3300048907 Bacteria 5145
319 Ga0496104_0222782 3300048907 Bacteria 1798
320 Ga0496105_0000042 3300048908 Bacteria 114886
321 Ga0496105_0000556 3300048908 Bacteria 24657
322 Ga0496105_0014115 3300048908 Bacteria 6356
323 Ga0496107_0319154 3300048910 Bacteria 1156
324 Ga0496108_0218767 3300048911 Bacteria 1654
325 Ga0496108_0517587 3300048911 Unclassified 1042
326 Ga0496109_0076817 3300048912 Bacteria 3072
327 Ga0496109_0155277 3300048912 Bacteria 2143
328 Ga0496109_0204788 3300048912 Bacteria 1855
329 Ga0496110_0000135 3300048913 Bacteria 42562
330 Ga0496110_0024298 3300048913 Bacteria 5163
331 Ga0496110_0029419 3300048913 Bacteria 4727
332 Ga0496111_0001568 3300048914 Bacteria 13195
333 Ga0496111_0011206 3300048914 Bacteria 6035
334 Ga0496111_0018246 3300048914 Bacteria 4859
335 Ga0496111_0042264 3300048914 Bacteria 3272
336 Ga0496111_0076253 3300048914 Bacteria 2444
337 Ga0496111_0543342 3300048914 Bacteria 853
338 Ga0496112_0003815 3300048915 Bacteria 12595
339 Ga0496112_0034646 3300048915 Bacteria 4913
340 Ga0496112_0064617 3300048915 Bacteria 3611
341 Ga0496113_0000695 3300048916 Bacteria 17177
342 Ga0496113_0036173 3300048916 Bacteria 3616
343 Ga0496113_0175484 3300048916 Bacteria 1698
344 Ga0496114_0218584 3300048917 Unclassified 1672
345 Ga0501031_0000822 3300049568 Bacteria 18682
346 Ga0501031_0006168 3300049568 Bacteria 7826
347 Ga0501032_0004405 3300049569 Bacteria 10630
348 Ga0501033_0000862 3300049570 Bacteria 27744
349 Ga0501034_0077206 3300049571 Bacteria 3336
350 Ga0501036_0000938 3300049572 Bacteria 21916
351 Ga0501036_0140868 3300049572 Bacteria 2035
352 Ga0501037_0003441 3300049573 Bacteria 11505
353 Ga0501037_0464333 3300049573 Unclassified 862
354 Ga0501038_0000933 3300049574 Bacteria 26040
355 Ga0501038_0028459 3300049574 Bacteria 4965
356 Ga0501038_0141441 3300049574 Bacteria 1968
357 Ga0501039_0003186 3300049575 Bacteria 12272
358 Ga0501039_0223398 3300049575 Bacteria 1480
359 Ga0501040_0003033 3300049576 Bacteria 10888
360 Ga0501040_0031546 3300049576 Bacteria 3582
361 Ga0501040_0040745 3300049576 Bacteria 3161
362 Ga0501040_0045727 3300049576 Bacteria 2987
363 Ga0501041_0001177 3300049577 Bacteria 14243
364 Ga0501041_0137383 3300049577 Bacteria 1523
365 Ga0501041_0211783 3300049577 Bacteria 1215
366 Ga0501042_0000761 3300049578 Bacteria 17537
367 Ga0501042_0039048 3300049578 Bacteria 3373
368 Ga0501043_0002346 3300049579 Bacteria 16049
369 Ga0501043_0150968 3300049579 Bacteria 1818
370 Ga0501043_0154949 3300049579 Bacteria 1792
371 Ga0501046_0008844 3300049580 Bacteria 8746
372 Ga0501046_0105613 3300049580 Bacteria 2157
373 Ga0501047_0000244 3300049581 Bacteria 64596
374 Ga0501048_0000223 3300049582 Bacteria 37247
375 Ga0501048_0117158 3300049582 Bacteria 1881
376 Ga0501067_0003969 3300049583 Bacteria 8163
377 Ga0501068_0000806 3300049584 Bacteria 16281
378 Ga0501068_0026835 3300049584 Bacteria 3397
379 Ga0501069_0000303 3300049585 Bacteria 22395
380 Ga0501069_0001253 3300049585 Bacteria 12430
381 Ga0501070_0028555 3300049586 Bacteria 4679
382 Ga0501071_0000001 3300049587 Bacteria 123952
383 Ga0501071_0028209 3300049587 Bacteria 3954
384 Ga0501071_0079228 3300049587 Bacteria 2401
385 Ga0501071_0183419 3300049587 Bacteria 1568
386 Ga0501072_0000550 3300049588 Bacteria 26960
387 Ga0501072_0038166 3300049588 Bacteria 3769
388 Ga0501072_0052439 3300049588 Bacteria 3211
389 Ga0501074_0001650 3300049590 Bacteria 15137
390 Ga0501074_0015986 3300049590 Bacteria 5456
391 Ga0501074_0103587 3300049590 Bacteria 2037
392 Ga0501075_0000462 3300049591 Bacteria 24174
393 Ga0501075_0039534 3300049591 Bacteria 3530
394 Ga0501075_0049579 3300049591 Bacteria 3156
395 Ga0501076_0000523 3300049592 Bacteria 24385
396 Ga0501076_0022826 3300049592 Bacteria 4813
397 Ga0501076_0042085 3300049592 Bacteria 3596
398 Ga0501077_0000028 3300049593 Bacteria 74757
399 Ga0501077_0039084 3300049593 Bacteria 3021
400 Ga0501077_0062081 3300049593 Bacteria 2371
401 Ga0501079_0000387 3300049741 Bacteria 28343
402 Ga0501079_0046870 3300049741 Bacteria 3335
403 Ga0501079_0094913 3300049741 Bacteria 2311
404 Ga0501079_0321531 3300049741 Bacteria 1211
405 Ga0501080_0001311 3300049742 Bacteria 20737
406 Ga0501080_0099788 3300049742 Bacteria 2694
407 Ga0501081_0000043 3300049743 Bacteria 47758
408 Ga0501081_0048936 3300049743 Bacteria 2909
409 Ga0501081_0347015 3300049743 Bacteria 1094
410 Ga0501083_0000412 3300049744 Bacteria 27299
411 Ga0501035_0001272 3300049822 Bacteria 26065
412 Ga0501035_0014610 3300049822 Bacteria 7248
413 Ga0501044_0017869 3300049823 Bacteria 7608
414 Ga0501044_0083157 3300049823 Bacteria 3238
415 Ga0501045_0007778 3300049824 Bacteria 7454
416 Ga0501045_0039744 3300049824 Bacteria 3423
417 Ga0501045_0165022 3300049824 Bacteria 1649
418 nmdc:mga05p37_141395_c1 3300050507 Bacteria 2949
419 nmdc:mga05p37_65799_c1 3300050507 Bacteria 4460
420 nmdc:mga09592_514857_c1 3300050508 Bacteria 1029
421 nmdc:mga09592_8746_c1 3300050508 Bacteria 8240
422 nmdc:mga0qj67_125385_c1 3300050509 Unclassified 2078
423 nmdc:mga0qj67_58477_c1 3300050509 Bacteria 3057
424 nmdc:mga06r32_722522_c1 3300050510 Bacteria 961
425 nmdc:mga08y16_146805_c1 3300050511 Bacteria 2452
426 nmdc:mga08y16_211088_c1 3300050511 Bacteria 2011
427 nmdc:mga08y16_482288_c1 3300050511 Bacteria 1262
428 nmdc:mga0n895_9311_c1 3300050512 Bacteria 8582
429 nmdc:mga0rr50_139698_c1 3300050513 Bacteria 1948
430 nmdc:mga0rr50_81544_c1 3300050513 Bacteria 2496
431 nmdc:mga0rr50_867552_c1 3300050513 Bacteria 770
432 nmdc:mga08x19_102473_c1 3300050514 Bacteria 1901
433 nmdc:mga0a205_188933_c1 3300050515 Bacteria 1953
434 nmdc:mga0a205_200640_c1 3300050515 Bacteria 1885
435 nmdc:mga0a205_293608_c1 3300050515 Bacteria 1500
436 Ga0495655_0031783 3300053083 Bacteria 1287
437 Ga0495595_0075476 3300053084 Bacteria 1599
438 Ga0495619_0075001 3300053085 Bacteria 2269
439 Ga0495619_0097061 3300053085 Bacteria 2002
440 Ga0501084_0000118 3300054114 Bacteria 60290
441 Ga0501084_0035885 3300054114 Bacteria 4144
442 Ga0590075_009915 3300059424 Bacteria 2287
443 Ga0501082_0000720 3300060353 Bacteria 29137
444 Ga0501082_0087721 3300060353 Bacteria 2684
445 Ga0501082_0173598 3300060353 Bacteria 1874
446 Ga0530510_0000507 3300061734 Bacteria 24742
447 Ga0530510_0047306 3300061734 Bacteria 3108
448 Ga0530510_0107335 3300061734 Bacteria 2043
449 Ga0530510_0339543 3300061734 Bacteria 1127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0181602 Ga0495616_0181602_17_634 203
2 3300005981 Ga0081538_10029740 Ga0081538_100297402 211
3 3300011119 Ga0105246_10671697 Ga0105246_106716972 211
4 3300005981 Ga0081538_10100827 Ga0081538_101008272 218
5 3300035170 Ga0373943_0232623 Ga0373943_0232623_358_1020 218
6 3300050513 nmdc:mga0rr50_867552_c1 nmdc:mga0rr50_867552_c1_22_684 218
7 3300032126 Ga0307415_100074150 Ga0307415_1000741502 228
8 3300037312 Ga0395899_0010989 Ga0395899_0010989_3343_4095 228
9 3300037418 Ga0395900_0031356 Ga0395900_0031356_1829_2581 228
10 3300037466 Ga0395898_0008414 Ga0395898_0008414_7457_8209 228
11 3300037471 Ga0395905_0016538 Ga0395905_0016538_1584_2336 228
12 3300038443 Ga0395901_0033107 Ga0395901_0033107_2625_3377 228
13 3300005983 Ga0081540_1012601 Ga0081540_10126016 230
14 3300037418 Ga0395900_0039221 Ga0395900_0039221_3131_3883 230
15 3300037466 Ga0395898_0022678 Ga0395898_0022678_2445_3197 230
16 3300038443 Ga0395901_0004515 Ga0395901_0004515_1955_2707 230
17 3300046491 Ga0495584_0040048 Ga0495584_0040048_478_1227 231
18 3300046523 Ga0495644_0070131 Ga0495644_0070131_325_1074 231
19 3300025913 Ga0207695_10480362 Ga0207695_104803622 232
20 3300032002 Ga0307416_100243640 Ga0307416_1002436402 233
21 3300032126 Ga0307415_100405591 Ga0307415_1004055912 233
22 3300038443 Ga0395901_0400965 Ga0395901_0400965_564_1307 233
23 3300046518 Ga0495631_0083811 Ga0495631_0083811_312_1061 233
24 3300005937 Ga0081455_10029952 Ga0081455_100299524 234
25 3300009094 Ga0111539_10044197 Ga0111539_100441979 234
26 3300042005 Ga0439448_0022587 Ga0439448_0022587_733_1482 234
27 3300042012 Ga0439455_0047597 Ga0439455_0047597_259_1008 234
28 3300046664 Ga0495659_0017750 Ga0495659_0017750_1449_2201 234
29 3300048914 Ga0496111_0011206 Ga0496111_0011206_3787_4527 234
30 3300050511 nmdc:mga08y16_146805_c1 nmdc:mga08y16_146805_c1_1406_2116 234
31 3300046691 Ga0495670_0081107 Ga0495670_0081107_872_1624 235
32 3300009148 Ga0105243_10035709 Ga0105243_100357096 236
33 3300005329 Ga0070683_100095037 Ga0070683_1000950373 237
34 3300005436 Ga0070713_100533779 Ga0070713_1005337792 237
35 3300005564 Ga0070664_100672441 Ga0070664_1006724411 237
36 3300006028 Ga0070717_10023017 Ga0070717_100230173 237
37 3300013308 Ga0157375_10209189 Ga0157375_102091892 237
38 3300025928 Ga0207700_10302801 Ga0207700_103028012 237
39 3300025941 Ga0207711_10234761 Ga0207711_102347614 237
40 3300025944 Ga0207661_10105087 Ga0207661_101050873 237
41 3300026035 Ga0207703_10187014 Ga0207703_101870142 237
42 3300038443 Ga0395901_0026873 Ga0395901_0026873_2658_3407 237
43 3300048903 Ga0496100_0244174 Ga0496100_0244174_146_895 237
44 3300048904 Ga0496101_0032582 Ga0496101_0032582_2579_3328 237
45 3300048907 Ga0496104_0000811 Ga0496104_0000811_238_987 237
46 3300048908 Ga0496105_0000042 Ga0496105_0000042_19926_20675 237
47 3300048911 Ga0496108_0218767 Ga0496108_0218767_71_820 237
48 3300048913 Ga0496110_0000135 Ga0496110_0000135_3298_4047 237
49 3300048914 Ga0496111_0001568 Ga0496111_0001568_3887_4636 237
50 3300048915 Ga0496112_0003815 Ga0496112_0003815_9960_10709 237
51 3300048916 Ga0496113_0000695 Ga0496113_0000695_5821_6570 237
52 3300005535 Ga0070684_100456965 Ga0070684_1004569651 238
53 3300006852 Ga0075433_10149173 Ga0075433_101491732 238
54 3300009147 Ga0114129_10524567 Ga0114129_105245672 238
55 3300012490 Ga0157322_1006145 Ga0157322_10061451 238
56 3300014325 Ga0163163_10494881 Ga0163163_104948812 238
57 3300048912 Ga0496109_0076817 Ga0496109_0076817_2049_2801 238
58 3300048916 Ga0496113_0175484 Ga0496113_0175484_610_1362 238
59 3300050515 nmdc:mga0a205_200640_c1 nmdc:mga0a205_200640_c1_785_1534 238
60 3300005329 Ga0070683_100017182 Ga0070683_1000171824 239
61 3300005471 Ga0070698_100189653 Ga0070698_1001896532 239
62 3300005535 Ga0070684_100005963 Ga0070684_1000059632 239
63 3300005577 Ga0068857_100080991 Ga0068857_1000809913 239
64 3300025944 Ga0207661_10220683 Ga0207661_102206831 239
65 3300026116 Ga0207674_10002488 Ga0207674_1000248841 239
66 3300005338 Ga0068868_100151559 Ga0068868_1001515591 240
67 3300005440 Ga0070705_100166842 Ga0070705_1001668422 240
68 3300005456 Ga0070678_100199115 Ga0070678_1001991154 240
69 3300005458 Ga0070681_10214171 Ga0070681_102141712 240
70 3300005530 Ga0070679_100364413 Ga0070679_1003644132 240
71 3300005535 Ga0070684_100520231 Ga0070684_1005202311 240
72 3300005544 Ga0070686_100110124 Ga0070686_1001101244 240
73 3300005545 Ga0070695_100206970 Ga0070695_1002069702 240
74 3300005547 Ga0070693_100003253 Ga0070693_10000325310 240
75 3300005578 Ga0068854_100100917 Ga0068854_1001009174 240
76 3300009098 Ga0105245_10072459 Ga0105245_100724594 240
77 3300025917 Ga0207660_10241092 Ga0207660_102410922 240
78 3300025941 Ga0207711_10476215 Ga0207711_104762152 240
79 3300025944 Ga0207661_10522184 Ga0207661_105221842 240
80 3300025945 Ga0207679_10650905 Ga0207679_106509051 240
81 3300025981 Ga0207640_10180507 Ga0207640_101805072 240
82 3300026023 Ga0207677_10187831 Ga0207677_101878314 240
83 3300048904 Ga0496101_0111765 Ga0496101_0111765_205_954 240
84 3300048905 Ga0496102_0305866 Ga0496102_0305866_350_1099 240
85 3300048905 Ga0496102_0348627 Ga0496102_0348627_51_800 240
86 3300048907 Ga0496104_0028834 Ga0496104_0028834_3737_4486 240
87 3300048910 Ga0496107_0319154 Ga0496107_0319154_376_1125 240
88 3300048912 Ga0496109_0155277 Ga0496109_0155277_49_798 240
89 3300048913 Ga0496110_0024298 Ga0496110_0024298_3478_4227 240
90 3300048914 Ga0496111_0042264 Ga0496111_0042264_1637_2386 240
91 3300048915 Ga0496112_0034646 Ga0496112_0034646_2819_3568 240
92 3300048916 Ga0496113_0036173 Ga0496113_0036173_807_1556 240
93 3300038443 Ga0395901_0432647 Ga0395901_0432647_353_1111 242
94 3300044706 Ga0466964_0097757 Ga0466964_0097757_405_1154 242
95 3300005329 Ga0070683_100008282 Ga0070683_10000828214 247
96 3300005336 Ga0070680_100192899 Ga0070680_1001928992 247
97 3300005337 Ga0070682_100388790 Ga0070682_1003887902 247
98 3300005338 Ga0068868_100032049 Ga0068868_1000320495 247
99 3300005341 Ga0070691_10046854 Ga0070691_100468541 247
100 3300005343 Ga0070687_100100018 Ga0070687_1001000184 247
101 3300005347 Ga0070668_100004587 Ga0070668_10000458713 247
102 3300005347 Ga0070668_100351460 Ga0070668_1003514602 247
103 3300005355 Ga0070671_100155705 Ga0070671_1001557051 247
104 3300005366 Ga0070659_100091030 Ga0070659_1000910304 247
105 3300005366 Ga0070659_100176930 Ga0070659_1001769302 247
106 3300005436 Ga0070713_100026736 Ga0070713_1000267364 247
107 3300005440 Ga0070705_100123520 Ga0070705_1001235203 247
108 3300005456 Ga0070678_100026127 Ga0070678_1000261273 247
109 3300005456 Ga0070678_100069609 Ga0070678_1000696094 247
110 3300005457 Ga0070662_100071738 Ga0070662_1000717382 247
111 3300005457 Ga0070662_100109255 Ga0070662_1001092553 247
112 3300005457 Ga0070662_100206939 Ga0070662_1002069393 247
113 3300005459 Ga0068867_100073062 Ga0068867_1000730622 247
114 3300005466 Ga0070685_10253489 Ga0070685_102534892 247
115 3300005467 Ga0070706_100016125 Ga0070706_1000161258 247
116 3300005467 Ga0070706_100226383 Ga0070706_1002263832 247
117 3300005468 Ga0070707_100136002 Ga0070707_1001360023 247
118 3300005468 Ga0070707_100630955 Ga0070707_1006309552 247
119 3300005468 Ga0070707_100713070 Ga0070707_1007130701 247
120 3300005471 Ga0070698_100018471 Ga0070698_1000184713 247
121 3300005471 Ga0070698_100610657 Ga0070698_1006106572 247
122 3300005518 Ga0070699_100015644 Ga0070699_1000156443 247
123 3300005535 Ga0070684_100514859 Ga0070684_1005148591 247
124 3300005536 Ga0070697_100184946 Ga0070697_1001849462 247
125 3300005539 Ga0068853_100465200 Ga0068853_1004652002 247
126 3300005543 Ga0070672_100197121 Ga0070672_1001971213 247
127 3300005544 Ga0070686_100183734 Ga0070686_1001837343 247
128 3300005546 Ga0070696_100025706 Ga0070696_1000257061 247
129 3300005547 Ga0070693_100022592 Ga0070693_1000225924 247
130 3300005549 Ga0070704_100162461 Ga0070704_1001624612 247
131 3300005549 Ga0070704_100388945 Ga0070704_1003889451 247
132 3300005563 Ga0068855_100030414 Ga0068855_1000304148 247
133 3300005563 Ga0068855_100225840 Ga0068855_1002258402 247
134 3300005577 Ga0068857_100493306 Ga0068857_1004933062 247
135 3300005614 Ga0068856_100081404 Ga0068856_1000814043 247
136 3300005614 Ga0068856_100159290 Ga0068856_1001592903 247
137 3300005617 Ga0068859_100343556 Ga0068859_1003435562 247
138 3300005719 Ga0068861_100010835 Ga0068861_1000108355 247
139 3300005844 Ga0068862_100154469 Ga0068862_1001544694 247
140 3300005937 Ga0081455_10049903 Ga0081455_100499033 247
141 3300005937 Ga0081455_10135695 Ga0081455_101356952 247
142 3300005983 Ga0081540_1020691 Ga0081540_10206913 247
143 3300005983 Ga0081540_1029262 Ga0081540_10292622 247
144 3300005985 Ga0081539_10000913 Ga0081539_100009136 247
145 3300006028 Ga0070717_10012032 Ga0070717_100120328 247
146 3300006058 Ga0075432_10014770 Ga0075432_100147703 247
147 3300006163 Ga0070715_10028498 Ga0070715_100284982 247
148 3300006173 Ga0070716_100033721 Ga0070716_1000337212 247
149 3300006175 Ga0070712_100080096 Ga0070712_1000800963 247
150 3300006175 Ga0070712_100387263 Ga0070712_1003872632 247
151 3300006237 Ga0097621_100287314 Ga0097621_1002873143 247
152 3300006358 Ga0068871_100163323 Ga0068871_1001633231 247
153 3300006844 Ga0075428_100097682 Ga0075428_1000976825 247
154 3300006847 Ga0075431_100121660 Ga0075431_1001216604 247
155 3300006852 Ga0075433_10210818 Ga0075433_102108182 247
156 3300006852 Ga0075433_10428765 Ga0075433_104287652 247
157 3300006852 Ga0075433_10604708 Ga0075433_106047082 247
158 3300006852 Ga0075433_10748204 Ga0075433_107482041 247
159 3300006871 Ga0075434_100308319 Ga0075434_1003083192 247
160 3300006880 Ga0075429_100167301 Ga0075429_1001673013 247
161 3300006914 Ga0075436_100026753 Ga0075436_1000267534 247
162 3300006931 Ga0097620_100343524 Ga0097620_1003435243 247
163 3300007076 Ga0075435_100013928 Ga0075435_1000139286 247
164 3300007076 Ga0075435_100033158 Ga0075435_1000331582 247
165 3300007076 Ga0075435_100172704 Ga0075435_1001727042 247
166 3300009093 Ga0105240_10372170 Ga0105240_103721702 247
167 3300009094 Ga0111539_10389067 Ga0111539_103890672 247
168 3300009094 Ga0111539_10393261 Ga0111539_103932612 247
169 3300009098 Ga0105245_10036992 Ga0105245_100369926 247
170 3300009098 Ga0105245_10153137 Ga0105245_101531373 247
171 3300009098 Ga0105245_10558481 Ga0105245_105584812 247
172 3300009174 Ga0105241_10107928 Ga0105241_101079283 247
173 3300009176 Ga0105242_10120932 Ga0105242_101209322 247
174 3300009553 Ga0105249_10028829 Ga0105249_100288295 247
175 3300010375 Ga0105239_10012162 Ga0105239_100121626 247
176 3300010375 Ga0105239_10061963 Ga0105239_100619633 247
177 3300010375 Ga0105239_10305813 Ga0105239_103058132 247
178 3300013102 Ga0157371_10131276 Ga0157371_101312762 247
179 3300013297 Ga0157378_10649183 Ga0157378_106491831 247
180 3300013306 Ga0163162_10157777 Ga0163162_101577774 247
181 3300013306 Ga0163162_10162298 Ga0163162_101622982 247
182 3300013306 Ga0163162_10227562 Ga0163162_102275622 247
183 3300013307 Ga0157372_10003201 Ga0157372_1000320110 247
184 3300013308 Ga0157375_11006326 Ga0157375_110063261 247
185 3300014969 Ga0157376_10381592 Ga0157376_103815923 247
186 3300017792 Ga0163161_10311538 Ga0163161_103115381 247
187 3300025905 Ga0207685_10012859 Ga0207685_100128594 247
188 3300025907 Ga0207645_10178884 Ga0207645_101788843 247
189 3300025910 Ga0207684_10077701 Ga0207684_100777014 247
190 3300025910 Ga0207684_10122284 Ga0207684_101222842 247
191 3300025914 Ga0207671_10328542 Ga0207671_103285422 247
192 3300025918 Ga0207662_10081980 Ga0207662_100819803 247
193 3300025922 Ga0207646_10259828 Ga0207646_102598282 247
194 3300025922 Ga0207646_10335250 Ga0207646_103352502 247
195 3300025927 Ga0207687_10029795 Ga0207687_100297952 247
196 3300025931 Ga0207644_10511238 Ga0207644_105112381 247
197 3300025933 Ga0207706_10014516 Ga0207706_1001451610 247
198 3300025933 Ga0207706_10039818 Ga0207706_100398185 247
199 3300025934 Ga0207686_10423585 Ga0207686_104235851 247
200 3300025935 Ga0207709_10033049 Ga0207709_100330493 247
201 3300025937 Ga0207669_10166755 Ga0207669_101667553 247
202 3300025938 Ga0207704_10526068 Ga0207704_105260681 247
203 3300025939 Ga0207665_10005605 Ga0207665_100056054 247
204 3300025949 Ga0207667_10291845 Ga0207667_102918452 247
205 3300025949 Ga0207667_10835250 Ga0207667_108352501 247
206 3300025961 Ga0207712_10009692 Ga0207712_100096928 247
207 3300025981 Ga0207640_10118502 Ga0207640_101185022 247
208 3300026023 Ga0207677_10147833 Ga0207677_101478333 247
209 3300026075 Ga0207708_10002970 Ga0207708_1000297012 247
210 3300026078 Ga0207702_10097601 Ga0207702_100976013 247
211 3300026089 Ga0207648_10006997 Ga0207648_1000699714 247
212 3300026089 Ga0207648_10030363 Ga0207648_100303637 247
213 3300026116 Ga0207674_10613686 Ga0207674_106136862 247
214 3300026118 Ga0207675_100002514 Ga0207675_1000025145 247
215 3300026118 Ga0207675_100011847 Ga0207675_1000118472 247
216 3300026118 Ga0207675_100364647 Ga0207675_1003646472 247
217 3300026121 Ga0207683_10000623 Ga0207683_1000062323 247
218 3300026121 Ga0207683_10137471 Ga0207683_101374712 247
219 3300026142 Ga0207698_10393339 Ga0207698_103933392 247
220 3300027907 Ga0207428_10006284 Ga0207428_100062846 247
221 3300028380 Ga0268265_10104095 Ga0268265_101040952 247
222 3300031995 Ga0307409_100101962 Ga0307409_1001019623 247
223 3300032002 Ga0307416_100233637 Ga0307416_1002336373 247
224 3300034819 Ga0373958_0009954 Ga0373958_0009954_768_1517 247
225 3300034820 Ga0373959_0049333 Ga0373959_0049333_71_820 247
226 3300035090 Ga0373949_0003734 Ga0373949_0003734_1667_2416 247
227 3300035112 Ga0373932_0031428 Ga0373932_0031428_307_1056 247
228 3300035121 Ga0373960_0004035 Ga0373960_0004035_963_1712 247
229 3300035171 Ga0373946_0053404 Ga0373946_0053404_538_1287 247
230 3300035242 Ga0373962_0088846 Ga0373962_0088846_101_850 247
231 3300035691 Ga0373931_0036219 Ga0373931_0036219_379_1128 247
232 3300035725 Ga0373947_0025490 Ga0373947_0025490_2436_3185 247
233 3300036401 Ga0373937_0291049 Ga0373937_0291049_775_1524 247
234 3300037068 Ga0373925_0055367 Ga0373925_0055367_1427_2176 247
235 3300037312 Ga0395899_0003491 Ga0395899_0003491_11417_12166 247
236 3300037312 Ga0395899_0005155 Ga0395899_0005155_3545_4294 247
237 3300037312 Ga0395899_0008581 Ga0395899_0008581_6255_7004 247
238 3300037312 Ga0395899_0145685 Ga0395899_0145685_175_924 247
239 3300037418 Ga0395900_0009143 Ga0395900_0009143_7116_7865 247
240 3300037418 Ga0395900_0009571 Ga0395900_0009571_4161_4910 247
241 3300037418 Ga0395900_0012221 Ga0395900_0012221_5768_6520 247
242 3300037418 Ga0395900_0021032 Ga0395900_0021032_758_1507 247
243 3300037418 Ga0395900_0210370 Ga0395900_0210370_362_1111 247
244 3300037418 Ga0395900_0615771 Ga0395900_0615771_42_800 247
245 3300037418 Ga0395900_0788856 Ga0395900_0788856_115_864 247
246 3300037466 Ga0395898_0005135 Ga0395898_0005135_1292_2044 247
247 3300037466 Ga0395898_0010080 Ga0395898_0010080_2729_3478 247
248 3300037466 Ga0395898_0013069 Ga0395898_0013069_1702_2451 247
249 3300037466 Ga0395898_0026261 Ga0395898_0026261_3679_4428 247
250 3300037466 Ga0395898_0051893 Ga0395898_0051893_1109_1858 247
251 3300037466 Ga0395898_0483868 Ga0395898_0483868_148_897 247
252 3300037466 Ga0395898_0542923 Ga0395898_0542923_185_934 247
253 3300037471 Ga0395905_0002978 Ga0395905_0002978_11492_12241 247
254 3300037471 Ga0395905_0003417 Ga0395905_0003417_3097_3846 247
255 3300037471 Ga0395905_0030243 Ga0395905_0030243_490_1242 247
256 3300037471 Ga0395905_0042959 Ga0395905_0042959_3414_4163 247
257 3300037471 Ga0395905_0193545 Ga0395905_0193545_748_1497 247
258 3300037471 Ga0395905_0367615 Ga0395905_0367615_517_1266 247
259 3300038443 Ga0395901_0000500 Ga0395901_0000500_19738_20490 247
260 3300038443 Ga0395901_0000717 Ga0395901_0000717_6913_7662 247
261 3300038443 Ga0395901_0020163 Ga0395901_0020163_111_860 247
262 3300038443 Ga0395901_0030141 Ga0395901_0030141_640_1389 247
263 3300038443 Ga0395901_0117806 Ga0395901_0117806_397_1146 247
264 3300038443 Ga0395901_0392878 Ga0395901_0392878_540_1298 247
265 3300041460 Ga0451802_0837705 Ga0451802_0837705_407_1165 247
266 3300041512 Ga0451853_0457980 Ga0451853_0457980_957_1709 247
267 3300041512 Ga0451853_2311355 Ga0451853_2311355_742_1500 247
268 3300042005 Ga0439448_0013632 Ga0439448_0013632_837_1586 247
269 3300042157 Ga0439458_0017804 Ga0439458_0017804_120_869 247
270 3300044901 Ga0466960_0309014 Ga0466960_0309014_43_801 247
271 3300045051 Ga0451576_0196247 Ga0451576_0196247_1172_1921 247
272 3300046454 Ga0495592_0096588 Ga0495592_0096588_950_1699 247
273 3300046455 Ga0495603_0005465 Ga0495603_0005465_5524_6273 247
274 3300046455 Ga0495603_0112936 Ga0495603_0112936_291_1040 247
275 3300046457 Ga0495590_0098749 Ga0495590_0098749_229_978 247
276 3300046461 Ga0495641_0013192 Ga0495641_0013192_790_1542 247
277 3300046463 Ga0495653_0083343 Ga0495653_0083343_1094_1843 247
278 3300046472 Ga0495580_0084197 Ga0495580_0084197_973_1722 247
279 3300046473 Ga0495582_0028772 Ga0495582_0028772_1736_2485 247
280 3300046473 Ga0495582_0181476 Ga0495582_0181476_207_959 247
281 3300046474 Ga0495605_0058334 Ga0495605_0058334_849_1601 247
282 3300046474 Ga0495605_0124911 Ga0495605_0124911_285_1043 247
283 3300046475 Ga0495639_0046595 Ga0495639_0046595_537_1286 247
284 3300046475 Ga0495639_0049047 Ga0495639_0049047_626_1378 247
285 3300046475 Ga0495639_0212118 Ga0495639_0212118_73_822 247
286 3300046491 Ga0495584_0079280 Ga0495584_0079280_837_1586 247
287 3300046491 Ga0495584_0191027 Ga0495584_0191027_38_790 247
288 3300046499 Ga0495594_0001108 Ga0495594_0001108_12022_12771 247
289 3300046511 Ga0495608_0084101 Ga0495608_0084101_1099_1848 247
290 3300046517 Ga0495630_0122467 Ga0495630_0122467_1004_1753 247
291 3300046518 Ga0495631_0082851 Ga0495631_0082851_269_1027 247
292 3300046526 Ga0495666_0049912 Ga0495666_0049912_761_1510 247
293 3300046528 Ga0495642_0102374 Ga0495642_0102374_46_804 247
294 3300046529 Ga0495652_0240698 Ga0495652_0240698_375_1124 247
295 3300046531 Ga0495665_0100902 Ga0495665_0100902_667_1416 247
296 3300046533 Ga0495640_0154595 Ga0495640_0154595_700_1449 247
297 3300046537 Ga0495598_0054092 Ga0495598_0054092_121_879 247
298 3300046538 Ga0495609_0073867 Ga0495609_0073867_619_1377 247
299 3300046538 Ga0495609_0110476 Ga0495609_0110476_390_1139 247
300 3300046557 Ga0495622_0081156 Ga0495622_0081156_132_881 247
301 3300046615 Ga0495656_0008666 Ga0495656_0008666_2505_3263 247
302 3300046615 Ga0495656_0070255 Ga0495656_0070255_703_1455 247
303 3300046648 Ga0495611_0028518 Ga0495611_0028518_755_1507 247
304 3300046663 Ga0495635_0474501 Ga0495635_0474501_31_780 247
305 3300046664 Ga0495659_0059072 Ga0495659_0059072_321_1070 247
306 3300046664 Ga0495659_0127884 Ga0495659_0127884_38_790 247
307 3300046665 Ga0495661_0146159 Ga0495661_0146159_376_1134 247
308 3300046674 Ga0495588_0008444 Ga0495588_0008444_2358_3107 247
309 3300046678 Ga0495599_0115233 Ga0495599_0115233_146_895 247
310 3300046691 Ga0495670_0171372 Ga0495670_0171372_292_1050 247
311 3300046794 Ga0495589_0068579 Ga0495589_0068579_22_780 247
312 3300047315 Ga0495581_0022244 Ga0495581_0022244_2067_2819 247
313 3300047321 Ga0495676_0003051 Ga0495676_0003051_1881_2630 247
314 3300047321 Ga0495676_0361584 Ga0495676_0361584_25_777 247
315 3300047446 Ga0495679_084702 Ga0495679_084702_23_775 247
316 3300047447 Ga0495685_057705 Ga0495685_057705_163_921 247
317 3300047471 Ga0495684_0024605 Ga0495684_0024605_2358_3107 247
318 3300048905 Ga0496102_0454236 Ga0496102_0454236_20_769 247
319 3300048906 Ga0496103_0053398 Ga0496103_0053398_365_1114 247
320 3300048906 Ga0496103_0057328 Ga0496103_0057328_1602_2351 247
321 3300048907 Ga0496104_0000845 Ga0496104_0000845_19204_19959 247
322 3300048907 Ga0496104_0222782 Ga0496104_0222782_305_1054 247
323 3300048908 Ga0496105_0000556 Ga0496105_0000556_7301_8056 247
324 3300048908 Ga0496105_0014115 Ga0496105_0014115_510_1259 247
325 3300048911 Ga0496108_0517587 Ga0496108_0517587_114_872 247
326 3300048912 Ga0496109_0204788 Ga0496109_0204788_21_770 247
327 3300048913 Ga0496110_0029419 Ga0496110_0029419_812_1561 247
328 3300048914 Ga0496111_0018246 Ga0496111_0018246_3295_4044 247
329 3300048914 Ga0496111_0076253 Ga0496111_0076253_280_1038 247
330 3300048914 Ga0496111_0543342 Ga0496111_0543342_56_805 247
331 3300048915 Ga0496112_0064617 Ga0496112_0064617_577_1326 247
332 3300048917 Ga0496114_0218584 Ga0496114_0218584_300_1049 247
333 3300049583 Ga0501067_0003969 Ga0501067_0003969_1386_2144 247
334 3300049585 Ga0501069_0001253 Ga0501069_0001253_7020_7778 247
335 3300050507 nmdc:mga05p37_141395_c1 nmdc:mga05p37_141395_c1_1147_1896 247
336 3300050508 nmdc:mga09592_514857_c1 nmdc:mga09592_514857_c1_244_993 247
337 3300050510 nmdc:mga06r32_722522_c1 nmdc:mga06r32_722522_c1_26_775 247
338 3300050511 nmdc:mga08y16_211088_c1 nmdc:mga08y16_211088_c1_409_1158 247
339 3300050511 nmdc:mga08y16_482288_c1 nmdc:mga08y16_482288_c1_360_1109 247
340 3300050512 nmdc:mga0n895_9311_c1 nmdc:mga0n895_9311_c1_3443_4192 247
341 3300050513 nmdc:mga0rr50_139698_c1 nmdc:mga0rr50_139698_c1_537_1286 247
342 3300050513 nmdc:mga0rr50_81544_c1 nmdc:mga0rr50_81544_c1_756_1508 247
343 3300050514 nmdc:mga08x19_102473_c1 nmdc:mga08x19_102473_c1_350_1099 247
344 3300050515 nmdc:mga0a205_188933_c1 nmdc:mga0a205_188933_c1_351_1100 247
345 3300050515 nmdc:mga0a205_293608_c1 nmdc:mga0a205_293608_c1_320_1069 247
346 3300053083 Ga0495655_0031783 Ga0495655_0031783_341_1099 247
347 3300053084 Ga0495595_0075476 Ga0495595_0075476_486_1235 247
348 3300053085 Ga0495619_0075001 Ga0495619_0075001_139_888 247
349 3300053085 Ga0495619_0097061 Ga0495619_0097061_1155_1913 247
350 3300059424 Ga0590075_009915 Ga0590075_009915_1097_1846 247
351 3300003373 JGI25407J50210_10003550 JGI25407J50210_100035501 251
352 3300003373 JGI25407J50210_10015639 JGI25407J50210_100156392 251
353 3300005937 Ga0081455_10047942 Ga0081455_100479424 251
354 3300005937 Ga0081455_10122181 Ga0081455_101221812 251
355 3300005981 Ga0081538_10000175 Ga0081538_100001759 251
356 3300005981 Ga0081538_10000873 Ga0081538_100008735 251
357 3300005981 Ga0081538_10001591 Ga0081538_1000159112 251
358 3300005981 Ga0081538_10001935 Ga0081538_1000193513 251
359 3300005981 Ga0081538_10005139 Ga0081538_100051392 251
360 3300006844 Ga0075428_100010256 Ga0075428_1000102567 251
361 3300006847 Ga0075431_100661077 Ga0075431_1006610771 251
362 3300006880 Ga0075429_100056229 Ga0075429_1000562293 251
363 3300009147 Ga0114129_10013239 Ga0114129_100132394 251
364 3300037312 Ga0395899_0032937 Ga0395899_0032937_1990_2751 251
365 3300042184 Ga0450908_022615 Ga0450908_022615_36_791 251
366 3300049568 Ga0501031_0000822 Ga0501031_0000822_61_816 251
367 3300049568 Ga0501031_0006168 Ga0501031_0006168_1095_1850 251
368 3300049569 Ga0501032_0004405 Ga0501032_0004405_2564_3319 251
369 3300049570 Ga0501033_0000862 Ga0501033_0000862_21077_21832 251
370 3300049571 Ga0501034_0077206 Ga0501034_0077206_915_1670 251
371 3300049572 Ga0501036_0000938 Ga0501036_0000938_6641_7396 251
372 3300049572 Ga0501036_0140868 Ga0501036_0140868_1166_1921 251
373 3300049573 Ga0501037_0003441 Ga0501037_0003441_5913_6668 251
374 3300049573 Ga0501037_0464333 Ga0501037_0464333_16_771 251
375 3300049574 Ga0501038_0000933 Ga0501038_0000933_17842_18597 251
376 3300049574 Ga0501038_0028459 Ga0501038_0028459_2601_3356 251
377 3300049574 Ga0501038_0141441 Ga0501038_0141441_1160_1915 251
378 3300049575 Ga0501039_0003186 Ga0501039_0003186_7444_8199 251
379 3300049575 Ga0501039_0223398 Ga0501039_0223398_295_1050 251
380 3300049576 Ga0501040_0003033 Ga0501040_0003033_2436_3191 251
381 3300049576 Ga0501040_0031546 Ga0501040_0031546_2515_3270 251
382 3300049576 Ga0501040_0040745 Ga0501040_0040745_2350_3105 251
383 3300049576 Ga0501040_0045727 Ga0501040_0045727_134_889 251
384 3300049577 Ga0501041_0001177 Ga0501041_0001177_6045_6800 251
385 3300049577 Ga0501041_0137383 Ga0501041_0137383_204_959 251
386 3300049577 Ga0501041_0211783 Ga0501041_0211783_15_770 251
387 3300049578 Ga0501042_0000761 Ga0501042_0000761_5822_6577 251
388 3300049578 Ga0501042_0039048 Ga0501042_0039048_93_848 251
389 3300049579 Ga0501043_0002346 Ga0501043_0002346_13579_14334 251
390 3300049579 Ga0501043_0150968 Ga0501043_0150968_672_1427 251
391 3300049579 Ga0501043_0154949 Ga0501043_0154949_572_1327 251
392 3300049580 Ga0501046_0008844 Ga0501046_0008844_5885_6640 251
393 3300049580 Ga0501046_0105613 Ga0501046_0105613_1029_1784 251
394 3300049581 Ga0501047_0000244 Ga0501047_0000244_34583_35338 251
395 3300049582 Ga0501048_0000223 Ga0501048_0000223_7444_8199 251
396 3300049582 Ga0501048_0117158 Ga0501048_0117158_70_825 251
397 3300049584 Ga0501068_0000806 Ga0501068_0000806_9614_10369 251
398 3300049584 Ga0501068_0026835 Ga0501068_0026835_1234_1989 251
399 3300049585 Ga0501069_0000303 Ga0501069_0000303_17839_18594 251
400 3300049586 Ga0501070_0028555 Ga0501070_0028555_3787_4542 251
401 3300049587 Ga0501071_0000001 Ga0501071_0000001_5913_6668 251
402 3300049587 Ga0501071_0028209 Ga0501071_0028209_1956_2711 251
403 3300049587 Ga0501071_0079228 Ga0501071_0079228_1496_2251 251
404 3300049587 Ga0501071_0183419 Ga0501071_0183419_646_1401 251
405 3300049588 Ga0501072_0000550 Ga0501072_0000550_7435_8190 251
406 3300049588 Ga0501072_0038166 Ga0501072_0038166_665_1420 251
407 3300049588 Ga0501072_0052439 Ga0501072_0052439_2006_2761 251
408 3300049590 Ga0501074_0001650 Ga0501074_0001650_835_1590 251
409 3300049590 Ga0501074_0015986 Ga0501074_0015986_202_957 251
410 3300049590 Ga0501074_0103587 Ga0501074_0103587_1008_1763 251
411 3300049591 Ga0501075_0000462 Ga0501075_0000462_30_785 251
412 3300049591 Ga0501075_0039534 Ga0501075_0039534_2464_3219 251
413 3300049591 Ga0501075_0049579 Ga0501075_0049579_865_1620 251
414 3300049592 Ga0501076_0000523 Ga0501076_0000523_15486_16241 251
415 3300049592 Ga0501076_0022826 Ga0501076_0022826_447_1202 251
416 3300049592 Ga0501076_0042085 Ga0501076_0042085_2306_3061 251
417 3300049593 Ga0501077_0000028 Ga0501077_0000028_26055_26810 251
418 3300049593 Ga0501077_0039084 Ga0501077_0039084_45_800 251
419 3300049593 Ga0501077_0062081 Ga0501077_0062081_1572_2327 251
420 3300049741 Ga0501079_0000387 Ga0501079_0000387_11601_12356 251
421 3300049741 Ga0501079_0046870 Ga0501079_0046870_1810_2565 251
422 3300049741 Ga0501079_0094913 Ga0501079_0094913_387_1142 251
423 3300049741 Ga0501079_0321531 Ga0501079_0321531_127_882 251
424 3300049742 Ga0501080_0001311 Ga0501080_0001311_15909_16664 251
425 3300049742 Ga0501080_0099788 Ga0501080_0099788_1476_2231 251
426 3300049743 Ga0501081_0000043 Ga0501081_0000043_26055_26810 251
427 3300049743 Ga0501081_0048936 Ga0501081_0048936_1503_2258 251
428 3300049743 Ga0501081_0347015 Ga0501081_0347015_51_806 251
429 3300049744 Ga0501083_0000412 Ga0501083_0000412_5885_6640 251
430 3300049822 Ga0501035_0001272 Ga0501035_0001272_17867_18622 251
431 3300049822 Ga0501035_0014610 Ga0501035_0014610_5734_6489 251
432 3300049823 Ga0501044_0017869 Ga0501044_0017869_431_1186 251
433 3300049823 Ga0501044_0083157 Ga0501044_0083157_255_1010 251
434 3300049824 Ga0501045_0007778 Ga0501045_0007778_874_1629 251
435 3300049824 Ga0501045_0039744 Ga0501045_0039744_2266_3021 251
436 3300049824 Ga0501045_0165022 Ga0501045_0165022_630_1385 251
437 3300050507 nmdc:mga05p37_65799_c1 nmdc:mga05p37_65799_c1_1027_1782 251
438 3300050508 nmdc:mga09592_8746_c1 nmdc:mga09592_8746_c1_605_1360 251
439 3300050509 nmdc:mga0qj67_125385_c1 nmdc:mga0qj67_125385_c1_1189_1944 251
440 3300050509 nmdc:mga0qj67_58477_c1 nmdc:mga0qj67_58477_c1_507_1262 251
441 3300054114 Ga0501084_0000118 Ga0501084_0000118_47492_48247 251
442 3300054114 Ga0501084_0035885 Ga0501084_0035885_2837_3592 251
443 3300060353 Ga0501082_0000720 Ga0501082_0000720_10933_11688 251
444 3300060353 Ga0501082_0087721 Ga0501082_0087721_852_1607 251
445 3300060353 Ga0501082_0173598 Ga0501082_0173598_858_1613 251
446 3300061734 Ga0530510_0000507 Ga0530510_0000507_7444_8199 251
447 3300061734 Ga0530510_0047306 Ga0530510_0047306_2013_2768 251
448 3300061734 Ga0530510_0107335 Ga0530510_0107335_140_895 251
449 3300061734 Ga0530510_0339543 Ga0530510_0339543_250_1005 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

2

215

0.89

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

42

243

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.7098 3 240
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.6961 3 238
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.6849 3 240
7tdt-assembly1.cif.gz_A cryo-em structure of nanodisc-embedded human abca1 0.6844 64 238
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.6765 3 240
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7863 39 241 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7521 28 238 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7091 28 239 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.649 39 241 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6415 28 238 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7V9VGM8-F1-model_v4 Transport permease protein 0.9331 4 238 GO:0043190
GO:0140359
AF-A0A2N2Q0D5-F1-model_v4 Transport permease protein 0.9321 1 243 GO:0043190
GO:0140359
AF-A0A4S3PU22-F1-model_v4 Transport permease protein 0.9305 1 243 GO:0043190
GO:0140359
AF-A0A7D4B0Y5-F1-model_v4 Transport permease protein 0.9299 1 243 GO:0043190
GO:0140359
AF-A0A7X8FQ80-F1-model_v4 Transport permease protein 0.9271 1 243 GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
87.57 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map