F446337

General Info

Members Datasets Scaffolds Average Seq Length
449 240 898 174

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100907405|Ga0068852_1009074052
Length 198
Sequence MAILKFRIYFEEDDSVYRDVVIRHKQSFFDLHEAILKSFEFDNKHAATFYRSNDNWQRGREISLEVYEKKYKAAPLLMKETTIGSEIQDPNQKFIYVYDFAKNWSFQVELINVSKEENPKITYPAVIRKEGIPPSQYGTKSLLGERFTDIEEKYVLTKGAEGFGEEGEEGTTDSTSDEFGGEESASEEEAFFFVERTI

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
182 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
183 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
197 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
200 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
201 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
202 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
203 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
204 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
205 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
206 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
207 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
211 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
212 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
213 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
224 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
225 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
228 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
232 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
233 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
234 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
237 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
238 2738541278 Niastella sp. CF465 Isolate Unclassified
239 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
240 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.22
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.13
Nodule 0
Rhizoplane 0
Rhizosphere 85.3
Stem 0
Stem Tuber 0
Unclassified 13.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100907405 3300005616 Bacteria 898
2 JGI24740J21852_10004081 3300001979 Bacteria 6318
3 JGI24740J21852_10021865 3300001979 Bacteria 2210
4 JGI24737J22298_10127208 3300001990 Bacteria 753
5 JGI25154J39366_1000008 3300002738 Bacteria 315375
6 JGI25158J39367_1011892 3300002739 Bacteria 1153
7 JGI25153J46596_10001413 3300003215 Bacteria 14398
8 rootH1_10060251 3300003316 Bacteria 6452
9 rootH1_10096109 3300003316 Bacteria 1238
10 rootH2_10030144 3300003320 Bacteria 6564
11 rootL2_10044891 3300003322 Bacteria 5631
12 rootH1_10038549 3300003323 Bacteria 10317
13 rootH1_10055347 3300003323 Bacteria 26133
14 rootH1_10111962 3300003323 Bacteria 1603
15 rootH1_10116642 3300003323 Bacteria 1996
16 rootH1_10265137 3300003323 Unclassified 3362
17 rootH1_10374198 3300003323 Bacteria 1934
18 JGI25160J50197_1002257 3300003354 Bacteria 9045
19 Ga0055535_1005622 3300003761 Bacteria 2704
20 Ga0055542_1003917 3300003762 Bacteria 3819
21 Ga0055531_10005359 3300003794 Bacteria 7520
22 Ga0065165_1014717 3300005262 Bacteria 3024
23 Ga0065704_10001498 3300005289 Bacteria 9163
24 Ga0065712_10091398 3300005290 Bacteria 2373
25 Ga0070658_10091083 3300005327 Bacteria 2513
26 Ga0070676_10396415 3300005328 Unclassified 959
27 Ga0070683_100046014 3300005329 Bacteria 4029
28 Ga0070683_100282182 3300005329 Unclassified 1580
29 Ga0070670_100073261 3300005331 Unclassified 2942
30 Ga0070670_100086363 3300005331 Bacteria 2696
31 Ga0070670_100234877 3300005331 Unclassified 1596
32 Ga0068869_100119957 3300005334 Bacteria 2010
33 Ga0068869_100396369 3300005334 Bacteria 1134
34 Ga0070666_10074210 3300005335 Bacteria 2318
35 Ga0070680_100166424 3300005336 Bacteria 1854
36 Ga0070680_101190987 3300005336 Bacteria 659
37 Ga0070682_100025077 3300005337 Bacteria 3556
38 Ga0068868_101189979 3300005338 Bacteria 704
39 Ga0070660_100023293 3300005339 Bacteria 4587
40 Ga0070660_100257834 3300005339 Bacteria 1423
41 Ga0070687_100167658 3300005343 Bacteria 1304
42 Ga0070661_100052441 3300005344 Bacteria 2986
43 Ga0070692_10554349 3300005345 Bacteria 753
44 Ga0070669_100583121 3300005353 Unclassified 935
45 Ga0070675_100014673 3300005354 Bacteria 6180
46 Ga0070675_100286548 3300005354 Bacteria 1449
47 Ga0070675_100820413 3300005354 Bacteria 851
48 Ga0070671_100021409 3300005355 Bacteria 5280
49 Ga0070671_100101961 3300005355 Bacteria 2408
50 Ga0070674_100196408 3300005356 Bacteria 1555
51 Ga0070673_100092153 3300005364 Bacteria 2478
52 Ga0070673_100451779 3300005364 Unclassified 1156
53 Ga0070673_100467087 3300005364 Bacteria 1137
54 Ga0070673_100475363 3300005364 Unclassified 1127
55 Ga0070659_100000832 3300005366 Bacteria 22486
56 Ga0070659_100003144 3300005366 Bacteria 11757
57 Ga0070667_100078976 3300005367 Bacteria 2812
58 Ga0070663_100141848 3300005455 Bacteria 1835
59 Ga0070678_100203881 3300005456 Bacteria 1634
60 Ga0070662_100011837 3300005457 Bacteria 5767
61 Ga0070681_10288233 3300005458 Bacteria 1552
62 Ga0070681_10476266 3300005458 Bacteria 1161
63 Ga0070681_10513000 3300005458 Unclassified 1112
64 Ga0068867_100225040 3300005459 Bacteria 1514
65 Ga0070707_100710515 3300005468 Bacteria 968
66 Ga0070679_100028368 3300005530 Bacteria 5518
67 Ga0070684_100059136 3300005535 Bacteria 3350
68 Ga0070684_100108792 3300005535 Unclassified 2484
69 Ga0068853_100025196 3300005539 Bacteria 4991
70 Ga0068853_100142650 3300005539 Bacteria 2151
71 Ga0068853_100161047 3300005539 Bacteria 2025
72 Ga0068853_100527288 3300005539 Bacteria 1117
73 Ga0070672_100101950 3300005543 Bacteria 2329
74 Ga0070672_100209689 3300005543 Unclassified 1631
75 Ga0070665_100000074 3300005548 Bacteria 192944
76 Ga0068855_100036619 3300005563 Bacteria 5838
77 Ga0068855_100146363 3300005563 Bacteria 2689
78 Ga0068855_100256679 3300005563 Unclassified 1949
79 Ga0070664_100000950 3300005564 Bacteria 22641
80 Ga0070664_100465328 3300005564 Bacteria 1162
81 Ga0068857_100003072 3300005577 Bacteria 13802
82 Ga0068857_100018903 3300005577 Bacteria 6045
83 Ga0068857_100125641 3300005577 Bacteria 2311
84 Ga0068857_100151253 3300005577 Unclassified 2103
85 Ga0068857_100165413 3300005577 Bacteria 2008
86 Ga0068854_100025843 3300005578 Bacteria 4030
87 Ga0068856_100034120 3300005614 Bacteria 4984
88 Ga0068856_100079438 3300005614 Bacteria 3253
89 Ga0068856_100139226 3300005614 Bacteria 2434
90 Ga0068856_100173876 3300005614 Unclassified 2166
91 Ga0070702_100459596 3300005615 Bacteria 925
92 Ga0068852_100001764 3300005616 Bacteria 14723
93 Ga0068852_100002876 3300005616 Bacteria 11944
94 Ga0068852_100005383 3300005616 Bacteria 9151
95 Ga0068852_100095007 3300005616 Bacteria 2676
96 Ga0068852_100096553 3300005616 Bacteria 2657
97 Ga0068852_100263909 3300005616 Unclassified 1654
98 Ga0068852_100344656 3300005616 Bacteria 1453
99 Ga0068864_100199168 3300005618 Bacteria 1839
100 Ga0068864_100630090 3300005618 Bacteria 1043
101 Ga0068851_10214797 3300005834 Bacteria 1078
102 Ga0068870_10189405 3300005840 Unclassified 1240
103 Ga0068860_100000034 3300005843 Bacteria 243128
104 Ga0068860_100009185 3300005843 Bacteria 9826
105 Ga0068860_100045048 3300005843 Bacteria 4205
106 Ga0075366_10397399 3300006195 Bacteria 848
107 Ga0097621_100027306 3300006237 Bacteria 4488
108 Ga0097621_100085669 3300006237 Bacteria 2628
109 Ga0097621_100536989 3300006237 Bacteria 1063
110 Ga0068871_100001620 3300006358 Bacteria 15167
111 Ga0068871_101231515 3300006358 Unclassified 703
112 Ga0075428_100386762 3300006844 Bacteria 1500
113 Ga0075431_100044659 3300006847 Bacteria 4569
114 Ga0075429_100058362 3300006880 Unclassified 3360
115 Ga0068865_100595392 3300006881 Unclassified 934
116 Ga0105240_10000008 3300009093 Bacteria 618862
117 Ga0105240_10000059 3300009093 Bacteria 219860
118 Ga0105240_10000753 3300009093 Bacteria 59090
119 Ga0105240_10016430 3300009093 Bacteria 10021
120 Ga0105240_10059903 3300009093 Bacteria 4748
121 Ga0105240_10134524 3300009093 Bacteria 2962
122 Ga0114129_10014867 3300009147 Bacteria 11089
123 Ga0114129_10068767 3300009147 Bacteria 4937
124 Ga0105241_10004808 3300009174 Bacteria 9951
125 Ga0105241_10066594 3300009174 Bacteria 2786
126 Ga0105241_10075190 3300009174 Bacteria 2632
127 Ga0105241_10372371 3300009174 Bacteria 1246
128 Ga0105241_10590747 3300009174 Bacteria 1002
129 Ga0105237_10000137 3300009545 Bacteria 102639
130 Ga0105237_10000365 3300009545 Bacteria 64152
131 Ga0105237_10019925 3300009545 Bacteria 6925
132 Ga0105237_10057490 3300009545 Bacteria 3892
133 Ga0105237_10272495 3300009545 Bacteria 1695
134 Ga0105237_10278614 3300009545 Bacteria 1675
135 Ga0105237_10352893 3300009545 Bacteria 1475
136 Ga0105238_10001640 3300009551 Bacteria 22429
137 Ga0105238_10079019 3300009551 Bacteria 3279
138 Ga0105238_10499119 3300009551 Bacteria 1217
139 Ga0105239_10013585 3300010375 Bacteria 9039
140 Ga0105239_10017342 3300010375 Bacteria 7965
141 Ga0105239_10083774 3300010375 Bacteria 3512
142 Ga0105239_10519656 3300010375 Bacteria 1354
143 Ga0157373_10010080 3300013100 Bacteria 6963
144 Ga0157373_10063980 3300013100 Bacteria 2604
145 Ga0157373_10185581 3300013100 Bacteria 1465
146 Ga0157371_10014609 3300013102 Bacteria 5918
147 Ga0157371_10040631 3300013102 Bacteria 3321
148 Ga0157371_10061853 3300013102 Bacteria 2655
149 Ga0157371_10187722 3300013102 Bacteria 1479
150 Ga0157370_10010368 3300013104 Bacteria 9824
151 Ga0157370_10287782 3300013104 Bacteria 1518
152 Ga0157370_10460370 3300013104 Bacteria 1169
153 Ga0157369_10006593 3300013105 Bacteria 13423
154 Ga0157369_10081519 3300013105 Bacteria 3462
155 Ga0157369_10192829 3300013105 Unclassified 2140
156 Ga0157369_10243594 3300013105 Bacteria 1877
157 Ga0157369_10703765 3300013105 Bacteria 1040
158 Ga0157369_10752459 3300013105 Bacteria 1002
159 Ga0157369_11387706 3300013105 Bacteria 715
160 Ga0157374_10001675 3300013296 Bacteria 18564
161 Ga0157374_10019513 3300013296 Bacteria 6001
162 Ga0157374_10023310 3300013296 Bacteria 5536
163 Ga0157374_10027788 3300013296 Bacteria 5107
164 Ga0157374_10078178 3300013296 Bacteria 3133
165 Ga0157374_10446192 3300013296 Bacteria 1295
166 Ga0157378_10020257 3300013297 Bacteria 5850
167 Ga0157378_10451300 3300013297 Bacteria 1276
168 Ga0163162_10016723 3300013306 Bacteria 7170
169 Ga0163162_10151141 3300013306 Bacteria 2440
170 Ga0163162_11279332 3300013306 Bacteria 833
171 Ga0157372_10005542 3300013307 Bacteria 13422
172 Ga0157372_10026285 3300013307 Bacteria 6333
173 Ga0157372_10067003 3300013307 Bacteria 4034
174 Ga0157372_10081466 3300013307 Bacteria 3664
175 Ga0157372_10144970 3300013307 Bacteria 2738
176 Ga0157372_10154477 3300013307 Bacteria 2650
177 Ga0157372_10206258 3300013307 Bacteria 2278
178 Ga0157372_10702449 3300013307 Unclassified 1177
179 Ga0157372_10812889 3300013307 Bacteria 1086
180 Ga0157372_10999009 3300013307 Bacteria 969
181 Ga0157372_11334515 3300013307 Bacteria 827
182 Ga0157372_11350344 3300013307 Bacteria 822
183 Ga0157375_10386631 3300013308 Bacteria 1566
184 Ga0157375_10563550 3300013308 Unclassified 1300
185 Ga0163163_10013034 3300014325 Bacteria 7590
186 Ga0157380_10038914 3300014326 Bacteria 3695
187 Ga0157377_10021622 3300014745 Bacteria 3386
188 Ga0157376_10900266 3300014969 Unclassified 903
189 Ga0206356_11653086 3300020070 Bacteria 670
190 Ga0209436_104011 3300025208 Bacteria 3724
191 Ga0209646_1000045 3300025246 Bacteria 333765
192 Ga0209646_1002910 3300025246 Bacteria 3568
193 Ga0209026_1000075 3300025250 Bacteria 202874
194 Ga0209130_1000915 3300025284 Bacteria 23743
195 Ga0209758_1005408 3300025297 Bacteria 9866
196 Ga0207426_1000073 3300025302 Bacteria 323756
197 Ga0207426_1000236 3300025302 Bacteria 125348
198 Ga0207656_10124563 3300025321 Unclassified 1203
199 Ga0207680_10035952 3300025903 Bacteria 2849
200 Ga0207647_10000949 3300025904 Bacteria 22419
201 Ga0207647_10019524 3300025904 Bacteria 4556
202 Ga0207705_10550841 3300025909 Bacteria 897
203 Ga0207654_10011230 3300025911 Bacteria 4565
204 Ga0207654_10032051 3300025911 Bacteria 2899
205 Ga0207654_10366178 3300025911 Bacteria 995
206 Ga0207654_10560261 3300025911 Bacteria 812
207 Ga0207707_10436752 3300025912 Bacteria 1121
208 Ga0207695_10000021 3300025913 Bacteria 679399
209 Ga0207695_10000039 3300025913 Bacteria 454801
210 Ga0207695_10000982 3300025913 Bacteria 50708
211 Ga0207695_10066857 3300025913 Bacteria 3689
212 Ga0207695_10067837 3300025913 Bacteria 3657
213 Ga0207695_10169755 3300025913 Bacteria 2108
214 Ga0207695_10215884 3300025913 Bacteria 1827
215 Ga0207671_10000424 3300025914 Bacteria 58429
216 Ga0207671_10002130 3300025914 Bacteria 21609
217 Ga0207671_10002759 3300025914 Bacteria 18342
218 Ga0207671_10023057 3300025914 Bacteria 4697
219 Ga0207671_10077374 3300025914 Bacteria 2490
220 Ga0207671_10114567 3300025914 Bacteria 2055
221 Ga0207662_10567962 3300025918 Bacteria 787
222 Ga0207657_10004992 3300025919 Bacteria 13947
223 Ga0207649_10183785 3300025920 Unclassified 1465
224 Ga0207649_10191877 3300025920 Bacteria 1437
225 Ga0207649_10207145 3300025920 Bacteria 1389
226 Ga0207652_10031118 3300025921 Bacteria 4479
227 Ga0207652_10240660 3300025921 Bacteria 1631
228 Ga0207694_10048130 3300025924 Bacteria 3299
229 Ga0207694_10800206 3300025924 Bacteria 796
230 Ga0207650_10001164 3300025925 Bacteria 19325
231 Ga0207650_10089075 3300025925 Bacteria 2355
232 Ga0207650_10109201 3300025925 Unclassified 2139
233 Ga0207650_10363660 3300025925 Unclassified 1192
234 Ga0207659_10106278 3300025926 Unclassified 2125
235 Ga0207659_10392493 3300025926 Bacteria 1159
236 Ga0207644_10544516 3300025931 Bacteria 960
237 Ga0207690_10011088 3300025932 Bacteria 5375
238 Ga0207690_10924208 3300025932 Bacteria 724
239 Ga0207706_10007504 3300025933 Bacteria 10089
240 Ga0207704_10971224 3300025938 Unclassified 717
241 Ga0207691_10213706 3300025940 Unclassified 1674
242 Ga0207691_10342950 3300025940 Bacteria 1279
243 Ga0207691_10569472 3300025940 Unclassified 960
244 Ga0207689_10203970 3300025942 Bacteria 1632
245 Ga0207689_10474581 3300025942 Bacteria 1047
246 Ga0207661_10083922 3300025944 Bacteria 2637
247 Ga0207661_10751690 3300025944 Unclassified 897
248 Ga0207679_10033771 3300025945 Bacteria 3603
249 Ga0207679_10933464 3300025945 Unclassified 794
250 Ga0207667_10004578 3300025949 Bacteria 16953
251 Ga0207667_10009515 3300025949 Bacteria 11435
252 Ga0207667_10247233 3300025949 Unclassified 1825
253 Ga0207667_11116782 3300025949 Bacteria 771
254 Ga0207651_10069166 3300025960 Bacteria 2492
255 Ga0207651_10167628 3300025960 Bacteria 1729
256 Ga0207651_10689834 3300025960 Unclassified 899
257 Ga0207640_10128591 3300025981 Bacteria 1827
258 Ga0207658_10059734 3300025986 Bacteria 2842
259 Ga0207658_10854346 3300025986 Bacteria 828
260 Ga0207677_10037523 3300026023 Bacteria 3168
261 Ga0207677_10248423 3300026023 Unclassified 1443
262 Ga0207639_10004585 3300026041 Bacteria 9301
263 Ga0207639_10032669 3300026041 Bacteria 3833
264 Ga0207639_10121869 3300026041 Bacteria 2144
265 Ga0207639_10278340 3300026041 Bacteria 1470
266 Ga0207639_11075582 3300026041 Bacteria 754
267 Ga0207678_10847527 3300026067 Bacteria 807
268 Ga0207702_10099342 3300026078 Bacteria 2565
269 Ga0207702_10156386 3300026078 Bacteria 2078
270 Ga0207641_10085072 3300026088 Bacteria 2755
271 Ga0207648_10021754 3300026089 Bacteria 5763
272 Ga0207648_10861740 3300026089 Bacteria 845
273 Ga0207676_10257700 3300026095 Bacteria 1573
274 Ga0207676_10717891 3300026095 Bacteria 970
275 Ga0207676_11095542 3300026095 Bacteria 787
276 Ga0207674_10004689 3300026116 Bacteria 16408
277 Ga0207674_10029388 3300026116 Bacteria 5786
278 Ga0207674_10073413 3300026116 Unclassified 3435
279 Ga0207674_10160306 3300026116 Bacteria 2204
280 Ga0207674_10415741 3300026116 Bacteria 1299
281 Ga0207674_10717172 3300026116 Bacteria 965
282 Ga0207675_100194783 3300026118 Bacteria 1945
283 Ga0207675_100759727 3300026118 Bacteria 981
284 Ga0207683_10291555 3300026121 Bacteria 1492
285 Ga0207698_10001608 3300026142 Bacteria 13148
286 Ga0207698_10037457 3300026142 Bacteria 3572
287 Ga0207698_10063846 3300026142 Bacteria 2884
288 Ga0207698_10064305 3300026142 Bacteria 2875
289 Ga0207698_10064831 3300026142 Bacteria 2865
290 Ga0207698_10191776 3300026142 Unclassified 1821
291 Ga0207698_10258136 3300026142 Unclassified 1599
292 Ga0207698_10262869 3300026142 Bacteria 1586
293 Ga0209968_1031823 3300027526 Bacteria 884
294 Ga0209999_1016392 3300027543 Unclassified 1348
295 Ga0268266_10000010 3300028379 Bacteria 1030233
296 Ga0268264_10000052 3300028381 Bacteria 321218
297 Ga0268264_10001431 3300028381 Bacteria 22308
298 Ga0268264_10204210 3300028381 Unclassified 1810
299 Ga0307517_10133681 3300028786 Bacteria 1774
300 Ga0307511_10001606 3300030521 Bacteria 23990
301 Ga0265327_10000054 3300031251 Bacteria 250337
302 Ga0265327_10063702 3300031251 Bacteria 1871
303 Ga0307513_10028247 3300031456 Bacteria 6417
304 Ga0307509_10390766 3300031507 Bacteria 1101
305 Ga0307516_10001143 3300031730 Bacteria 37055
306 Ga0307516_10414771 3300031730 Bacteria 1005
307 Ga0307406_10068183 3300031901 Bacteria 2322
308 Ga0307407_10261945 3300031903 Bacteria 1190
309 Ga0307416_100022237 3300032002 Unclassified 4573
310 Ga0307416_101898748 3300032002 Unclassified 699
311 Ga0307414_10562331 3300032004 Bacteria 1018
312 Ga0307415_100059941 3300032126 Bacteria 2627
313 Ga0307510_10000869 3300033180 Bacteria 31741
314 Ga0373935_0583871 3300035692 Unclassified 816
315 Ga0373927_0110428 3300035695 Bacteria 1791
316 Ga0395900_0473941 3300037418 Bacteria 1205
317 Ga0395905_0004912 3300037471 Bacteria 13770
318 Ga0395905_1154029 3300037471 Unclassified 678
319 Ga0395901_1318307 3300038443 Bacteria 683
320 Ga0436365_1876803 3300039437 Bacteria 22992
321 Ga0439436_0053945 3300041404 Bacteria 1131
322 Ga0439439_0015814 3300041406 Bacteria 1844
323 Ga0439439_0065488 3300041406 Bacteria 969
324 Ga0451841_1322386 3300041498 Bacteria 3266
325 Ga0439431_0002975 3300041997 Bacteria 3719
326 Ga0439433_0052526 3300041999 Bacteria 963
327 Ga0439445_0002757 3300042004 Bacteria 3917
328 Ga0439449_0011275 3300042007 Bacteria 3366
329 Ga0439449_0028173 3300042007 Bacteria 2094
330 Ga0451577_0066392 3300042876 Bacteria 3218
331 Ga0466972_0000348 3300044658 Bacteria 25310
332 Ga0466972_0000422 3300044658 Bacteria 21982
333 Ga0466972_0015986 3300044658 Bacteria 3751
334 Ga0466965_0371490 3300044683 Bacteria 786
335 Ga0466961_0246328 3300044693 Bacteria 1098
336 Ga0453684_0030904 3300044712 Bacteria 7551
337 Ga0453684_0235965 3300044712 Bacteria 2108
338 Ga0466968_0087801 3300044735 Bacteria 1374
339 Ga0466968_0107144 3300044735 Bacteria 1253
340 Ga0466970_0001701 3300044765 Bacteria 10578
341 Ga0466957_0000134 3300044842 Bacteria 31410
342 Ga0466957_0008275 3300044842 Bacteria 5912
343 Ga0466957_0225471 3300044842 Unclassified 1239
344 Ga0466957_0649260 3300044842 Bacteria 742
345 Ga0466959_0033328 3300045049 Bacteria 3809
346 Ga0466959_0123511 3300045049 Unclassified 1839
347 Ga0451576_0857981 3300045051 Bacteria 953
348 Ga0466967_0112998 3300045976 Bacteria 2498
349 Ga0466967_0694321 3300045976 Bacteria 1008
350 Ga0466967_1278548 3300045976 Bacteria 731
351 Ga0495638_0049942 3300046460 Bacteria 2614
352 Ga0495638_0173026 3300046460 Unclassified 1238
353 Ga0495606_0022321 3300046507 Bacteria 4613
354 Ga0495632_0288114 3300046519 Bacteria 730
355 Ga0495648_0003458 3300046524 Bacteria 13894
356 Ga0495645_0508859 3300046543 Bacteria 752
357 Ga0495667_0668061 3300046559 Bacteria 645
358 Ga0495611_0000135 3300046648 Bacteria 51495
359 Ga0495625_0437049 3300046660 Bacteria 811
360 Ga0495672_0085000 3300047320 Bacteria 1754
361 Ga0495687_000039 3300047443 Bacteria 245077
362 Ga0495686_0000046 3300047472 Bacteria 281963
363 Ga0501296_024271 3300049519 Bacteria 790
364 Ga0501299_036102 3300049522 Bacteria 974
365 Ga0501300_015121 3300049523 Bacteria 1127
366 Ga0501032_0004185 3300049569 Bacteria 10930
367 Ga0501033_0602689 3300049570 Unclassified 753
368 Ga0501034_0002222 3300049571 Bacteria 23945
369 Ga0501034_0244708 3300049571 Bacteria 1739
370 Ga0501034_0258868 3300049571 Bacteria 1683
371 Ga0501034_0692804 3300049571 Bacteria 918
372 Ga0501036_0132545 3300049572 Bacteria 2103
373 Ga0501037_0003388 3300049573 Bacteria 11590
374 Ga0501038_0017914 3300049574 Bacteria 6399
375 Ga0501039_0054580 3300049575 Bacteria 3093
376 Ga0501043_0011232 3300049579 Bacteria 7015
377 Ga0501043_0111049 3300049579 Bacteria 2152
378 Ga0501043_0469827 3300049579 Bacteria 943
379 Ga0501046_0241186 3300049580 Unclassified 1333
380 Ga0501047_0005548 3300049581 Bacteria 11874
381 Ga0501047_0011539 3300049581 Bacteria 8364
382 Ga0501047_0127838 3300049581 Bacteria 2421
383 Ga0501048_0302343 3300049582 Bacteria 1138
384 Ga0501070_0776838 3300049586 Unclassified 753
385 Ga0501198_006405 3300049649 Unclassified 1676
386 Ga0501202_000389 3300049652 Bacteria 6109
387 Ga0501202_010986 3300049652 Bacteria 1689
388 Ga0501202_036121 3300049652 Bacteria 1051
389 Ga0501217_001947 3300049661 Bacteria 3968
390 Ga0501217_061298 3300049661 Unclassified 1005
391 Ga0501235_009031 3300049669 Bacteria 2176
392 Ga0501242_021935 3300049674 Bacteria 827
393 Ga0501247_006031 3300049677 Unclassified 1364
394 Ga0501247_018730 3300049677 Bacteria 886
395 Ga0501251_048391 3300049681 Bacteria 666
396 Ga0501252_000918 3300049682 Bacteria 2545
397 Ga0501257_004349 3300049686 Bacteria 3090
398 Ga0501257_025953 3300049686 Bacteria 1396
399 Ga0501257_079167 3300049686 Bacteria 846
400 Ga0501259_015512 3300049688 Bacteria 1302
401 Ga0501261_003707 3300049690 Bacteria 1876
402 Ga0501219_001135 3300049703 Bacteria 2960
403 Ga0501221_002983 3300049704 Bacteria 2789
404 Ga0501221_038659 3300049704 Unclassified 1032
405 Ga0501225_0010429 3300049705 Bacteria 2631
406 Ga0501225_0023300 3300049705 Bacteria 1706
407 Ga0501234_004557 3300049707 Unclassified 2181
408 Ga0501245_002779 3300049708 Bacteria 2349
409 Ga0501241_001440 3300049758 Bacteria 4848
410 Ga0501241_002792 3300049758 Bacteria 3355
411 Ga0501266_005724 3300049763 Bacteria 1543
412 Ga0501035_0057807 3300049822 Bacteria 3458
413 Ga0501035_0945308 3300049822 Bacteria 680
414 Ga0501044_0007421 3300049823 Bacteria 12060
415 Ga0501044_0019114 3300049823 Bacteria 7335
416 Ga0501284_00048 3300050005 Bacteria 45450
417 nmdc:mga05p37_10412_c1 3300050507 Bacteria 11036
418 nmdc:mga05p37_226138_c1 3300050507 Bacteria 2256
419 Ga0500578_0000462 3300053086 Bacteria 49481
420 Ga0500578_0068941 3300053086 Bacteria 2254
421 Ga0500644_0037686 3300053088 Bacteria 1582
422 Ga0500644_0270397 3300053088 Bacteria 721
423 Ga0500646_0001881 3300053090 Bacteria 5507
424 Ga0500646_0012381 3300053090 Bacteria 2201
425 Ga0500646_0014587 3300053090 Bacteria 2041
426 Ga0500583_0000031 3300053092 Bacteria 104319
427 Ga0500583_0000923 3300053092 Bacteria 8392
428 Ga0500583_0053552 3300053092 Bacteria 1881
429 Ga0500651_0144626 3300053093 Bacteria 1431
430 Ga0500650_0030255 3300053098 Bacteria 2455
431 Ga0500556_0050095 3300053104 Bacteria 1508
432 Ga0500562_028456 3300053108 Bacteria 1469
433 Ga0500642_0306581 3300053130 Bacteria 715
434 Ga0500652_007986 3300053131 Bacteria 3502
435 Ga0500652_091507 3300053131 Bacteria 1270
436 Ga0500655_008622 3300053133 Unclassified 1836
437 Ga0500568_0016814 3300053139 Bacteria 3241
438 Ga0500577_0216083 3300053142 Bacteria 829
439 Ga0500588_0033219 3300053146 Bacteria 1504
440 Ga0500589_094264 3300053147 Bacteria 1312
441 Ga0500590_215947 3300053148 Unclassified 796
442 Ga0500603_166509 3300053150 Unclassified 689
443 Ga0500622_0076226 3300053156 Bacteria 1686
444 Ga0500622_0143855 3300053156 Bacteria 1134
445 Ga0500639_040814 3300053163 Bacteria 2442
446 Ga0500636_0034813 3300053177 Bacteria 2981
447 2738730516 2738541278 Bacteria 9755573
448 2884791738 2884791551 Bacteria 8511252
449 2896109997 2896109856 Bacteria 7140722
450 Ga0068852_100907405
451 JGI24740J21852_10004081
452 JGI24740J21852_10021865
453 JGI24737J22298_10127208
454 JGI25154J39366_1000008
455 JGI25158J39367_1011892
456 JGI25153J46596_10001413
457 rootH1_10060251
458 rootH1_10096109
459 rootH2_10030144
460 rootL2_10044891
461 rootH1_10038549
462 rootH1_10055347
463 rootH1_10111962
464 rootH1_10116642
465 rootH1_10265137
466 rootH1_10374198
467 JGI25160J50197_1002257
468 Ga0055535_1005622
469 Ga0055542_1003917
470 Ga0055531_10005359
471 Ga0065165_1014717
472 Ga0065704_10001498
473 Ga0065712_10091398
474 Ga0070658_10091083
475 Ga0070676_10396415
476 Ga0070683_100046014
477 Ga0070683_100282182
478 Ga0070670_100073261
479 Ga0070670_100086363
480 Ga0070670_100234877
481 Ga0068869_100119957
482 Ga0068869_100396369
483 Ga0070666_10074210
484 Ga0070680_100166424
485 Ga0070680_101190987
486 Ga0070682_100025077
487 Ga0068868_101189979
488 Ga0070660_100023293
489 Ga0070660_100257834
490 Ga0070687_100167658
491 Ga0070661_100052441
492 Ga0070692_10554349
493 Ga0070669_100583121
494 Ga0070675_100014673
495 Ga0070675_100286548
496 Ga0070675_100820413
497 Ga0070671_100021409
498 Ga0070671_100101961
499 Ga0070674_100196408
500 Ga0070673_100092153
501 Ga0070673_100451779
502 Ga0070673_100467087
503 Ga0070673_100475363
504 Ga0070659_100000832
505 Ga0070659_100003144
506 Ga0070667_100078976
507 Ga0070663_100141848
508 Ga0070678_100203881
509 Ga0070662_100011837
510 Ga0070681_10288233
511 Ga0070681_10476266
512 Ga0070681_10513000
513 Ga0068867_100225040
514 Ga0070707_100710515
515 Ga0070679_100028368
516 Ga0070684_100059136
517 Ga0070684_100108792
518 Ga0068853_100025196
519 Ga0068853_100142650
520 Ga0068853_100161047
521 Ga0068853_100527288
522 Ga0070672_100101950
523 Ga0070672_100209689
524 Ga0070665_100000074
525 Ga0068855_100036619
526 Ga0068855_100146363
527 Ga0068855_100256679
528 Ga0070664_100000950
529 Ga0070664_100465328
530 Ga0068857_100003072
531 Ga0068857_100018903
532 Ga0068857_100125641
533 Ga0068857_100151253
534 Ga0068857_100165413
535 Ga0068854_100025843
536 Ga0068856_100034120
537 Ga0068856_100079438
538 Ga0068856_100139226
539 Ga0068856_100173876
540 Ga0070702_100459596
541 Ga0068852_100001764
542 Ga0068852_100002876
543 Ga0068852_100005383
544 Ga0068852_100095007
545 Ga0068852_100096553
546 Ga0068852_100263909
547 Ga0068852_100344656
548 Ga0068864_100199168
549 Ga0068864_100630090
550 Ga0068851_10214797
551 Ga0068870_10189405
552 Ga0068860_100000034
553 Ga0068860_100009185
554 Ga0068860_100045048
555 Ga0075366_10397399
556 Ga0097621_100027306
557 Ga0097621_100085669
558 Ga0097621_100536989
559 Ga0068871_100001620
560 Ga0068871_101231515
561 Ga0075428_100386762
562 Ga0075431_100044659
563 Ga0075429_100058362
564 Ga0068865_100595392
565 Ga0105240_10000008
566 Ga0105240_10000059
567 Ga0105240_10000753
568 Ga0105240_10016430
569 Ga0105240_10059903
570 Ga0105240_10134524
571 Ga0114129_10014867
572 Ga0114129_10068767
573 Ga0105241_10004808
574 Ga0105241_10066594
575 Ga0105241_10075190
576 Ga0105241_10372371
577 Ga0105241_10590747
578 Ga0105237_10000137
579 Ga0105237_10000365
580 Ga0105237_10019925
581 Ga0105237_10057490
582 Ga0105237_10272495
583 Ga0105237_10278614
584 Ga0105237_10352893
585 Ga0105238_10001640
586 Ga0105238_10079019
587 Ga0105238_10499119
588 Ga0105239_10013585
589 Ga0105239_10017342
590 Ga0105239_10083774
591 Ga0105239_10519656
592 Ga0157373_10010080
593 Ga0157373_10063980
594 Ga0157373_10185581
595 Ga0157371_10014609
596 Ga0157371_10040631
597 Ga0157371_10061853
598 Ga0157371_10187722
599 Ga0157370_10010368
600 Ga0157370_10287782
601 Ga0157370_10460370
602 Ga0157369_10006593
603 Ga0157369_10081519
604 Ga0157369_10192829
605 Ga0157369_10243594
606 Ga0157369_10703765
607 Ga0157369_10752459
608 Ga0157369_11387706
609 Ga0157374_10001675
610 Ga0157374_10019513
611 Ga0157374_10023310
612 Ga0157374_10027788
613 Ga0157374_10078178
614 Ga0157374_10446192
615 Ga0157378_10020257
616 Ga0157378_10451300
617 Ga0163162_10016723
618 Ga0163162_10151141
619 Ga0163162_11279332
620 Ga0157372_10005542
621 Ga0157372_10026285
622 Ga0157372_10067003
623 Ga0157372_10081466
624 Ga0157372_10144970
625 Ga0157372_10154477
626 Ga0157372_10206258
627 Ga0157372_10702449
628 Ga0157372_10812889
629 Ga0157372_10999009
630 Ga0157372_11334515
631 Ga0157372_11350344
632 Ga0157375_10386631
633 Ga0157375_10563550
634 Ga0163163_10013034
635 Ga0157380_10038914
636 Ga0157377_10021622
637 Ga0157376_10900266
638 Ga0206356_11653086
639 Ga0209436_104011
640 Ga0209646_1000045
641 Ga0209646_1002910
642 Ga0209026_1000075
643 Ga0209130_1000915
644 Ga0209758_1005408
645 Ga0207426_1000073
646 Ga0207426_1000236
647 Ga0207656_10124563
648 Ga0207680_10035952
649 Ga0207647_10000949
650 Ga0207647_10019524
651 Ga0207705_10550841
652 Ga0207654_10011230
653 Ga0207654_10032051
654 Ga0207654_10366178
655 Ga0207654_10560261
656 Ga0207707_10436752
657 Ga0207695_10000021
658 Ga0207695_10000039
659 Ga0207695_10000982
660 Ga0207695_10066857
661 Ga0207695_10067837
662 Ga0207695_10169755
663 Ga0207695_10215884
664 Ga0207671_10000424
665 Ga0207671_10002130
666 Ga0207671_10002759
667 Ga0207671_10023057
668 Ga0207671_10077374
669 Ga0207671_10114567
670 Ga0207662_10567962
671 Ga0207657_10004992
672 Ga0207649_10183785
673 Ga0207649_10191877
674 Ga0207649_10207145
675 Ga0207652_10031118
676 Ga0207652_10240660
677 Ga0207694_10048130
678 Ga0207694_10800206
679 Ga0207650_10001164
680 Ga0207650_10089075
681 Ga0207650_10109201
682 Ga0207650_10363660
683 Ga0207659_10106278
684 Ga0207659_10392493
685 Ga0207644_10544516
686 Ga0207690_10011088
687 Ga0207690_10924208
688 Ga0207706_10007504
689 Ga0207704_10971224
690 Ga0207691_10213706
691 Ga0207691_10342950
692 Ga0207691_10569472
693 Ga0207689_10203970
694 Ga0207689_10474581
695 Ga0207661_10083922
696 Ga0207661_10751690
697 Ga0207679_10033771
698 Ga0207679_10933464
699 Ga0207667_10004578
700 Ga0207667_10009515
701 Ga0207667_10247233
702 Ga0207667_11116782
703 Ga0207651_10069166
704 Ga0207651_10167628
705 Ga0207651_10689834
706 Ga0207640_10128591
707 Ga0207658_10059734
708 Ga0207658_10854346
709 Ga0207677_10037523
710 Ga0207677_10248423
711 Ga0207639_10004585
712 Ga0207639_10032669
713 Ga0207639_10121869
714 Ga0207639_10278340
715 Ga0207639_11075582
716 Ga0207678_10847527
717 Ga0207702_10099342
718 Ga0207702_10156386
719 Ga0207641_10085072
720 Ga0207648_10021754
721 Ga0207648_10861740
722 Ga0207676_10257700
723 Ga0207676_10717891
724 Ga0207676_11095542
725 Ga0207674_10004689
726 Ga0207674_10029388
727 Ga0207674_10073413
728 Ga0207674_10160306
729 Ga0207674_10415741
730 Ga0207674_10717172
731 Ga0207675_100194783
732 Ga0207675_100759727
733 Ga0207683_10291555
734 Ga0207698_10001608
735 Ga0207698_10037457
736 Ga0207698_10063846
737 Ga0207698_10064305
738 Ga0207698_10064831
739 Ga0207698_10191776
740 Ga0207698_10258136
741 Ga0207698_10262869
742 Ga0209968_1031823
743 Ga0209999_1016392
744 Ga0268266_10000010
745 Ga0268264_10000052
746 Ga0268264_10001431
747 Ga0268264_10204210
748 Ga0307517_10133681
749 Ga0307511_10001606
750 Ga0265327_10000054
751 Ga0265327_10063702
752 Ga0307513_10028247
753 Ga0307509_10390766
754 Ga0307516_10001143
755 Ga0307516_10414771
756 Ga0307406_10068183
757 Ga0307407_10261945
758 Ga0307416_100022237
759 Ga0307416_101898748
760 Ga0307414_10562331
761 Ga0307415_100059941
762 Ga0307510_10000869
763 Ga0373935_0583871
764 Ga0373927_0110428
765 Ga0395900_0473941
766 Ga0395905_0004912
767 Ga0395905_1154029
768 Ga0395901_1318307
769 Ga0436365_1876803
770 Ga0439436_0053945
771 Ga0439439_0015814
772 Ga0439439_0065488
773 Ga0451841_1322386
774 Ga0439431_0002975
775 Ga0439433_0052526
776 Ga0439445_0002757
777 Ga0439449_0011275
778 Ga0439449_0028173
779 Ga0451577_0066392
780 Ga0466972_0000348
781 Ga0466972_0000422
782 Ga0466972_0015986
783 Ga0466965_0371490
784 Ga0466961_0246328
785 Ga0453684_0030904
786 Ga0453684_0235965
787 Ga0466968_0087801
788 Ga0466968_0107144
789 Ga0466970_0001701
790 Ga0466957_0000134
791 Ga0466957_0008275
792 Ga0466957_0225471
793 Ga0466957_0649260
794 Ga0466959_0033328
795 Ga0466959_0123511
796 Ga0451576_0857981
797 Ga0466967_0112998
798 Ga0466967_0694321
799 Ga0466967_1278548
800 Ga0495638_0049942
801 Ga0495638_0173026
802 Ga0495606_0022321
803 Ga0495632_0288114
804 Ga0495648_0003458
805 Ga0495645_0508859
806 Ga0495667_0668061
807 Ga0495611_0000135
808 Ga0495625_0437049
809 Ga0495672_0085000
810 Ga0495687_000039
811 Ga0495686_0000046
812 Ga0501296_024271
813 Ga0501299_036102
814 Ga0501300_015121
815 Ga0501032_0004185
816 Ga0501033_0602689
817 Ga0501034_0002222
818 Ga0501034_0244708
819 Ga0501034_0258868
820 Ga0501034_0692804
821 Ga0501036_0132545
822 Ga0501037_0003388
823 Ga0501038_0017914
824 Ga0501039_0054580
825 Ga0501043_0011232
826 Ga0501043_0111049
827 Ga0501043_0469827
828 Ga0501046_0241186
829 Ga0501047_0005548
830 Ga0501047_0011539
831 Ga0501047_0127838
832 Ga0501048_0302343
833 Ga0501070_0776838
834 Ga0501198_006405
835 Ga0501202_000389
836 Ga0501202_010986
837 Ga0501202_036121
838 Ga0501217_001947
839 Ga0501217_061298
840 Ga0501235_009031
841 Ga0501242_021935
842 Ga0501247_006031
843 Ga0501247_018730
844 Ga0501251_048391
845 Ga0501252_000918
846 Ga0501257_004349
847 Ga0501257_025953
848 Ga0501257_079167
849 Ga0501259_015512
850 Ga0501261_003707
851 Ga0501219_001135
852 Ga0501221_002983
853 Ga0501221_038659
854 Ga0501225_0010429
855 Ga0501225_0023300
856 Ga0501234_004557
857 Ga0501245_002779
858 Ga0501241_001440
859 Ga0501241_002792
860 Ga0501266_005724
861 Ga0501035_0057807
862 Ga0501035_0945308
863 Ga0501044_0007421
864 Ga0501044_0019114
865 Ga0501284_00048
866 nmdc:mga05p37_10412_c1
867 nmdc:mga05p37_226138_c1
868 Ga0500578_0000462
869 Ga0500578_0068941
870 Ga0500644_0037686
871 Ga0500644_0270397
872 Ga0500646_0001881
873 Ga0500646_0012381
874 Ga0500646_0014587
875 Ga0500583_0000031
876 Ga0500583_0000923
877 Ga0500583_0053552
878 Ga0500651_0144626
879 Ga0500650_0030255
880 Ga0500556_0050095
881 Ga0500562_028456
882 Ga0500642_0306581
883 Ga0500652_007986
884 Ga0500652_091507
885 Ga0500655_008622
886 Ga0500568_0016814
887 Ga0500577_0216083
888 Ga0500588_0033219
889 Ga0500589_094264
890 Ga0500590_215947
891 Ga0500603_166509
892 Ga0500622_0076226
893 Ga0500622_0143855
894 Ga0500639_040814
895 Ga0500636_0034813
896 2738730516
897 2884791738
898 2896109997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07929

PRiA4_ORF3

Plasmid pRiA4b ORF-3-like protein

2

142

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i1s-assembly2.cif.gz_B crystal structure of protein of unknown function mm3350 from methanosarcina mazei go1 0.8618 2 129
2i1s-assembly1.cif.gz_A crystal structure of protein of unknown function mm3350 from methanosarcina mazei go1 0.856 2 134
6fno-assembly2.cif.gz_D caldiarchaeum subterraneum ubiquitin:rpn11-homolog complex, zinc soak 0.7506 19 98
6hyl-assembly2.cif.gz_B structure of pcm1 lir motif bound to gabarap 0.734 19 84
3pv1-assembly1.cif.gz_B crystal structure of the usp15 dusp-ubl domains 0.7203 17 104
ID Description Score Start End Superfamily
2i1sA00 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;MM3350-like 0.856 2 134 3.10.290.30
af_A0A1D6P3J9_634_711_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7816 17 92 3.10.20.90
af_Q7ZVI8_1_79_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7468 17 55 3.10.20.90
af_A0A0A1EI90_1200_1299_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.742 17 59 3.10.20.90
af_Q4D4W4_8_98_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.719 3 47 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A519UBL2-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9833 1 105
AF-A0A257L6N2-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9682 2 137
AF-A0A4Q3WA00-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9654 1 119
AF-A0A519UBL2-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9651 1 105
AF-A0A4Q5QV42-F1-model_v4 Plasmid pRiA4b Orf3-like domain-containing protein 0.9627 1 147

Map