F446484

General Info

Members Datasets Scaffolds Average Seq Length
449 284 898 303

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0005769|Ga0501038_0005769_10365_11456
Length 348
Sequence VDDLERPHDDAWRRRLDVDGRAGDEKDDQFRFLRRGMIELIIDKLQDVRFLTTIFTSIAAVATVLTFAMPYLTNDNLNRRMKSVAIERNKIRRSAPKPYMQMVVENLNLRKWLGEEEIRATLVQAGYRGQGPYVAFLFFRMVAPIAMFVFALAYLFVLTNFKYPPLIKVAVSIGAAYLGIKLPQLFLKNLIQRRQLSVKRAFPDALDLLLICVESGMSIEVAFKRVSQEIGSQSIALAEELTLTTAELSYLPDRRQAYENLSQRTGIDGVKAVCTALIQAERYGTPLGQALRVLGQEIRDMRMAEAEKKAAALPPKLTVPMILFFLPVLFVVILGPAFIRVMEVRGGG

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
185 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
186 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
189 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
277 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.46
Nodule 0
Rhizoplane 2.23
Rhizosphere 86.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0005769 3300049574 Bacteria 11466
2 JGI25153J46596_10002897 3300003215 Bacteria 9733
3 JGI25404J52841_10005996 3300003659 Bacteria 2527
4 Ga0065715_10000080 3300005293 Bacteria 2895
5 Ga0065715_10125401 3300005293 Bacteria 2132
6 Ga0065715_10145826 3300005293 Bacteria 1785
7 Ga0065715_10157720 3300005293 Bacteria 1651
8 Ga0065715_10240571 3300005293 Bacteria 1199
9 Ga0070658_10138779 3300005327 Bacteria 2030
10 Ga0070676_10034706 3300005328 Bacteria 2897
11 Ga0070683_100133022 3300005329 Bacteria 2354
12 Ga0070670_100140575 3300005331 Bacteria 2087
13 Ga0068869_100147419 3300005334 Bacteria 1822
14 Ga0070666_10114581 3300005335 Bacteria 1866
15 Ga0070680_100008821 3300005336 Bacteria 7733
16 Ga0070680_100109319 3300005336 Bacteria 2300
17 Ga0070682_100001892 3300005337 Bacteria 11687
18 Ga0070682_100153965 3300005337 Bacteria 1581
19 Ga0070660_100247513 3300005339 Bacteria 1453
20 Ga0070687_100018413 3300005343 Bacteria 3230
21 Ga0070668_100224651 3300005347 Bacteria 1550
22 Ga0070669_100054248 3300005353 Bacteria 2935
23 Ga0070669_100064788 3300005353 Bacteria 2691
24 Ga0070675_100021275 3300005354 Bacteria 5182
25 Ga0070671_100059871 3300005355 Bacteria 3170
26 Ga0070674_100014933 3300005356 Bacteria 4837
27 Ga0070673_100038762 3300005364 Bacteria 3641
28 Ga0070673_100073184 3300005364 Bacteria 2758
29 Ga0070673_100074484 3300005364 Bacteria 2736
30 Ga0070688_100004493 3300005365 Bacteria 7270
31 Ga0070659_100101196 3300005366 Bacteria 2320
32 Ga0070659_100209414 3300005366 Bacteria 1607
33 Ga0070703_10003861 3300005406 Bacteria 4245
34 Ga0070710_10043340 3300005437 Bacteria 2491
35 Ga0070701_10066928 3300005438 Bacteria 1910
36 Ga0070663_100353666 3300005455 Bacteria 1190
37 Ga0070678_100057810 3300005456 Bacteria 2843
38 Ga0070662_100015921 3300005457 Bacteria 5043
39 Ga0070681_10005462 3300005458 Bacteria 12277
40 Ga0070681_10267944 3300005458 Bacteria 1619
41 Ga0068867_100293323 3300005459 Bacteria 1338
42 Ga0070685_10110177 3300005466 Bacteria 1694
43 Ga0070679_100013132 3300005530 Bacteria 7929
44 Ga0070679_100110109 3300005530 Bacteria 2740
45 Ga0070679_100296603 3300005530 Bacteria 1568
46 Ga0070679_100330967 3300005530 Bacteria 1472
47 Ga0070697_100038733 3300005536 Bacteria 3852
48 Ga0068853_100001190 3300005539 Bacteria 18532
49 Ga0070686_100383472 3300005544 Bacteria 1065
50 Ga0070695_100001991 3300005545 Bacteria 11624
51 Ga0070696_100023623 3300005546 Bacteria 4178
52 Ga0070693_100082966 3300005547 Bacteria 1915
53 Ga0070665_100530719 3300005548 Bacteria 1189
54 Ga0068857_100091134 3300005577 Bacteria 2728
55 Ga0068857_100341310 3300005577 Bacteria 1386
56 Ga0068856_100156372 3300005614 Bacteria 2290
57 Ga0068859_100036242 3300005617 Bacteria 4952
58 Ga0068859_100199177 3300005617 Bacteria 2087
59 Ga0068859_100330879 3300005617 Bacteria 1617
60 Ga0068864_100022725 3300005618 Bacteria 5259
61 Ga0068864_100055634 3300005618 Bacteria 3417
62 Ga0068863_100167710 3300005841 Bacteria 2106
63 Ga0068863_100562012 3300005841 Bacteria 1127
64 Ga0068858_100123610 3300005842 Bacteria 2422
65 Ga0068858_100130335 3300005842 Bacteria 2358
66 Ga0081455_10000059 3300005937 Bacteria 119148
67 Ga0081455_10001271 3300005937 Bacteria 31492
68 Ga0081540_1000075 3300005983 Bacteria 106804
69 Ga0081540_1005218 3300005983 Bacteria 9724
70 Ga0081540_1091168 3300005983 Bacteria 1340
71 Ga0081539_10001975 3300005985 Bacteria 31233
72 Ga0070717_10304200 3300006028 Bacteria 1418
73 Ga0075368_10008674 3300006042 Bacteria 3631
74 Ga0075368_10054673 3300006042 Bacteria 1591
75 Ga0075363_100004796 3300006048 Bacteria 5965
76 Ga0075363_100008729 3300006048 Bacteria 4734
77 Ga0075363_100060531 3300006048 Bacteria 2039
78 Ga0075364_10007639 3300006051 Bacteria 6430
79 Ga0075364_10138701 3300006051 Bacteria 1634
80 Ga0075364_10196167 3300006051 Bacteria 1368
81 Ga0070716_100017195 3300006173 Bacteria 3745
82 Ga0075362_10014452 3300006177 Bacteria 3187
83 Ga0075367_10018635 3300006178 Bacteria 3834
84 Ga0075367_10069130 3300006178 Bacteria 2120
85 Ga0075367_10084663 3300006178 Bacteria 1923
86 Ga0075367_10094357 3300006178 Bacteria 1824
87 Ga0075366_10000506 3300006195 Bacteria 18061
88 Ga0075366_10010231 3300006195 Bacteria 5262
89 Ga0075428_100061807 3300006844 Bacteria 4102
90 Ga0075430_100310724 3300006846 Bacteria 1303
91 Ga0075431_100164323 3300006847 Bacteria 2282
92 Ga0075433_10060877 3300006852 Bacteria 3307
93 Ga0075434_100031283 3300006871 Bacteria 5247
94 Ga0075429_100130402 3300006880 Bacteria 2199
95 Ga0068865_100069297 3300006881 Bacteria 2495
96 Ga0075436_100001182 3300006914 Bacteria 17721
97 Ga0097620_100036242 3300006931 Bacteria 4952
98 Ga0097620_100199164 3300006931 Bacteria 2087
99 Ga0097620_100330904 3300006931 Bacteria 1617
100 Ga0105240_10313388 3300009093 Bacteria 1791
101 Ga0111539_10006361 3300009094 Bacteria 15230
102 Ga0111539_10017260 3300009094 Bacteria 8933
103 Ga0111539_10057230 3300009094 Bacteria 4630
104 Ga0111539_10163722 3300009094 Bacteria 2601
105 Ga0105245_10100232 3300009098 Bacteria 2679
106 Ga0105245_10123671 3300009098 Bacteria 2419
107 Ga0105247_10026788 3300009101 Bacteria 3484
108 Ga0105243_10051817 3300009148 Bacteria 3248
109 Ga0105243_10061397 3300009148 Bacteria 3006
110 Ga0105243_10385682 3300009148 Bacteria 1297
111 Ga0105241_10111205 3300009174 Bacteria 2193
112 Ga0105237_10054058 3300009545 Bacteria 4024
113 Ga0105249_10015609 3300009553 Bacteria 6723
114 Ga0099796_10000945 3300010159 Bacteria 5418
115 Ga0105246_10041078 3300011119 Bacteria 3124
116 Ga0157373_10108374 3300013100 Bacteria 1953
117 Ga0157370_10124761 3300013104 Bacteria 2404
118 Ga0157378_10029785 3300013297 Bacteria 4820
119 Ga0157378_10092407 3300013297 Bacteria 2753
120 Ga0163162_10044245 3300013306 Bacteria 4458
121 Ga0163162_10553203 3300013306 Bacteria 1279
122 Ga0157372_10073081 3300013307 Bacteria 3865
123 Ga0163163_10024758 3300014325 Bacteria 5715
124 Ga0163163_10085932 3300014325 Bacteria 3154
125 Ga0163163_10471822 3300014325 Bacteria 1316
126 Ga0157380_10030126 3300014326 Bacteria 4153
127 Ga0157380_10232035 3300014326 Bacteria 1658
128 Ga0157376_10175392 3300014969 Bacteria 1955
129 Ga0182006_1067907 3300015261 Bacteria 1329
130 Ga0213876_10002176 3300021384 Bacteria 11577
131 Ga0213875_10000011 3300021388 Bacteria 332447
132 Ga0213875_10143605 3300021388 Bacteria 1118
133 Ga0213871_10030837 3300021441 Bacteria 1397
134 Ga0209758_1000257 3300025297 Bacteria 106321
135 Ga0207653_10002308 3300025885 Bacteria 6089
136 Ga0207682_10000372 3300025893 Bacteria 20677
137 Ga0207692_10018731 3300025898 Bacteria 3113
138 Ga0207710_10008490 3300025900 Bacteria 4331
139 Ga0207688_10091057 3300025901 Bacteria 1751
140 Ga0207680_10192257 3300025903 Bacteria 1386
141 Ga0207685_10107374 3300025905 Bacteria 1204
142 Ga0207699_10092817 3300025906 Bacteria 1898
143 Ga0207645_10018321 3300025907 Bacteria 4609
144 Ga0207643_10040365 3300025908 Bacteria 2628
145 Ga0207707_10028171 3300025912 Bacteria 4909
146 Ga0207671_10012740 3300025914 Bacteria 6744
147 Ga0207660_10083888 3300025917 Bacteria 2347
148 Ga0207662_10010868 3300025918 Bacteria 5032
149 Ga0207662_10023478 3300025918 Bacteria 3543
150 Ga0207662_10073777 3300025918 Bacteria 2070
151 Ga0207657_10223876 3300025919 Bacteria 1506
152 Ga0207652_10070769 3300025921 Bacteria 3029
153 Ga0207652_10232817 3300025921 Bacteria 1660
154 Ga0207652_10443842 3300025921 Bacteria 1170
155 Ga0207650_10196651 3300025925 Bacteria 1613
156 Ga0207659_10053826 3300025926 Bacteria 2872
157 Ga0207687_10045717 3300025927 Bacteria 3027
158 Ga0207687_10112564 3300025927 Bacteria 2023
159 Ga0207687_10139777 3300025927 Bacteria 1836
160 Ga0207700_10244015 3300025928 Bacteria 1532
161 Ga0207644_10010375 3300025931 Bacteria 6141
162 Ga0207690_10063174 3300025932 Bacteria 2524
163 Ga0207690_10431865 3300025932 Bacteria 1055
164 Ga0207706_10016391 3300025933 Bacteria 6691
165 Ga0207686_10020973 3300025934 Bacteria 3741
166 Ga0207709_10008165 3300025935 Bacteria 5797
167 Ga0207670_10001066 3300025936 Bacteria 14465
168 Ga0207670_10001957 3300025936 Bacteria 10798
169 Ga0207669_10016849 3300025937 Bacteria 3729
170 Ga0207669_10020927 3300025937 Bacteria 3441
171 Ga0207704_10050702 3300025938 Bacteria 2505
172 Ga0207665_10055580 3300025939 Bacteria 2671
173 Ga0207665_10073896 3300025939 Bacteria 2332
174 Ga0207691_10004399 3300025940 Bacteria 13658
175 Ga0207711_10065197 3300025941 Bacteria 3148
176 Ga0207711_10221221 3300025941 Bacteria 1732
177 Ga0207711_10290704 3300025941 Bacteria 1506
178 Ga0207689_10178924 3300025942 Bacteria 1749
179 Ga0207689_10444475 3300025942 Bacteria 1083
180 Ga0207661_10224617 3300025944 Bacteria 1661
181 Ga0207679_10190964 3300025945 Bacteria 1703
182 Ga0207679_10322803 3300025945 Bacteria 1337
183 Ga0207667_10291152 3300025949 Bacteria 1668
184 Ga0207651_10019510 3300025960 Bacteria 4066
185 Ga0207651_10081159 3300025960 Bacteria 2337
186 Ga0207651_10536761 3300025960 Bacteria 1015
187 Ga0207712_10001673 3300025961 Bacteria 14882
188 Ga0207712_10036277 3300025961 Bacteria 3356
189 Ga0207677_10021203 3300026023 Bacteria 3965
190 Ga0207703_10073298 3300026035 Bacteria 2832
191 Ga0207703_10101759 3300026035 Bacteria 2437
192 Ga0207703_10174229 3300026035 Bacteria 1894
193 Ga0207678_10109613 3300026067 Bacteria 2355
194 Ga0207708_10037852 3300026075 Bacteria 3675
195 Ga0207708_10106249 3300026075 Bacteria 2176
196 Ga0207702_10294672 3300026078 Bacteria 1538
197 Ga0207641_10160481 3300026088 Bacteria 2044
198 Ga0207648_10307010 3300026089 Bacteria 1424
199 Ga0207676_10061891 3300026095 Bacteria 2965
200 Ga0207674_10034630 3300026116 Bacteria 5277
201 Ga0207674_10084087 3300026116 Bacteria 3181
202 Ga0207675_100027959 3300026118 Bacteria 5252
203 Ga0207675_100129370 3300026118 Bacteria 2394
204 Ga0207683_10018816 3300026121 Bacteria 5891
205 Ga0207683_10048007 3300026121 Bacteria 3738
206 Ga0209996_1007028 3300027395 Bacteria 1463
207 Ga0209179_1000235 3300027512 Bacteria 5242
208 Ga0209970_1011365 3300027614 Bacteria 1464
209 Ga0209983_1008574 3300027665 Bacteria 2090
210 Ga0209971_1021718 3300027682 Bacteria 1527
211 Ga0207428_10031334 3300027907 Bacteria 4388
212 Ga0268264_10109197 3300028381 Bacteria 2420
213 Ga0268264_10322521 3300028381 Bacteria 1461
214 Ga0265337_1001195 3300028556 Bacteria 13202
215 Ga0265318_10011617 3300028577 Bacteria 3783
216 Ga0265330_10049310 3300031235 Bacteria 1850
217 Ga0265328_10000413 3300031239 Bacteria 20010
218 Ga0265320_10033707 3300031240 Bacteria 2611
219 Ga0265325_10000672 3300031241 Bacteria 24929
220 Ga0265325_10019900 3300031241 Bacteria 3705
221 Ga0265325_10076493 3300031241 Bacteria 1670
222 Ga0265340_10008749 3300031247 Bacteria 5459
223 Ga0265340_10016172 3300031247 Bacteria 3867
224 Ga0265340_10086686 3300031247 Bacteria 1468
225 Ga0265339_10053430 3300031249 Bacteria 2197
226 Ga0265331_10000005 3300031250 Bacteria 465192
227 Ga0265331_10047395 3300031250 Bacteria 2068
228 Ga0265327_10032509 3300031251 Bacteria 2919
229 Ga0265316_10034934 3300031344 Bacteria 4080
230 Ga0265316_10100445 3300031344 Bacteria 2199
231 Ga0265313_10000525 3300031595 Bacteria 40049
232 Ga0265313_10006221 3300031595 Bacteria 8529
233 Ga0265313_10011149 3300031595 Bacteria 5604
234 Ga0316579_10046096 3300031691 Bacteria 2033
235 Ga0265342_10028221 3300031712 Bacteria 3499
236 Ga0373926_0040622 3300035083 Bacteria 1661
237 Ga0373926_0084763 3300035083 Bacteria 1175
238 Ga0373923_0015894 3300035111 Bacteria 2848
239 Ga0373936_0125901 3300035113 Bacteria 1098
240 Ga0373939_0016652 3300035114 Bacteria 1941
241 Ga0373945_0014899 3300035116 Bacteria 2610
242 Ga0373954_0005564 3300035118 Bacteria 5457
243 Ga0373946_0000999 3300035171 Bacteria 9718
244 Ga0373955_0004904 3300035172 Bacteria 5968
245 Ga0373955_0009214 3300035172 Bacteria 4618
246 Ga0373942_0024218 3300035207 Bacteria 1555
247 Ga0373961_0001126 3300035241 Bacteria 8418
248 Ga0373961_0005079 3300035241 Bacteria 3165
249 Ga0373924_0000399 3300035410 Bacteria 13309
250 Ga0373931_0003060 3300035691 Bacteria 7476
251 Ga0373935_0000167 3300035692 Bacteria 30761
252 Ga0373927_0007700 3300035695 Bacteria 7287
253 Ga0373933_0014573 3300035724 Bacteria 4374
254 Ga0373947_0000325 3300035725 Bacteria 27027
255 Ga0373947_0050224 3300035725 Bacteria 2508
256 Ga0373937_0000006 3300036401 Bacteria 194781
257 Ga0373937_0021048 3300036401 Bacteria 5851
258 Ga0373937_0182460 3300036401 Bacteria 1971
259 Ga0316582_0271169 3300036647 Bacteria 1164
260 Ga0373925_0000002 3300037068 Bacteria 368879
261 Ga0436364_0213507 3300037853 Bacteria 1708
262 Ga0436364_0622718 3300037853 Bacteria 37563
263 Ga0436364_0940251 3300037853 Bacteria 1281
264 Ga0242420_007481 3300038996 Bacteria 1753
265 Ga0436365_0182496 3300039437 Bacteria 5610
266 Ga0436365_0916151 3300039437 Bacteria 2529
267 Ga0436365_1764020 3300039437 Bacteria 12207
268 Ga0436365_1786701 3300039437 Bacteria 2329
269 Ga0436360_0748010 3300039438 Bacteria 2614
270 Ga0436361_0872466 3300039447 Bacteria 1798
271 Ga0436363_0528241 3300039450 Bacteria 1036
272 Ga0436363_0820928 3300039450 Bacteria 7503
273 Ga0436362_0529197 3300039453 Bacteria 1930
274 Ga0439453_0000120 3300041408 Bacteria 6578
275 Ga0439441_000450 3300042001 Bacteria 4398
276 Ga0439450_006709 3300042008 Bacteria 2082
277 Ga0439435_0000761 3300042436 Bacteria 5400
278 Ga0439460_0018266 3300042461 Bacteria 1887
279 Ga0439440_0013847 3300042993 Bacteria 1735
280 Ga0466963_0068307 3300044694 Bacteria 2387
281 Ga0451576_0073029 3300045051 Bacteria 3570
282 Ga0466967_0235906 3300045976 Bacteria 1743
283 Ga0495592_0000086 3300046454 Bacteria 82248
284 Ga0495629_0006696 3300046459 Bacteria 8523
285 Ga0495651_0000420 3300046462 Bacteria 32886
286 Ga0495653_0000006 3300046463 Bacteria 363285
287 Ga0495605_0021230 3300046474 Bacteria 3442
288 Ga0495664_0000002 3300046477 Bacteria 625183
289 Ga0495608_0000009 3300046511 Bacteria 266614
290 Ga0495618_0000005 3300046514 Bacteria 230421
291 Ga0495628_0000002 3300046516 Bacteria 589399
292 Ga0495630_0000865 3300046517 Bacteria 21326
293 Ga0495652_0000004 3300046529 Bacteria 588877
294 Ga0495640_0000005 3300046533 Bacteria 318271
295 Ga0495587_0000007 3300046536 Bacteria 290788
296 Ga0495621_0013184 3300046539 Bacteria 2592
297 Ga0495645_0000003 3300046543 Bacteria 570133
298 Ga0495667_0000002 3300046559 Bacteria 437535
299 Ga0495634_0000022 3300046642 Bacteria 118988
300 Ga0495635_0000020 3300046663 Bacteria 189698
301 Ga0495657_0000316 3300046675 Bacteria 44405
302 Ga0495599_0000001 3300046678 Bacteria 537563
303 Ga0495623_0000001 3300046679 Bacteria 313861
304 Ga0495646_0000013 3300046680 Bacteria 159700
305 Ga0495658_0093785 3300046683 Bacteria 1782
306 Ga0495613_0076008 3300046689 Bacteria 2445
307 Ga0495600_0000006 3300046809 Bacteria 151916
308 Ga0495604_0000005 3300047317 Bacteria 424516
309 Ga0495604_0085460 3300047317 Bacteria 2354
310 Ga0495674_0000003 3300047319 Bacteria 562126
311 Ga0495680_0000002 3300047322 Bacteria 197533
312 Ga0495675_0000010 3300047444 Bacteria 153375
313 Ga0495684_0000020 3300047471 Bacteria 148507
314 Ga0495593_0005019 3300047673 Bacteria 7831
315 Ga0495602_0000054 3300048088 Bacteria 111411
316 Ga0495615_0006005 3300048090 Bacteria 2222
317 Ga0496104_0068887 3300048907 Bacteria 3362
318 Ga0496107_0017050 3300048910 Bacteria 5107
319 Ga0496108_0003489 3300048911 Bacteria 12599
320 Ga0496109_0013336 3300048912 Bacteria 7124
321 Ga0496109_0014847 3300048912 Bacteria 6778
322 Ga0496111_0034590 3300048914 Bacteria 3608
323 Ga0496113_0018033 3300048916 Bacteria 4911
324 Ga0496113_0023692 3300048916 Bacteria 4355
325 Ga0496113_0387912 3300048916 Bacteria 1121
326 Ga0496115_0361232 3300048918 Bacteria 1183
327 Ga0501031_0004746 3300049568 Bacteria 8824
328 Ga0501032_0013464 3300049569 Bacteria 5816
329 Ga0501033_0008092 3300049570 Bacteria 8147
330 Ga0501033_0009478 3300049570 Bacteria 7499
331 Ga0501033_0162491 3300049570 Bacteria 1607
332 Ga0501034_0012202 3300049571 Bacteria 8885
333 Ga0501034_0083837 3300049571 Bacteria 3189
334 Ga0501034_0176149 3300049571 Bacteria 2105
335 Ga0501034_0284617 3300049571 Bacteria 1592
336 Ga0501034_0385780 3300049571 Bacteria 1325
337 Ga0501036_0013872 3300049572 Bacteria 6702
338 Ga0501036_0113080 3300049572 Bacteria 2294
339 Ga0501036_0175147 3300049572 Bacteria 1806
340 Ga0501036_0188334 3300049572 Bacteria 1736
341 Ga0501036_0379771 3300049572 Bacteria 1179
342 Ga0501037_0013906 3300049573 Bacteria 5930
343 Ga0501037_0114914 3300049573 Bacteria 1937
344 Ga0501037_0143293 3300049573 Bacteria 1709
345 Ga0501038_0004684 3300049574 Bacteria 12732
346 Ga0501038_0011385 3300049574 Bacteria 8117
347 Ga0501038_0085801 3300049574 Bacteria 2646
348 Ga0501038_0089460 3300049574 Bacteria 2582
349 Ga0501038_0209196 3300049574 Bacteria 1561
350 Ga0501039_0026873 3300049575 Bacteria 4424
351 Ga0501039_0046682 3300049575 Bacteria 3347
352 Ga0501042_0123787 3300049578 Bacteria 1862
353 Ga0501043_0013844 3300049579 Bacteria 6313
354 Ga0501043_0030576 3300049579 Bacteria 4232
355 Ga0501043_0044548 3300049579 Bacteria 3488
356 Ga0501043_0084788 3300049579 Bacteria 2490
357 Ga0501043_0162717 3300049579 Bacteria 1743
358 Ga0501046_0066021 3300049580 Bacteria 2821
359 Ga0501046_0110711 3300049580 Bacteria 2098
360 Ga0501046_0226501 3300049580 Bacteria 1382
361 Ga0501047_0004079 3300049581 Bacteria 13745
362 Ga0501047_0058563 3300049581 Bacteria 3721
363 Ga0501047_0188414 3300049581 Bacteria 1927
364 Ga0501047_0201003 3300049581 Bacteria 1854
365 Ga0501047_0400571 3300049581 Bacteria 1205
366 Ga0501048_0048428 3300049582 Bacteria 3031
367 Ga0501067_0072045 3300049583 Bacteria 1914
368 Ga0501068_0087865 3300049584 Bacteria 1914
369 Ga0501068_0135679 3300049584 Bacteria 1541
370 Ga0501069_0102795 3300049585 Bacteria 1623
371 Ga0501070_0005846 3300049586 Bacteria 10492
372 Ga0501070_0064281 3300049586 Bacteria 3039
373 Ga0501070_0068787 3300049586 Bacteria 2931
374 Ga0501070_0079887 3300049586 Bacteria 2706
375 Ga0501070_0326796 3300049586 Bacteria 1247
376 Ga0501070_0351290 3300049586 Bacteria 1196
377 Ga0501071_0224171 3300049587 Bacteria 1415
378 Ga0501072_0007865 3300049588 Bacteria 8099
379 Ga0501072_0102415 3300049588 Bacteria 2276
380 Ga0501072_0137722 3300049588 Bacteria 1946
381 Ga0501073_0034589 3300049589 Bacteria 3595
382 Ga0501073_0045788 3300049589 Bacteria 3080
383 Ga0501073_0065038 3300049589 Bacteria 2543
384 Ga0501074_0056988 3300049590 Bacteria 2815
385 Ga0501074_0086425 3300049590 Bacteria 2246
386 Ga0501076_0191413 3300049592 Bacteria 1669
387 Ga0501080_0016238 3300049742 Bacteria 6873
388 Ga0501080_0065199 3300049742 Bacteria 3388
389 Ga0501083_0011760 3300049744 Bacteria 6135
390 Ga0501083_0044169 3300049744 Bacteria 3017
391 Ga0501083_0046997 3300049744 Bacteria 2918
392 Ga0501083_0056998 3300049744 Bacteria 2617
393 Ga0501035_0001398 3300049822 Bacteria 24778
394 Ga0501035_0017990 3300049822 Bacteria 6516
395 Ga0501035_0019356 3300049822 Bacteria 6262
396 Ga0501035_0057470 3300049822 Bacteria 3468
397 Ga0501035_0511617 3300049822 Bacteria 987
398 Ga0501044_0015876 3300049823 Bacteria 8104
399 Ga0501044_0039770 3300049823 Bacteria 4904
400 Ga0501044_0047063 3300049823 Bacteria 4462
401 Ga0501044_0076903 3300049823 Bacteria 3386
402 Ga0501044_0217839 3300049823 Bacteria 1860
403 Ga0501044_0382884 3300049823 Bacteria 1321
404 nmdc:mga03683_2898_c1 3300050489 Bacteria 5410
405 nmdc:mga03n38_17993_c1 3300050490 Bacteria 2780
406 nmdc:mga03n38_53517_c1 3300050490 Bacteria 1810
407 nmdc:mga00v17_3045_c2 3300050491 Bacteria 5333
408 nmdc:mga00v17_41628_c1 3300050491 Bacteria 2760
409 nmdc:mga0k408_1585_c1 3300050493 Bacteria 12299
410 nmdc:mga06z11_60553_c1 3300050494 Bacteria 1971
411 nmdc:mga06z11_82642_c1 3300050494 Bacteria 1727
412 nmdc:mga04h51_17912_c1 3300050495 Bacteria 2079
413 nmdc:mga07m45_133846_c2 3300050496 Bacteria 1217
414 nmdc:mga07m45_22146_c1 3300050496 Bacteria 3468
415 nmdc:mga07m45_36159_c2 3300050496 Bacteria 1640
416 nmdc:mga06r32_171565_c1 3300050510 Bacteria 2153
417 nmdc:mga08y16_11056_c2 3300050511 Bacteria 6176
418 nmdc:mga08y16_114131_c1 3300050511 Bacteria 2812
419 nmdc:mga08y16_166772_c1 3300050511 Bacteria 2288
420 nmdc:mga08y16_308392_c1 3300050511 Bacteria 1630
421 nmdc:mga08y16_97218_c1 3300050511 Bacteria 3066
422 nmdc:mga0n895_36457_c1 3300050512 Bacteria 4748
423 nmdc:mga0n895_397611_c1 3300050512 Bacteria 1394
424 nmdc:mga08x19_21_c1 3300050514 Bacteria 302369
425 nmdc:mga0sz30_38392_c1 3300050516 Bacteria 2006
426 Ga0495601_0000008 3300053077 Bacteria 362152
427 Ga0495601_0086777 3300053077 Bacteria 2011
428 Ga0495612_0000002 3300053078 Bacteria 310466
429 Ga0495612_0057214 3300053078 Bacteria 1610
430 Ga0495612_0086380 3300053078 Bacteria 1323
431 Ga0495595_0000008 3300053084 Bacteria 196206
432 Ga0495595_0037144 3300053084 Bacteria 2213
433 Ga0495619_0000002 3300053085 Bacteria 530226
434 Ga0500644_0000582 3300053088 Bacteria 13971
435 Ga0500651_0067153 3300053093 Bacteria 2233
436 Ga0500641_0023800 3300053096 Bacteria 2358
437 Ga0500650_0030940 3300053098 Bacteria 2430
438 Ga0500595_010485 3300053119 Bacteria 3681
439 Ga0500652_016824 3300053131 Bacteria 2668
440 Ga0500616_0000001 3300053153 Bacteria 1986011
441 Ga0500645_000943 3300053730 Bacteria 16547
442 Ga0501084_0073287 3300054114 Bacteria 2868
443 Ga0501084_0096567 3300054114 Bacteria 2482
444 Ga0501084_0111189 3300054114 Bacteria 2302
445 Ga0501082_0000002 3300060353 Bacteria 186546
446 Ga0501082_0015911 3300060353 Bacteria 6470
447 Ga0501082_0040576 3300060353 Bacteria 4014
448 Ga0501082_0100332 3300060353 Bacteria 2504
449 Ga0530510_0039371 3300061734 Bacteria 3412
450 Ga0501038_0005769
451 JGI25153J46596_10002897
452 JGI25404J52841_10005996
453 Ga0065715_10000080
454 Ga0065715_10125401
455 Ga0065715_10145826
456 Ga0065715_10157720
457 Ga0065715_10240571
458 Ga0070658_10138779
459 Ga0070676_10034706
460 Ga0070683_100133022
461 Ga0070670_100140575
462 Ga0068869_100147419
463 Ga0070666_10114581
464 Ga0070680_100008821
465 Ga0070680_100109319
466 Ga0070682_100001892
467 Ga0070682_100153965
468 Ga0070660_100247513
469 Ga0070687_100018413
470 Ga0070668_100224651
471 Ga0070669_100054248
472 Ga0070669_100064788
473 Ga0070675_100021275
474 Ga0070671_100059871
475 Ga0070674_100014933
476 Ga0070673_100038762
477 Ga0070673_100073184
478 Ga0070673_100074484
479 Ga0070688_100004493
480 Ga0070659_100101196
481 Ga0070659_100209414
482 Ga0070703_10003861
483 Ga0070710_10043340
484 Ga0070701_10066928
485 Ga0070663_100353666
486 Ga0070678_100057810
487 Ga0070662_100015921
488 Ga0070681_10005462
489 Ga0070681_10267944
490 Ga0068867_100293323
491 Ga0070685_10110177
492 Ga0070679_100013132
493 Ga0070679_100110109
494 Ga0070679_100296603
495 Ga0070679_100330967
496 Ga0070697_100038733
497 Ga0068853_100001190
498 Ga0070686_100383472
499 Ga0070695_100001991
500 Ga0070696_100023623
501 Ga0070693_100082966
502 Ga0070665_100530719
503 Ga0068857_100091134
504 Ga0068857_100341310
505 Ga0068856_100156372
506 Ga0068859_100036242
507 Ga0068859_100199177
508 Ga0068859_100330879
509 Ga0068864_100022725
510 Ga0068864_100055634
511 Ga0068863_100167710
512 Ga0068863_100562012
513 Ga0068858_100123610
514 Ga0068858_100130335
515 Ga0081455_10000059
516 Ga0081455_10001271
517 Ga0081540_1000075
518 Ga0081540_1005218
519 Ga0081540_1091168
520 Ga0081539_10001975
521 Ga0070717_10304200
522 Ga0075368_10008674
523 Ga0075368_10054673
524 Ga0075363_100004796
525 Ga0075363_100008729
526 Ga0075363_100060531
527 Ga0075364_10007639
528 Ga0075364_10138701
529 Ga0075364_10196167
530 Ga0070716_100017195
531 Ga0075362_10014452
532 Ga0075367_10018635
533 Ga0075367_10069130
534 Ga0075367_10084663
535 Ga0075367_10094357
536 Ga0075366_10000506
537 Ga0075366_10010231
538 Ga0075428_100061807
539 Ga0075430_100310724
540 Ga0075431_100164323
541 Ga0075433_10060877
542 Ga0075434_100031283
543 Ga0075429_100130402
544 Ga0068865_100069297
545 Ga0075436_100001182
546 Ga0097620_100036242
547 Ga0097620_100199164
548 Ga0097620_100330904
549 Ga0105240_10313388
550 Ga0111539_10006361
551 Ga0111539_10017260
552 Ga0111539_10057230
553 Ga0111539_10163722
554 Ga0105245_10100232
555 Ga0105245_10123671
556 Ga0105247_10026788
557 Ga0105243_10051817
558 Ga0105243_10061397
559 Ga0105243_10385682
560 Ga0105241_10111205
561 Ga0105237_10054058
562 Ga0105249_10015609
563 Ga0099796_10000945
564 Ga0105246_10041078
565 Ga0157373_10108374
566 Ga0157370_10124761
567 Ga0157378_10029785
568 Ga0157378_10092407
569 Ga0163162_10044245
570 Ga0163162_10553203
571 Ga0157372_10073081
572 Ga0163163_10024758
573 Ga0163163_10085932
574 Ga0163163_10471822
575 Ga0157380_10030126
576 Ga0157380_10232035
577 Ga0157376_10175392
578 Ga0182006_1067907
579 Ga0213876_10002176
580 Ga0213875_10000011
581 Ga0213875_10143605
582 Ga0213871_10030837
583 Ga0209758_1000257
584 Ga0207653_10002308
585 Ga0207682_10000372
586 Ga0207692_10018731
587 Ga0207710_10008490
588 Ga0207688_10091057
589 Ga0207680_10192257
590 Ga0207685_10107374
591 Ga0207699_10092817
592 Ga0207645_10018321
593 Ga0207643_10040365
594 Ga0207707_10028171
595 Ga0207671_10012740
596 Ga0207660_10083888
597 Ga0207662_10010868
598 Ga0207662_10023478
599 Ga0207662_10073777
600 Ga0207657_10223876
601 Ga0207652_10070769
602 Ga0207652_10232817
603 Ga0207652_10443842
604 Ga0207650_10196651
605 Ga0207659_10053826
606 Ga0207687_10045717
607 Ga0207687_10112564
608 Ga0207687_10139777
609 Ga0207700_10244015
610 Ga0207644_10010375
611 Ga0207690_10063174
612 Ga0207690_10431865
613 Ga0207706_10016391
614 Ga0207686_10020973
615 Ga0207709_10008165
616 Ga0207670_10001066
617 Ga0207670_10001957
618 Ga0207669_10016849
619 Ga0207669_10020927
620 Ga0207704_10050702
621 Ga0207665_10055580
622 Ga0207665_10073896
623 Ga0207691_10004399
624 Ga0207711_10065197
625 Ga0207711_10221221
626 Ga0207711_10290704
627 Ga0207689_10178924
628 Ga0207689_10444475
629 Ga0207661_10224617
630 Ga0207679_10190964
631 Ga0207679_10322803
632 Ga0207667_10291152
633 Ga0207651_10019510
634 Ga0207651_10081159
635 Ga0207651_10536761
636 Ga0207712_10001673
637 Ga0207712_10036277
638 Ga0207677_10021203
639 Ga0207703_10073298
640 Ga0207703_10101759
641 Ga0207703_10174229
642 Ga0207678_10109613
643 Ga0207708_10037852
644 Ga0207708_10106249
645 Ga0207702_10294672
646 Ga0207641_10160481
647 Ga0207648_10307010
648 Ga0207676_10061891
649 Ga0207674_10034630
650 Ga0207674_10084087
651 Ga0207675_100027959
652 Ga0207675_100129370
653 Ga0207683_10018816
654 Ga0207683_10048007
655 Ga0209996_1007028
656 Ga0209179_1000235
657 Ga0209970_1011365
658 Ga0209983_1008574
659 Ga0209971_1021718
660 Ga0207428_10031334
661 Ga0268264_10109197
662 Ga0268264_10322521
663 Ga0265337_1001195
664 Ga0265318_10011617
665 Ga0265330_10049310
666 Ga0265328_10000413
667 Ga0265320_10033707
668 Ga0265325_10000672
669 Ga0265325_10019900
670 Ga0265325_10076493
671 Ga0265340_10008749
672 Ga0265340_10016172
673 Ga0265340_10086686
674 Ga0265339_10053430
675 Ga0265331_10000005
676 Ga0265331_10047395
677 Ga0265327_10032509
678 Ga0265316_10034934
679 Ga0265316_10100445
680 Ga0265313_10000525
681 Ga0265313_10006221
682 Ga0265313_10011149
683 Ga0316579_10046096
684 Ga0265342_10028221
685 Ga0373926_0040622
686 Ga0373926_0084763
687 Ga0373923_0015894
688 Ga0373936_0125901
689 Ga0373939_0016652
690 Ga0373945_0014899
691 Ga0373954_0005564
692 Ga0373946_0000999
693 Ga0373955_0004904
694 Ga0373955_0009214
695 Ga0373942_0024218
696 Ga0373961_0001126
697 Ga0373961_0005079
698 Ga0373924_0000399
699 Ga0373931_0003060
700 Ga0373935_0000167
701 Ga0373927_0007700
702 Ga0373933_0014573
703 Ga0373947_0000325
704 Ga0373947_0050224
705 Ga0373937_0000006
706 Ga0373937_0021048
707 Ga0373937_0182460
708 Ga0316582_0271169
709 Ga0373925_0000002
710 Ga0436364_0213507
711 Ga0436364_0622718
712 Ga0436364_0940251
713 Ga0242420_007481
714 Ga0436365_0182496
715 Ga0436365_0916151
716 Ga0436365_1764020
717 Ga0436365_1786701
718 Ga0436360_0748010
719 Ga0436361_0872466
720 Ga0436363_0528241
721 Ga0436363_0820928
722 Ga0436362_0529197
723 Ga0439453_0000120
724 Ga0439441_000450
725 Ga0439450_006709
726 Ga0439435_0000761
727 Ga0439460_0018266
728 Ga0439440_0013847
729 Ga0466963_0068307
730 Ga0451576_0073029
731 Ga0466967_0235906
732 Ga0495592_0000086
733 Ga0495629_0006696
734 Ga0495651_0000420
735 Ga0495653_0000006
736 Ga0495605_0021230
737 Ga0495664_0000002
738 Ga0495608_0000009
739 Ga0495618_0000005
740 Ga0495628_0000002
741 Ga0495630_0000865
742 Ga0495652_0000004
743 Ga0495640_0000005
744 Ga0495587_0000007
745 Ga0495621_0013184
746 Ga0495645_0000003
747 Ga0495667_0000002
748 Ga0495634_0000022
749 Ga0495635_0000020
750 Ga0495657_0000316
751 Ga0495599_0000001
752 Ga0495623_0000001
753 Ga0495646_0000013
754 Ga0495658_0093785
755 Ga0495613_0076008
756 Ga0495600_0000006
757 Ga0495604_0000005
758 Ga0495604_0085460
759 Ga0495674_0000003
760 Ga0495680_0000002
761 Ga0495675_0000010
762 Ga0495684_0000020
763 Ga0495593_0005019
764 Ga0495602_0000054
765 Ga0495615_0006005
766 Ga0496104_0068887
767 Ga0496107_0017050
768 Ga0496108_0003489
769 Ga0496109_0013336
770 Ga0496109_0014847
771 Ga0496111_0034590
772 Ga0496113_0018033
773 Ga0496113_0023692
774 Ga0496113_0387912
775 Ga0496115_0361232
776 Ga0501031_0004746
777 Ga0501032_0013464
778 Ga0501033_0008092
779 Ga0501033_0009478
780 Ga0501033_0162491
781 Ga0501034_0012202
782 Ga0501034_0083837
783 Ga0501034_0176149
784 Ga0501034_0284617
785 Ga0501034_0385780
786 Ga0501036_0013872
787 Ga0501036_0113080
788 Ga0501036_0175147
789 Ga0501036_0188334
790 Ga0501036_0379771
791 Ga0501037_0013906
792 Ga0501037_0114914
793 Ga0501037_0143293
794 Ga0501038_0004684
795 Ga0501038_0011385
796 Ga0501038_0085801
797 Ga0501038_0089460
798 Ga0501038_0209196
799 Ga0501039_0026873
800 Ga0501039_0046682
801 Ga0501042_0123787
802 Ga0501043_0013844
803 Ga0501043_0030576
804 Ga0501043_0044548
805 Ga0501043_0084788
806 Ga0501043_0162717
807 Ga0501046_0066021
808 Ga0501046_0110711
809 Ga0501046_0226501
810 Ga0501047_0004079
811 Ga0501047_0058563
812 Ga0501047_0188414
813 Ga0501047_0201003
814 Ga0501047_0400571
815 Ga0501048_0048428
816 Ga0501067_0072045
817 Ga0501068_0087865
818 Ga0501068_0135679
819 Ga0501069_0102795
820 Ga0501070_0005846
821 Ga0501070_0064281
822 Ga0501070_0068787
823 Ga0501070_0079887
824 Ga0501070_0326796
825 Ga0501070_0351290
826 Ga0501071_0224171
827 Ga0501072_0007865
828 Ga0501072_0102415
829 Ga0501072_0137722
830 Ga0501073_0034589
831 Ga0501073_0045788
832 Ga0501073_0065038
833 Ga0501074_0056988
834 Ga0501074_0086425
835 Ga0501076_0191413
836 Ga0501080_0016238
837 Ga0501080_0065199
838 Ga0501083_0011760
839 Ga0501083_0044169
840 Ga0501083_0046997
841 Ga0501083_0056998
842 Ga0501035_0001398
843 Ga0501035_0017990
844 Ga0501035_0019356
845 Ga0501035_0057470
846 Ga0501035_0511617
847 Ga0501044_0015876
848 Ga0501044_0039770
849 Ga0501044_0047063
850 Ga0501044_0076903
851 Ga0501044_0217839
852 Ga0501044_0382884
853 nmdc:mga03683_2898_c1
854 nmdc:mga03n38_17993_c1
855 nmdc:mga03n38_53517_c1
856 nmdc:mga00v17_3045_c2
857 nmdc:mga00v17_41628_c1
858 nmdc:mga0k408_1585_c1
859 nmdc:mga06z11_60553_c1
860 nmdc:mga06z11_82642_c1
861 nmdc:mga04h51_17912_c1
862 nmdc:mga07m45_133846_c2
863 nmdc:mga07m45_22146_c1
864 nmdc:mga07m45_36159_c2
865 nmdc:mga06r32_171565_c1
866 nmdc:mga08y16_11056_c2
867 nmdc:mga08y16_114131_c1
868 nmdc:mga08y16_166772_c1
869 nmdc:mga08y16_308392_c1
870 nmdc:mga08y16_97218_c1
871 nmdc:mga0n895_36457_c1
872 nmdc:mga0n895_397611_c1
873 nmdc:mga08x19_21_c1
874 nmdc:mga0sz30_38392_c1
875 Ga0495601_0000008
876 Ga0495601_0086777
877 Ga0495612_0000002
878 Ga0495612_0057214
879 Ga0495612_0086380
880 Ga0495595_0000008
881 Ga0495595_0037144
882 Ga0495619_0000002
883 Ga0500644_0000582
884 Ga0500651_0067153
885 Ga0500641_0023800
886 Ga0500650_0030940
887 Ga0500595_010485
888 Ga0500652_016824
889 Ga0500616_0000001
890 Ga0500645_000943
891 Ga0501084_0073287
892 Ga0501084_0096567
893 Ga0501084_0111189
894 Ga0501082_0000002
895 Ga0501082_0015911
896 Ga0501082_0040576
897 Ga0501082_0100332
898 Ga0530510_0039371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

205

335

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8156 143 256
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8114 143 253
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8062 143 256
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.7857 143 253
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.76 143 256
ID Description Score Start End Superfamily
af_O69625_45_175_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7084 150 277 1.20.81.30
af_O69625_45_175_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.6853 150 277 1.20.81.30
af_A0A1D6IP43_204_350_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3932 103 249 1.25.40.10
af_K7K4N6_264_386_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3845 149 242 1.25.40.10
af_A0A1D6IP43_204_350_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3839 103 249 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A529Q458-F1-model_v4 Type II secretion system F family protein 0.9161 106 242 GO:0005886
AF-A0A529HLZ7-F1-model_v4 Type II secretion system F family protein 0.9102 106 227 GO:0005886
AF-A0A5R2N1Y6-F1-model_v4 Type II secretion system F family protein 0.9012 129 268 GO:0005886
AF-A0A2M8Q7C7-F1-model_v4 Secretion system protein 0.8979 85 230 GO:0005886
AF-A0A5R2N1Y6-F1-model_v4 Type II secretion system F family protein 0.8829 129 268 GO:0005886

Map