F446495

General Info

Members Datasets Scaffolds Average Seq Length
449 288 898 341

Family's Representative Sequence

Representative Sequence 3300053100|Ga0500660_067721|Ga0500660_067721_420_1556
Length 378
Sequence LRPLCARSAWVSISALARIVLDYKSFTDWRTPVIKIAKKHGLATLAAAGLTLAAMAPAHAGKTLDAIKARGQVICGVNVGLAGFSSADSNGAWTGLDVDTCKAIAASVLGDANKVKWVPLNAQQRFTALQSGEVDVLARNTTFSLTRDASLGLHMTAVTYYDGQGFMVPVKSKVKSAKALKNATVCVQSGTTTEKNLTDFSKANNLNMKPVVFEKQEAVNAAYFSGRCQAYTTDASGLASVRNKEAKVPADHLILPELISKEPLGPMVRRGDDEWFAIVKWVVYGLIEAEEYGVTQANVDAMTKDSKDPVVMRLTGSGEDTGKLLGLDKEWLVRAVKAVGNYGEIFERNVGPKTPLALPRGQNNQWNKGGQMYAMPVR

Samples

Sample ID Description Type Environment
1 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
135 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
136 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
137 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
138 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
139 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
140 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
161 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
162 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
163 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
164 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
165 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
202 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
222 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
223 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
224 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
225 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
226 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
227 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
235 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
236 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
243 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
244 2547132374 Acidovorax radicis N35 Isolate Unclassified
245 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
246 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
247 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
248 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
249 2643221609 Acidovorax sp. Root217 Isolate Unclassified
250 2643221611 Acidovorax sp. Root219 Isolate Unclassified
251 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
252 2643221658 Variovorax sp. Root411 Isolate Unclassified
253 2643221672 Variovorax sp. Root434 Isolate Unclassified
254 2643221683 Variovorax sp. Root473 Isolate Unclassified
255 2643221717 Acidovorax sp. Root267 Isolate Unclassified
256 2738541277 Variovorax sp. GV051 Isolate Unclassified
257 2738541307 Variovorax sp. GV008 Isolate Unclassified
258 2738543012 Acidovorax sp. CF301 Isolate Unclassified
259 2738543019 Variovorax sp. GV040 Isolate Unclassified
260 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
261 2816332133 Acidovorax radicis 2721A Isolate Unclassified
262 2818991446 Variovorax sp. 1180 Isolate Unclassified
263 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
264 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
265 2842677519 Variovorax sp. R-72495 Isolate Unclassified
266 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
267 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
268 2885198086 Variovorax sp. 679 Isolate Unclassified
269 2885211737 Variovorax sp. 553 Isolate Unclassified
270 2899924645 Variovorax sp. 369 Isolate Unclassified
271 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
272 2904456579 Variovorax sp. 2002 Isolate Unclassified
273 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
274 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
275 2928037797 Variovorax sp. 1126 Isolate Unclassified
276 2928044640 Variovorax sp. 1128 Isolate Unclassified
277 2928051484 Variovorax sp. 1133 Isolate Unclassified
278 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
279 2928070936 Variovorax gossypii 1167 Isolate Unclassified
280 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
281 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
282 2929520902 Variovorax beijingensis 502 Isolate Unclassified
283 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
284 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
285 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
286 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
287 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
288 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.53
Metatranscriptomes 0
Isolates 10.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.75
Nodule 0.89
Rhizoplane 1.11
Rhizosphere 46.99
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500660_067721 3300053100 Bacteria 1689
2 JGI25155J39150_1000009 3300002704 Bacteria 224358
3 JGI25156J39149_1000009 3300002705 Bacteria 224379
4 JGI25154J39366_1000024 3300002738 Bacteria 211372
5 JGI25158J39367_1007303 3300002739 Bacteria 1561
6 JGI25157J39369_1000007 3300002741 Bacteria 224377
7 JGI25152J39213_1003701 3300002773 Bacteria 5128
8 JGI25150J39212_1001859 3300002774 Bacteria 5576
9 JGI25159J45721_1000546 3300002987 Bacteria 17108
10 JGI25159J45721_1003871 3300002987 Bacteria 5128
11 JGI25159J45721_1004681 3300002987 Bacteria 4471
12 JGI25151J46595_10002356 3300003187 Bacteria 11484
13 JGI25151J46595_10007640 3300003187 Bacteria 5275
14 JGI25151J46595_10013840 3300003187 Bacteria 3617
15 JGI25153J46596_10007642 3300003215 Bacteria 5275
16 JGI25153J46596_10010817 3300003215 Bacteria 4090
17 rootH1_10037382 3300003316 Bacteria 3911
18 JGI25160J50197_1000117 3300003354 Bacteria 72240
19 JGI25160J50197_1005635 3300003354 Bacteria 5183
20 JGI25160J50197_1008233 3300003354 Bacteria 3990
21 JGI25161J50226_1000009 3300003374 Bacteria 224699
22 JGI25161J50226_1002188 3300003374 Bacteria 5207
23 JGI25161J50226_1005799 3300003374 Bacteria 2329
24 Ga0055535_1000520 3300003761 Bacteria 33578
25 Ga0055542_1000021 3300003762 Bacteria 331499
26 Ga0055526_1007648 3300003771 Bacteria 5571
27 Ga0055526_1008775 3300003771 Bacteria 4979
28 Ga0055526_1009223 3300003771 Bacteria 4786
29 Ga0055537_1000020 3300003773 Bacteria 117325
30 Ga0055537_1000285 3300003773 Bacteria 36115
31 Ga0055537_1003192 3300003773 Bacteria 5122
32 Ga0055537_1006280 3300003773 Bacteria 3042
33 Ga0055524_1000047 3300003775 Bacteria 150887
34 Ga0055524_1006369 3300003775 Bacteria 5122
35 Ga0055524_1006386 3300003775 Bacteria 5114
36 Ga0055536_1000972 3300003781 Bacteria 18246
37 Ga0055536_1002662 3300003781 Bacteria 9905
38 Ga0055534_1000018 3300003784 Bacteria 138136
39 Ga0055534_1002128 3300003784 Bacteria 7106
40 Ga0055534_1003298 3300003784 Bacteria 5122
41 Ga0055528_1000509 3300003790 Bacteria 30550
42 Ga0055528_1006838 3300003790 Bacteria 5122
43 Ga0055528_1013772 3300003790 Bacteria 3042
44 Ga0055530_10004362 3300003791 Bacteria 7334
45 Ga0055540_1000027 3300003792 Bacteria 187454
46 Ga0055540_1001939 3300003792 Bacteria 11570
47 Ga0055531_10009166 3300003794 Bacteria 5099
48 Ga0055531_10010804 3300003794 Bacteria 4493
49 Ga0055543_1003068 3300004625 Bacteria 5134
50 Ga0065165_1007453 3300005262 Bacteria 5370
51 Ga0065165_1038013 3300005262 Bacteria 1454
52 Ga0065165_1038016 3300005262 Bacteria 1454
53 Ga0065707_10088748 3300005295 Bacteria 4563
54 Ga0070660_100005548 3300005339 Bacteria 8740
55 Ga0070674_100006603 3300005356 Bacteria 6782
56 Ga0070674_100322870 3300005356 Bacteria 1238
57 Ga0070701_10012330 3300005438 Bacteria 3852
58 Ga0070701_10045307 3300005438 Bacteria 2256
59 Ga0070708_100401760 3300005445 Bacteria 1292
60 Ga0070662_100019751 3300005457 Bacteria 4580
61 Ga0070681_10005034 3300005458 Bacteria 12741
62 Ga0070681_10049038 3300005458 Bacteria 4218
63 Ga0070681_10160784 3300005458 Bacteria 2170
64 Ga0068867_100000415 3300005459 Bacteria 28504
65 Ga0070706_100024276 3300005467 Bacteria 5581
66 Ga0070698_100202724 3300005471 Bacteria 1919
67 Ga0070699_100064951 3300005518 Bacteria 3166
68 Ga0070699_100369360 3300005518 Bacteria 1294
69 Ga0070679_100016044 3300005530 Bacteria 7215
70 Ga0070679_100118439 3300005530 Bacteria 2633
71 Ga0070679_100397177 3300005530 Bacteria 1325
72 Ga0070697_100163215 3300005536 Bacteria 1883
73 Ga0068853_100147558 3300005539 Bacteria 2115
74 Ga0070672_100013371 3300005543 Bacteria 5797
75 Ga0070665_100144207 3300005548 Bacteria 2385
76 Ga0070704_100022351 3300005549 Bacteria 4114
77 Ga0068855_100091243 3300005563 Bacteria 3514
78 Ga0068856_100083032 3300005614 Bacteria 3181
79 Ga0068859_100137898 3300005617 Bacteria 2513
80 Ga0068864_100102860 3300005618 Bacteria 2536
81 Ga0068866_10005869 3300005718 Bacteria 5099
82 Ga0068861_100000811 3300005719 Bacteria 18865
83 Ga0068858_100006181 3300005842 Bacteria 11680
84 Ga0068858_100280707 3300005842 Bacteria 1586
85 Ga0068860_100002168 3300005843 Bacteria 20685
86 Ga0068862_100003580 3300005844 Bacteria 13297
87 Ga0075365_10000720 3300006038 Bacteria 13378
88 Ga0075365_10132385 3300006038 Bacteria 1726
89 Ga0075363_100016634 3300006048 Bacteria 3636
90 Ga0075363_100019584 3300006048 Bacteria 3384
91 Ga0075363_100033987 3300006048 Bacteria 2660
92 Ga0075364_10008499 3300006051 Bacteria 6140
93 Ga0075364_10019349 3300006051 Bacteria 4273
94 Ga0075364_10072592 3300006051 Bacteria 2268
95 Ga0075366_10012958 3300006195 Bacteria 4739
96 Ga0097621_100070737 3300006237 Bacteria 2882
97 Ga0075370_10001993 3300006353 Bacteria 9255
98 Ga0075370_10062396 3300006353 Bacteria 2123
99 Ga0075370_10067028 3300006353 Bacteria 2049
100 Ga0068871_100194124 3300006358 Bacteria 1750
101 Ga0075428_100014628 3300006844 Bacteria 8714
102 Ga0097620_100137896 3300006931 Bacteria 2513
103 Ga0079104_1023764 3300006946 Bacteria 1625
104 Ga0099826_10000116 3300006948 Bacteria 36767
105 Ga0105244_10005152 3300009036 Bacteria 8761
106 Ga0105244_10007093 3300009036 Bacteria 7164
107 Ga0105240_10008954 3300009093 Bacteria 14231
108 Ga0111539_10000771 3300009094 Bacteria 41650
109 Ga0105245_10078866 3300009098 Bacteria 3006
110 Ga0105237_10028602 3300009545 Bacteria 5675
111 Ga0105237_10111083 3300009545 Bacteria 2733
112 Ga0105238_10059018 3300009551 Bacteria 3845
113 Ga0157347_1001247 3300012502 Bacteria 1956
114 Ga0157370_10008602 3300013104 Bacteria 10991
115 Ga0157370_10126458 3300013104 Bacteria 2386
116 Ga0157378_10049664 3300013297 Bacteria 3732
117 Ga0157378_10133142 3300013297 Bacteria 2303
118 Ga0157375_10000321 3300013308 Bacteria 42980
119 Ga0157375_10130830 3300013308 Bacteria 2628
120 Ga0157380_10011696 3300014326 Bacteria 6346
121 Ga0157380_10046622 3300014326 Bacteria 3405
122 Ga0157380_10208600 3300014326 Bacteria 1739
123 Ga0182008_10000190 3300014497 Bacteria 48677
124 Ga0182008_10001478 3300014497 Bacteria 15700
125 Ga0157379_10049634 3300014968 Bacteria 3747
126 Ga0157379_10125586 3300014968 Bacteria 2308
127 Ga0157379_10352311 3300014968 Bacteria 1348
128 Ga0182006_1002550 3300015261 Bacteria 9881
129 Ga0182007_10000789 3300015262 Bacteria 17718
130 Ga0163161_10000149 3300017792 Bacteria 64127
131 Ga0163161_10007203 3300017792 Bacteria 7688
132 Ga0163161_10323953 3300017792 Bacteria 1219
133 Ga0209435_100008 3300025206 Bacteria 503644
134 Ga0209436_103481 3300025208 Bacteria 4170
135 Ga0209436_106849 3300025208 Bacteria 2446
136 Ga0209436_109378 3300025208 Bacteria 1868
137 Ga0209672_101411 3300025228 Bacteria 8750
138 Ga0209258_100058 3300025242 Bacteria 331567
139 Ga0207425_1000368 3300025245 Bacteria 31204
140 Ga0207425_1004113 3300025245 Bacteria 4451
141 Ga0207425_1005188 3300025245 Bacteria 3751
142 Ga0209646_1000029 3300025246 Bacteria 386414
143 Ga0209026_1000016 3300025250 Bacteria 386457
144 Ga0209148_1000071 3300025254 Bacteria 331551
145 Ga0209759_1000016 3300025256 Bacteria 386414
146 Ga0209129_1000023 3300025258 Bacteria 420646
147 Ga0209129_1003442 3300025258 Bacteria 6870
148 Ga0209129_1003948 3300025258 Bacteria 6136
149 Ga0209129_1009149 3300025258 Bacteria 2651
150 Ga0209565_1000075 3300025263 Bacteria 162259
151 Ga0209565_1000122 3300025263 Bacteria 111132
152 Ga0209565_1000187 3300025263 Bacteria 76001
153 Ga0209565_1000389 3300025263 Bacteria 37285
154 Ga0209565_1001234 3300025263 Bacteria 12012
155 Ga0209673_1000066 3300025273 Bacteria 250037
156 Ga0209673_1000289 3300025273 Bacteria 93941
157 Ga0209673_1000298 3300025273 Bacteria 91771
158 Ga0209673_1000389 3300025273 Bacteria 79243
159 Ga0209673_1007435 3300025273 Bacteria 5052
160 Ga0209130_1000014 3300025284 Bacteria 412039
161 Ga0209130_1000069 3300025284 Bacteria 179177
162 Ga0209130_1000415 3300025284 Bacteria 46113
163 Ga0209130_1001257 3300025284 Bacteria 17680
164 Ga0209675_1000074 3300025291 Bacteria 162260
165 Ga0209675_1000098 3300025291 Bacteria 130512
166 Ga0209675_1000177 3300025291 Bacteria 73574
167 Ga0209675_1000830 3300025291 Bacteria 20316
168 Ga0209675_1003101 3300025291 Bacteria 8113
169 Ga0209676_1000005 3300025292 Bacteria 1076001
170 Ga0209676_1000013 3300025292 Bacteria 816080
171 Ga0209676_1000142 3300025292 Bacteria 175752
172 Ga0209676_1000572 3300025292 Bacteria 55433
173 Ga0209676_1000900 3300025292 Bacteria 37519
174 Ga0209676_1008075 3300025292 Bacteria 4781
175 Ga0209025_1000351 3300025294 Bacteria 99585
176 Ga0209025_1000644 3300025294 Bacteria 61330
177 Ga0209025_1001844 3300025294 Bacteria 24885
178 Ga0209025_1002100 3300025294 Bacteria 22497
179 Ga0209025_1002386 3300025294 Bacteria 20102
180 Ga0209025_1004386 3300025294 Bacteria 12283
181 Ga0209025_1006494 3300025294 Bacteria 9046
182 Ga0209025_1016716 3300025294 Bacteria 4298
183 Ga0209025_1023454 3300025294 Bacteria 3223
184 Ga0209564_1000090 3300025295 Bacteria 249298
185 Ga0209564_1000181 3300025295 Bacteria 151002
186 Ga0209564_1000247 3300025295 Bacteria 116628
187 Ga0209564_1000527 3300025295 Bacteria 62263
188 Ga0209564_1000598 3300025295 Bacteria 56491
189 Ga0209758_1000044 3300025297 Bacteria 398448
190 Ga0209758_1001180 3300025297 Bacteria 33051
191 Ga0209758_1012549 3300025297 Bacteria 4727
192 Ga0209758_1015887 3300025297 Bacteria 3865
193 Ga0209758_1022013 3300025297 Bacteria 2943
194 Ga0209050_1000007 3300025298 Bacteria 1187891
195 Ga0209050_1000008 3300025298 Bacteria 1144179
196 Ga0209050_1001512 3300025298 Bacteria 24562
197 Ga0209050_1007343 3300025298 Bacteria 6202
198 Ga0209050_1007538 3300025298 Bacteria 6066
199 Ga0209256_1000020 3300025299 Bacteria 542402
200 Ga0209256_1000022 3300025299 Bacteria 481843
201 Ga0209256_1000039 3300025299 Bacteria 372337
202 Ga0209256_1021354 3300025299 Bacteria 1991
203 Ga0207426_1000001 3300025302 Bacteria 1341301
204 Ga0207426_1000031 3300025302 Bacteria 460699
205 Ga0207426_1000224 3300025302 Bacteria 130233
206 Ga0207426_1000714 3300025302 Bacteria 38628
207 Ga0209051_1000005 3300025303 Bacteria 1142353
208 Ga0209051_1000036 3300025303 Bacteria 339863
209 Ga0209051_1000500 3300025303 Bacteria 49702
210 Ga0209051_1001023 3300025303 Bacteria 26694
211 Ga0209051_1001418 3300025303 Bacteria 20578
212 Ga0209257_1000011 3300025304 Bacteria 1112630
213 Ga0209257_1000031 3300025304 Bacteria 688770
214 Ga0209257_1000226 3300025304 Bacteria 133836
215 Ga0209257_1006760 3300025304 Bacteria 7226
216 Ga0207655_1000554 3300025728 Bacteria 46735
217 Ga0207655_1004987 3300025728 Bacteria 9194
218 Ga0207645_10037875 3300025907 Bacteria 3095
219 Ga0207684_10021806 3300025910 Bacteria 5468
220 Ga0207707_10006861 3300025912 Bacteria 9931
221 Ga0207707_10055841 3300025912 Bacteria 3435
222 Ga0207695_10351445 3300025913 Bacteria 1361
223 Ga0207662_10129160 3300025918 Bacteria 1592
224 Ga0207652_10038890 3300025921 Bacteria 4035
225 Ga0207652_10301664 3300025921 Bacteria 1446
226 Ga0207681_10032320 3300025923 Bacteria 3425
227 Ga0207659_10158904 3300025926 Bacteria 1772
228 Ga0207644_10054639 3300025931 Bacteria 2877
229 Ga0207706_10026111 3300025933 Bacteria 5229
230 Ga0207686_10026001 3300025934 Bacteria 3413
231 Ga0207686_10095026 3300025934 Bacteria 1977
232 Ga0207709_10032837 3300025935 Bacteria 3042
233 Ga0207709_10036986 3300025935 Bacteria 2898
234 Ga0207709_10251224 3300025935 Bacteria 1292
235 Ga0207670_10038865 3300025936 Bacteria 3111
236 Ga0207691_10063621 3300025940 Bacteria 3345
237 Ga0207711_10017201 3300025941 Bacteria 6009
238 Ga0207689_10105659 3300025942 Bacteria 2313
239 Ga0207667_10118644 3300025949 Bacteria 2726
240 Ga0207703_10005344 3300026035 Bacteria 10343
241 Ga0207703_10020952 3300026035 Bacteria 5115
242 Ga0207703_10056443 3300026035 Bacteria 3199
243 Ga0207703_10231400 3300026035 Bacteria 1657
244 Ga0207639_10038971 3300026041 Bacteria 3538
245 Ga0207648_10000133 3300026089 Bacteria 73580
246 Ga0207648_10024245 3300026089 Bacteria 5418
247 Ga0207676_10169087 3300026095 Bacteria 1903
248 Ga0207676_10356007 3300026095 Bacteria 1355
249 Ga0207675_100000103 3300026118 Bacteria 67419
250 Ga0207683_10008738 3300026121 Bacteria 8648
251 Ga0207683_10260555 3300026121 Bacteria 1583
252 Ga0209282_1000114 3300027666 Bacteria 51706
253 Ga0209974_10001142 3300027876 Bacteria 9447
254 Ga0207428_10045128 3300027907 Bacteria 3552
255 Ga0268266_10175225 3300028379 Bacteria 1949
256 Ga0268266_10204860 3300028379 Bacteria 1807
257 Ga0268264_10045281 3300028381 Bacteria 3652
258 Ga0307515_10000131 3300028794 Bacteria 178919
259 Ga0307515_10010437 3300028794 Bacteria 17795
260 Ga0307515_10211517 3300028794 Bacteria 1782
261 Ga0316177_1049165 3300030731 Bacteria 4951
262 Ga0316176_1022729 3300030732 Bacteria 1537
263 Ga0314311_1006667 3300030733 Bacteria 5104
264 Ga0316179_1013086 3300030734 Bacteria 4563
265 Ga0316180_1120001 3300030736 Bacteria 5923
266 Ga0316181_1240660 3300030744 Bacteria 1748
267 Ga0316182_1209257 3300030745 Bacteria 6688
268 Ga0265332_10000035 3300031238 Bacteria 139554
269 Ga0265328_10007074 3300031239 Bacteria 4700
270 Ga0307513_10000219 3300031456 Bacteria 82663
271 Ga0307509_10001905 3300031507 Bacteria 34457
272 Ga0307509_10028710 3300031507 Bacteria 6182
273 Ga0307408_100000068 3300031548 Bacteria 120700
274 Ga0307408_100024207 3300031548 Bacteria 4143
275 Ga0307408_100187544 3300031548 Bacteria 1663
276 Ga0307508_10018843 3300031616 Bacteria 6271
277 Ga0307514_10048460 3300031649 Bacteria 3309
278 Ga0307516_10190089 3300031730 Bacteria 1780
279 Ga0307413_10336098 3300031824 Bacteria 1160
280 Ga0307406_10000274 3300031901 Bacteria 30854
281 Ga0307406_10046207 3300031901 Bacteria 2738
282 Ga0307412_10188469 3300031911 Bacteria 1557
283 Ga0307416_100259266 3300032002 Bacteria 1698
284 Ga0307416_100270026 3300032002 Bacteria 1669
285 Ga0307416_100352378 3300032002 Bacteria 1490
286 Ga0307411_10012213 3300032005 Bacteria 4674
287 Ga0307415_100257851 3300032126 Bacteria 1421
288 Ga0307510_10091198 3300033180 Bacteria 2890
289 Ga0373937_0071404 3300036401 Bacteria 3202
290 Ga0373937_0097500 3300036401 Bacteria 2727
291 Ga0373925_0034112 3300037068 Bacteria 3751
292 Ga0395905_0012063 3300037471 Bacteria 8328
293 Ga0436360_0220877 3300039438 Bacteria 2414
294 Ga0450911_000152 3300042115 Bacteria 27922
295 Ga0450923_000539 3300042125 Bacteria 4246
296 Ga0450896_005123 3300042133 Bacteria 1785
297 Ga0450906_004202 3300042145 Bacteria 3037
298 Ga0450907_006243 3300042146 Bacteria 1994
299 Ga0450908_001043 3300042184 Bacteria 5371
300 Ga0439434_0008074 3300042435 Bacteria 3086
301 Ga0450918_000923 3300042531 Bacteria 6145
302 Ga0451577_0000237 3300042876 Bacteria 109473
303 Ga0451577_0002148 3300042876 Bacteria 24144
304 Ga0451577_0008909 3300042876 Bacteria 9712
305 Ga0451577_0023335 3300042876 Bacteria 5643
306 Ga0451577_0128452 3300042876 Bacteria 2272
307 Ga0453683_0015775 3300044673 Bacteria 4885
308 Ga0453683_0099366 3300044673 Bacteria 1827
309 Ga0453684_0000121 3300044712 Bacteria 341067
310 Ga0453684_0015045 3300044712 Bacteria 12278
311 Ga0453684_0021884 3300044712 Bacteria 9515
312 Ga0453684_0089656 3300044712 Bacteria 3802
313 Ga0453684_0127682 3300044712 Bacteria 3057
314 Ga0451576_0001958 3300045051 Bacteria 32802
315 Ga0451576_0003156 3300045051 Bacteria 23064
316 Ga0451576_0004341 3300045051 Bacteria 18511
317 Ga0495590_0010535 3300046457 Bacteria 3473
318 Ga0495638_0013283 3300046460 Bacteria 5615
319 Ga0495638_0087432 3300046460 Bacteria 1883
320 Ga0495650_0011333 3300046471 Bacteria 4895
321 Ga0495610_0045026 3300046512 Bacteria 2185
322 Ga0495616_0015647 3300046513 Bacteria 4214
323 Ga0495631_0000339 3300046518 Bacteria 32159
324 Ga0495586_0015260 3300046535 Bacteria 4086
325 Ga0495609_0000288 3300046538 Bacteria 46408
326 Ga0495621_0014988 3300046539 Bacteria 2465
327 Ga0495621_0025165 3300046539 Bacteria 1997
328 Ga0495597_0003726 3300046542 Bacteria 8702
329 Ga0495625_0000044 3300046660 Bacteria 203855
330 Ga0495625_0018329 3300046660 Bacteria 5467
331 Ga0495658_0035725 3300046683 Bacteria 2737
332 Ga0495670_0088754 3300046691 Bacteria 1581
333 Ga0495671_0062168 3300046692 Bacteria 1840
334 Ga0496100_0281789 3300048903 Bacteria 1239
335 Ga0496106_0139661 3300048909 Bacteria 1905
336 Ga0496116_0106159 3300048919 Bacteria 1664
337 Ga0496117_0016771 3300048920 Bacteria 6156
338 Ga0496121_0013477 3300048924 Bacteria 8777
339 Ga0496121_0100711 3300048924 Bacteria 2229
340 Ga0496124_0024896 3300048927 Bacteria 5431
341 Ga0496125_0003303 3300048928 Bacteria 19766
342 Ga0496125_0004616 3300048928 Bacteria 15745
343 Ga0496125_0055984 3300048928 Bacteria 3207
344 Ga0496126_0255332 3300048929 Bacteria 1459
345 Ga0501031_0217136 3300049568 Bacteria 1246
346 Ga0501048_0107248 3300049582 Bacteria 1972
347 Ga0501071_0329411 3300049587 Bacteria 1160
348 Ga0501074_0033350 3300049590 Bacteria 3731
349 Ga0501075_0029823 3300049591 Bacteria 4036
350 Ga0501075_0211276 3300049591 Bacteria 1480
351 Ga0501076_0095408 3300049592 Bacteria 2395
352 Ga0501077_0015539 3300049593 Bacteria 4793
353 Ga0501209_000142 3300049656 Bacteria 7841
354 Ga0501223_022421 3300049663 Bacteria 1233
355 Ga0501225_0001852 3300049705 Bacteria 6638
356 Ga0501079_0005685 3300049741 Bacteria 9312
357 Ga0501080_0006003 3300049742 Bacteria 10888
358 Ga0501080_0100286 3300049742 Bacteria 2687
359 Ga0501081_0036094 3300049743 Bacteria 3369
360 Ga0501262_000035 3300049759 Bacteria 17582
361 Ga0501035_0332505 3300049822 Bacteria 1275
362 Ga0501045_0123203 3300049824 Bacteria 1925
363 Ga0501045_0301971 3300049824 Bacteria 1191
364 nmdc:mga03n38_23888_c1 3300050490 Bacteria 2493
365 nmdc:mga00v17_22901_c1 3300050491 Bacteria 3610
366 nmdc:mga0yw44_42976_c1 3300050492 Unclassified 2697
367 nmdc:mga0k408_55229_c1 3300050493 Bacteria 2303
368 nmdc:mga0k408_6843_c1 3300050493 Bacteria 6081
369 nmdc:mga07m45_32956_c1 3300050496 Bacteria 2875
370 nmdc:mga07m45_7509_c2 3300050496 Bacteria 4054
371 nmdc:mga08y16_866_c1 3300050511 Bacteria 29145
372 Ga0500610_0003490 3300053079 Bacteria 6047
373 Ga0500643_001367 3300053087 Bacteria 14144
374 Ga0500644_0001573 3300053088 Bacteria 5984
375 Ga0500651_0000208 3300053093 Bacteria 36941
376 Ga0500651_0006783 3300053093 Bacteria 6631
377 Ga0500641_0009813 3300053096 Bacteria 3448
378 Ga0500571_000048 3300053110 Bacteria 37193
379 Ga0500593_000271 3300053117 Bacteria 21197
380 Ga0500593_002226 3300053117 Bacteria 7080
381 Ga0500594_0000482 3300053118 Bacteria 8730
382 Ga0500607_002108 3300053121 Bacteria 16617
383 Ga0500608_006598 3300053122 Bacteria 4735
384 Ga0500628_001447 3300053129 Bacteria 4064
385 Ga0500655_000951 3300053133 Bacteria 5595
386 Ga0500658_0000160 3300053134 Bacteria 32138
387 Ga0500658_0000259 3300053134 Bacteria 24435
388 Ga0500559_0005158 3300053136 Bacteria 6033
389 Ga0500561_0008268 3300053137 Bacteria 2066
390 Ga0500568_0024406 3300053139 Bacteria 2561
391 Ga0500604_0025793 3300053151 Bacteria 1691
392 Ga0500616_0025608 3300053153 Bacteria 3271
393 Ga0500616_0029305 3300053153 Bacteria 3029
394 Ga0500616_0054757 3300053153 Bacteria 2088
395 Ga0500627_0000453 3300053158 Bacteria 11116
396 Ga0500634_0061818 3300053161 Bacteria 1985
397 Ga0500638_008987 3300053162 Bacteria 4292
398 Ga0500645_026996 3300053730 Bacteria 1743
399 Ga0501084_0001005 3300054114 Bacteria 21910
400 Ga0500661_000189 3300055283 Bacteria 10774
401 Ga0501082_0013908 3300060353 Bacteria 6920
402 Ga0530510_0061565 3300061734 Bacteria 2717
403 2511246631 2511231002 Bacteria 5042903
404 2513231388 2513020051 Bacteria 6053213
405 2548496939 2547132374 Bacteria 5530232
406 2599626630 2599185214 Bacteria 8209958
407 2599675694 2599185226 Bacteria 8233575
408 2599684167 2599185227 Bacteria 8246414
409 2599696181 2599185229 Bacteria 8216126
410 2644062942 2643221609 Bacteria 6756331
411 2644070625 2643221611 Bacteria 6820941
412 2644163242 2643221628 Bacteria 5745828
413 2644327907 2643221658 Bacteria 6064537
414 2644397868 2643221672 Bacteria 6322190
415 2644468294 2643221683 Bacteria 5749203
416 2644645557 2643221717 Bacteria 5676132
417 2738718047 2738541277 Bacteria 7458140
418 2738885051 2738541307 Bacteria 8606193
419 2739245403 2738543012 Bacteria 7115078
420 2739278733 2738543019 Bacteria 7459457
421 2739612779 2739367655 Bacteria 4051151
422 2816474766 2816332133 Bacteria 7249298
423 2819595741 2818991446 Bacteria 7757362
424 2831266752 2831265667 Bacteria 7184833
425 2838057169 2838054893 Bacteria 7451788
426 2842679649 2842677519 Bacteria 5615038
427 2883294209 2883291878 Bacteria 5894118
428 2883357262 2883354860 Bacteria 5865246
429 2885201201 2885198086 Bacteria 7212419
430 2885214855 2885211737 Bacteria 7212420
431 2899925087 2899924645 Bacteria 7487985
432 2904455752 2904449895 Bacteria 6927402
433 2904457817 2904456579 Bacteria 6819253
434 2904544778 2904541872 Bacteria 8915136
435 2919467260 2919462493 Bacteria 5817112
436 2928038788 2928037797 Bacteria 7273642
437 2928045607 2928044640 Bacteria 7271509
438 2928053224 2928051484 Bacteria 7773759
439 2928066829 2928064002 Bacteria 7419480
440 2928071286 2928070936 Bacteria 8062541
441 2928084785 2928084124 Bacteria 7159212
442 2929163551 2929160207 Bacteria 9075316
443 2929522735 2929520902 Bacteria 6765052
444 2939633016 2939631187 Bacteria 6118131
445 2945912240 2945909444 Bacteria 7065066
446 2945947719 2945945610 Bacteria 5951079
447 2945977423 2945972063 Bacteria 6086495
448 2945985447 2945984333 Bacteria 7358892
449 2954772036 2954767861 Bacteria 5535784
450 Ga0500660_067721
451 JGI25155J39150_1000009
452 JGI25156J39149_1000009
453 JGI25154J39366_1000024
454 JGI25158J39367_1007303
455 JGI25157J39369_1000007
456 JGI25152J39213_1003701
457 JGI25150J39212_1001859
458 JGI25159J45721_1000546
459 JGI25159J45721_1003871
460 JGI25159J45721_1004681
461 JGI25151J46595_10002356
462 JGI25151J46595_10007640
463 JGI25151J46595_10013840
464 JGI25153J46596_10007642
465 JGI25153J46596_10010817
466 rootH1_10037382
467 JGI25160J50197_1000117
468 JGI25160J50197_1005635
469 JGI25160J50197_1008233
470 JGI25161J50226_1000009
471 JGI25161J50226_1002188
472 JGI25161J50226_1005799
473 Ga0055535_1000520
474 Ga0055542_1000021
475 Ga0055526_1007648
476 Ga0055526_1008775
477 Ga0055526_1009223
478 Ga0055537_1000020
479 Ga0055537_1000285
480 Ga0055537_1003192
481 Ga0055537_1006280
482 Ga0055524_1000047
483 Ga0055524_1006369
484 Ga0055524_1006386
485 Ga0055536_1000972
486 Ga0055536_1002662
487 Ga0055534_1000018
488 Ga0055534_1002128
489 Ga0055534_1003298
490 Ga0055528_1000509
491 Ga0055528_1006838
492 Ga0055528_1013772
493 Ga0055530_10004362
494 Ga0055540_1000027
495 Ga0055540_1001939
496 Ga0055531_10009166
497 Ga0055531_10010804
498 Ga0055543_1003068
499 Ga0065165_1007453
500 Ga0065165_1038013
501 Ga0065165_1038016
502 Ga0065707_10088748
503 Ga0070660_100005548
504 Ga0070674_100006603
505 Ga0070674_100322870
506 Ga0070701_10012330
507 Ga0070701_10045307
508 Ga0070708_100401760
509 Ga0070662_100019751
510 Ga0070681_10005034
511 Ga0070681_10049038
512 Ga0070681_10160784
513 Ga0068867_100000415
514 Ga0070706_100024276
515 Ga0070698_100202724
516 Ga0070699_100064951
517 Ga0070699_100369360
518 Ga0070679_100016044
519 Ga0070679_100118439
520 Ga0070679_100397177
521 Ga0070697_100163215
522 Ga0068853_100147558
523 Ga0070672_100013371
524 Ga0070665_100144207
525 Ga0070704_100022351
526 Ga0068855_100091243
527 Ga0068856_100083032
528 Ga0068859_100137898
529 Ga0068864_100102860
530 Ga0068866_10005869
531 Ga0068861_100000811
532 Ga0068858_100006181
533 Ga0068858_100280707
534 Ga0068860_100002168
535 Ga0068862_100003580
536 Ga0075365_10000720
537 Ga0075365_10132385
538 Ga0075363_100016634
539 Ga0075363_100019584
540 Ga0075363_100033987
541 Ga0075364_10008499
542 Ga0075364_10019349
543 Ga0075364_10072592
544 Ga0075366_10012958
545 Ga0097621_100070737
546 Ga0075370_10001993
547 Ga0075370_10062396
548 Ga0075370_10067028
549 Ga0068871_100194124
550 Ga0075428_100014628
551 Ga0097620_100137896
552 Ga0079104_1023764
553 Ga0099826_10000116
554 Ga0105244_10005152
555 Ga0105244_10007093
556 Ga0105240_10008954
557 Ga0111539_10000771
558 Ga0105245_10078866
559 Ga0105237_10028602
560 Ga0105237_10111083
561 Ga0105238_10059018
562 Ga0157347_1001247
563 Ga0157370_10008602
564 Ga0157370_10126458
565 Ga0157378_10049664
566 Ga0157378_10133142
567 Ga0157375_10000321
568 Ga0157375_10130830
569 Ga0157380_10011696
570 Ga0157380_10046622
571 Ga0157380_10208600
572 Ga0182008_10000190
573 Ga0182008_10001478
574 Ga0157379_10049634
575 Ga0157379_10125586
576 Ga0157379_10352311
577 Ga0182006_1002550
578 Ga0182007_10000789
579 Ga0163161_10000149
580 Ga0163161_10007203
581 Ga0163161_10323953
582 Ga0209435_100008
583 Ga0209436_103481
584 Ga0209436_106849
585 Ga0209436_109378
586 Ga0209672_101411
587 Ga0209258_100058
588 Ga0207425_1000368
589 Ga0207425_1004113
590 Ga0207425_1005188
591 Ga0209646_1000029
592 Ga0209026_1000016
593 Ga0209148_1000071
594 Ga0209759_1000016
595 Ga0209129_1000023
596 Ga0209129_1003442
597 Ga0209129_1003948
598 Ga0209129_1009149
599 Ga0209565_1000075
600 Ga0209565_1000122
601 Ga0209565_1000187
602 Ga0209565_1000389
603 Ga0209565_1001234
604 Ga0209673_1000066
605 Ga0209673_1000289
606 Ga0209673_1000298
607 Ga0209673_1000389
608 Ga0209673_1007435
609 Ga0209130_1000014
610 Ga0209130_1000069
611 Ga0209130_1000415
612 Ga0209130_1001257
613 Ga0209675_1000074
614 Ga0209675_1000098
615 Ga0209675_1000177
616 Ga0209675_1000830
617 Ga0209675_1003101
618 Ga0209676_1000005
619 Ga0209676_1000013
620 Ga0209676_1000142
621 Ga0209676_1000572
622 Ga0209676_1000900
623 Ga0209676_1008075
624 Ga0209025_1000351
625 Ga0209025_1000644
626 Ga0209025_1001844
627 Ga0209025_1002100
628 Ga0209025_1002386
629 Ga0209025_1004386
630 Ga0209025_1006494
631 Ga0209025_1016716
632 Ga0209025_1023454
633 Ga0209564_1000090
634 Ga0209564_1000181
635 Ga0209564_1000247
636 Ga0209564_1000527
637 Ga0209564_1000598
638 Ga0209758_1000044
639 Ga0209758_1001180
640 Ga0209758_1012549
641 Ga0209758_1015887
642 Ga0209758_1022013
643 Ga0209050_1000007
644 Ga0209050_1000008
645 Ga0209050_1001512
646 Ga0209050_1007343
647 Ga0209050_1007538
648 Ga0209256_1000020
649 Ga0209256_1000022
650 Ga0209256_1000039
651 Ga0209256_1021354
652 Ga0207426_1000001
653 Ga0207426_1000031
654 Ga0207426_1000224
655 Ga0207426_1000714
656 Ga0209051_1000005
657 Ga0209051_1000036
658 Ga0209051_1000500
659 Ga0209051_1001023
660 Ga0209051_1001418
661 Ga0209257_1000011
662 Ga0209257_1000031
663 Ga0209257_1000226
664 Ga0209257_1006760
665 Ga0207655_1000554
666 Ga0207655_1004987
667 Ga0207645_10037875
668 Ga0207684_10021806
669 Ga0207707_10006861
670 Ga0207707_10055841
671 Ga0207695_10351445
672 Ga0207662_10129160
673 Ga0207652_10038890
674 Ga0207652_10301664
675 Ga0207681_10032320
676 Ga0207659_10158904
677 Ga0207644_10054639
678 Ga0207706_10026111
679 Ga0207686_10026001
680 Ga0207686_10095026
681 Ga0207709_10032837
682 Ga0207709_10036986
683 Ga0207709_10251224
684 Ga0207670_10038865
685 Ga0207691_10063621
686 Ga0207711_10017201
687 Ga0207689_10105659
688 Ga0207667_10118644
689 Ga0207703_10005344
690 Ga0207703_10020952
691 Ga0207703_10056443
692 Ga0207703_10231400
693 Ga0207639_10038971
694 Ga0207648_10000133
695 Ga0207648_10024245
696 Ga0207676_10169087
697 Ga0207676_10356007
698 Ga0207675_100000103
699 Ga0207683_10008738
700 Ga0207683_10260555
701 Ga0209282_1000114
702 Ga0209974_10001142
703 Ga0207428_10045128
704 Ga0268266_10175225
705 Ga0268266_10204860
706 Ga0268264_10045281
707 Ga0307515_10000131
708 Ga0307515_10010437
709 Ga0307515_10211517
710 Ga0316177_1049165
711 Ga0316176_1022729
712 Ga0314311_1006667
713 Ga0316179_1013086
714 Ga0316180_1120001
715 Ga0316181_1240660
716 Ga0316182_1209257
717 Ga0265332_10000035
718 Ga0265328_10007074
719 Ga0307513_10000219
720 Ga0307509_10001905
721 Ga0307509_10028710
722 Ga0307408_100000068
723 Ga0307408_100024207
724 Ga0307408_100187544
725 Ga0307508_10018843
726 Ga0307514_10048460
727 Ga0307516_10190089
728 Ga0307413_10336098
729 Ga0307406_10000274
730 Ga0307406_10046207
731 Ga0307412_10188469
732 Ga0307416_100259266
733 Ga0307416_100270026
734 Ga0307416_100352378
735 Ga0307411_10012213
736 Ga0307415_100257851
737 Ga0307510_10091198
738 Ga0373937_0071404
739 Ga0373937_0097500
740 Ga0373925_0034112
741 Ga0395905_0012063
742 Ga0436360_0220877
743 Ga0450911_000152
744 Ga0450923_000539
745 Ga0450896_005123
746 Ga0450906_004202
747 Ga0450907_006243
748 Ga0450908_001043
749 Ga0439434_0008074
750 Ga0450918_000923
751 Ga0451577_0000237
752 Ga0451577_0002148
753 Ga0451577_0008909
754 Ga0451577_0023335
755 Ga0451577_0128452
756 Ga0453683_0015775
757 Ga0453683_0099366
758 Ga0453684_0000121
759 Ga0453684_0015045
760 Ga0453684_0021884
761 Ga0453684_0089656
762 Ga0453684_0127682
763 Ga0451576_0001958
764 Ga0451576_0003156
765 Ga0451576_0004341
766 Ga0495590_0010535
767 Ga0495638_0013283
768 Ga0495638_0087432
769 Ga0495650_0011333
770 Ga0495610_0045026
771 Ga0495616_0015647
772 Ga0495631_0000339
773 Ga0495586_0015260
774 Ga0495609_0000288
775 Ga0495621_0014988
776 Ga0495621_0025165
777 Ga0495597_0003726
778 Ga0495625_0000044
779 Ga0495625_0018329
780 Ga0495658_0035725
781 Ga0495670_0088754
782 Ga0495671_0062168
783 Ga0496100_0281789
784 Ga0496106_0139661
785 Ga0496116_0106159
786 Ga0496117_0016771
787 Ga0496121_0013477
788 Ga0496121_0100711
789 Ga0496124_0024896
790 Ga0496125_0003303
791 Ga0496125_0004616
792 Ga0496125_0055984
793 Ga0496126_0255332
794 Ga0501031_0217136
795 Ga0501048_0107248
796 Ga0501071_0329411
797 Ga0501074_0033350
798 Ga0501075_0029823
799 Ga0501075_0211276
800 Ga0501076_0095408
801 Ga0501077_0015539
802 Ga0501209_000142
803 Ga0501223_022421
804 Ga0501225_0001852
805 Ga0501079_0005685
806 Ga0501080_0006003
807 Ga0501080_0100286
808 Ga0501081_0036094
809 Ga0501262_000035
810 Ga0501035_0332505
811 Ga0501045_0123203
812 Ga0501045_0301971
813 nmdc:mga03n38_23888_c1
814 nmdc:mga00v17_22901_c1
815 nmdc:mga0yw44_42976_c1
816 nmdc:mga0k408_55229_c1
817 nmdc:mga0k408_6843_c1
818 nmdc:mga07m45_32956_c1
819 nmdc:mga07m45_7509_c2
820 nmdc:mga08y16_866_c1
821 Ga0500610_0003490
822 Ga0500643_001367
823 Ga0500644_0001573
824 Ga0500651_0000208
825 Ga0500651_0006783
826 Ga0500641_0009813
827 Ga0500571_000048
828 Ga0500593_000271
829 Ga0500593_002226
830 Ga0500594_0000482
831 Ga0500607_002108
832 Ga0500608_006598
833 Ga0500628_001447
834 Ga0500655_000951
835 Ga0500658_0000160
836 Ga0500658_0000259
837 Ga0500559_0005158
838 Ga0500561_0008268
839 Ga0500568_0024406
840 Ga0500604_0025793
841 Ga0500616_0025608
842 Ga0500616_0029305
843 Ga0500616_0054757
844 Ga0500627_0000453
845 Ga0500634_0061818
846 Ga0500638_008987
847 Ga0500645_026996
848 Ga0501084_0001005
849 Ga0500661_000189
850 Ga0501082_0013908
851 Ga0530510_0061565
852 2511246631
853 2513231388
854 2548496939
855 2599626630
856 2599675694
857 2599684167
858 2599696181
859 2644062942
860 2644070625
861 2644163242
862 2644327907
863 2644397868
864 2644468294
865 2644645557
866 2738718047
867 2738885051
868 2739245403
869 2739278733
870 2739612779
871 2816474766
872 2819595741
873 2831266752
874 2838057169
875 2842679649
876 2883294209
877 2883357262
878 2885201201
879 2885214855
880 2899925087
881 2904455752
882 2904457817
883 2904544778
884 2919467260
885 2928038788
886 2928045607
887 2928053224
888 2928066829
889 2928071286
890 2928084785
891 2929163551
892 2929522735
893 2939633016
894 2945912240
895 2945947719
896 2945977423
897 2945985447
898 2954772036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

73

298

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.9726 31 346
4z9n-assembly3.cif.gz_C abc transporter / periplasmic binding protein from brucella ovis with glutathione bound 0.9577 31 346
7a99-assembly1.cif.gz_A crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp 0.9103 32 128
6gpc-assembly1.cif.gz_A crystal structure of the arginine-bound form of domain 1 from tmargbp 0.8996 33 128
6q3u-assembly1.cif.gz_A gly52ala mutant of arginine-bound argbp from t. maritima 0.8987 32 249
ID Description Score Start End Superfamily
2v25B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9365 31 125 3.40.190.10
2yjpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9289 29 130 3.40.190.10
5eyfA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9227 32 126 3.40.190.10
2v25B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9197 128 233 3.40.190.10
2v25B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9027 128 233 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537MQQ0-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9947 30 108 GO:0006865
AF-A0A4Q8QMC4-F1-model_v4 Amino acid ABC transporter substrate-bindnig protein 0.9918 34 346 GO:0006865
AF-F2IXB3-F1-model_v4 Amino acid ABC transporter, periplasmic amino acid-binding protein 0.9896 48 346 GO:0006865
AF-A0A7S7Q2N8-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9892 31 346 GO:0006865
AF-H0TS08-F1-model_v4 General L-amino acid-binding periplasmic protein 0.9873 31 346 GO:0006865

Map