F446510

General Info

Members Datasets Scaffolds Average Seq Length
449 351 229 117

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2958071322|2958078079
Length 140
Sequence EAKSHDAKLPAGLDAPVFAEPWQAEAFAMTVALHDKGLFSWSEWADALSAEVKKPGAASDGHDYYEHWLAALENLLSAKGVAGKGDVDALAAAWERAAHATPHGKPILLENDPSPTEGRGRPTEGLGSPPFCSLYVPPSA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
6 2512875024 Mesorhizobium loti R88b Isolate Nodule
7 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
8 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
9 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
10 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
11 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
12 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
13 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
14 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
15 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
16 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
17 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
18 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
19 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
20 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
21 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
22 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
23 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
24 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
25 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
26 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
27 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
28 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
29 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
30 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
31 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
32 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
33 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
34 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
35 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
36 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
37 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
38 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
39 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
40 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
41 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
42 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
43 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
44 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
45 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
46 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
47 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
48 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
49 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
50 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
51 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
52 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
53 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
54 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
55 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
56 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
57 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
58 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
59 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
60 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
61 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
62 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
63 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
64 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
65 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
66 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
67 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
68 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
69 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
70 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
71 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
72 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
73 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
74 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
75 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
76 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
77 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
78 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
79 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
80 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
81 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
82 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
83 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
84 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
85 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
86 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
87 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
88 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
89 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
90 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
91 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
92 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
93 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
94 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
95 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
96 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
97 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
98 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
99 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
100 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
101 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
102 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
103 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
104 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
105 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
106 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
107 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
108 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
109 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
110 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
111 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
112 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
113 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
114 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
115 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
116 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
117 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
118 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
119 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
120 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
121 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
122 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
123 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
124 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
125 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
126 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
127 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
128 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
129 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
130 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
131 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
132 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
133 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
134 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
135 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
136 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
137 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
138 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
139 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
140 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
141 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
142 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
143 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
144 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
145 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
146 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
147 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
148 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
149 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
150 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
151 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
152 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
153 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
154 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
155 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
156 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
157 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
158 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
159 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
160 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
161 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
162 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
163 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
164 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
165 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
166 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
167 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
168 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
169 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
170 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
171 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
172 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
173 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
174 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
175 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
176 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
177 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
178 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
179 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
180 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
181 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
182 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
183 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
184 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
185 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
186 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
187 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
188 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
189 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
190 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
191 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
192 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
193 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
194 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
195 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
196 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
197 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
198 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
199 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
200 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
201 3004167301 Mesorhizobium loti 582 Isolate Unclassified
202 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
203 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
204 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
205 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
206 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
207 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
208 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
209 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
210 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
211 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
212 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
213 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
214 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
215 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
216 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
217 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
218 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
219 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
220 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
221 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
222 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
223 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
224 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
225 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
226 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
227 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
228 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
229 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
230 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
231 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
232 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
233 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
234 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
235 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
236 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
237 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
238 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
239 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
240 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
241 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
242 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
243 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
244 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
245 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
246 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
247 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
248 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
249 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
250 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
251 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
252 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
253 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
255 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
256 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
258 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
278 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
279 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
280 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
281 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
287 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
288 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
294 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
336 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
339 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
340 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
341 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
342 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
343 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
344 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
345 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
346 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
347 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
348 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
349 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
350 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
351 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.78
Metatranscriptomes 0.22
Isolates 49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.81
Nodule 42.54
Rhizoplane 2.45
Rhizosphere 32.07
Stem 0
Stem Tuber 0
Unclassified 9.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10074606 3300001989 Bacteria 1050
2 Ga0006562J51391_1097299 3300003578 Bacteria 668
3 Ga0055542_1000519 3300003762 Bacteria 34751
4 Ga0055529_1002792 3300003763 Bacteria 3165
5 Ga0070676_10644859 3300005328 Bacteria 768
6 Ga0070682_100599423 3300005337 Bacteria 870
7 Ga0070660_100244702 3300005339 Bacteria 1461
8 Ga0070661_100608912 3300005344 Bacteria 884
9 Ga0070669_101400328 3300005353 Bacteria 607
10 Ga0070678_100390022 3300005456 Bacteria 1207
11 Ga0068867_100334477 3300005459 Bacteria 1259
12 Ga0068867_100962632 3300005459 Bacteria 772
13 Ga0070685_10906694 3300005466 Bacteria 656
14 Ga0068853_100013344 3300005539 Bacteria 6708
15 Ga0068853_100435464 3300005539 Bacteria 1231
16 Ga0068853_102325826 3300005539 Bacteria 519
17 Ga0070665_100143222 3300005548 Bacteria 2393
18 Ga0070665_100153061 3300005548 Bacteria 2308
19 Ga0068854_100361515 3300005578 Bacteria 1191
20 Ga0068854_101460694 3300005578 Bacteria 620
21 Ga0068856_100782731 3300005614 Bacteria 974
22 Ga0068852_100110797 3300005616 Bacteria 2495
23 Ga0081455_10074784 3300005937 Bacteria 2797
24 Ga0075365_10005895 3300006038 Bacteria 6670
25 Ga0075365_10194002 3300006038 Bacteria 1422
26 Ga0075365_10460852 3300006038 Bacteria 898
27 Ga0075365_10480634 3300006038 Bacteria 878
28 Ga0075365_10746032 3300006038 Bacteria 691
29 Ga0075368_10089499 3300006042 Bacteria 1258
30 Ga0075363_100250767 3300006048 Bacteria 1019
31 Ga0075364_10020174 3300006051 Bacteria 4190
32 Ga0075364_10453853 3300006051 Bacteria 876
33 Ga0075364_10555673 3300006051 Bacteria 785
34 Ga0075362_10208122 3300006177 Bacteria 953
35 Ga0075362_10545204 3300006177 Bacteria 596
36 Ga0075367_10056215 3300006178 Bacteria 2337
37 Ga0075367_10134082 3300006178 Bacteria 1532
38 Ga0075369_10123994 3300006186 Bacteria 1171
39 Ga0075370_10133816 3300006353 Bacteria 1447
40 Ga0075370_10985104 3300006353 Bacteria 516
41 Ga0105240_10118413 3300009093 Bacteria 3191
42 Ga0105240_10163409 3300009093 Bacteria 2642
43 Ga0105240_10322618 3300009093 Bacteria 1760
44 Ga0105247_11240651 3300009101 Bacteria 596
45 Ga0105247_11781149 3300009101 Bacteria 512
46 Ga0105243_12326652 3300009148 Bacteria 574
47 Ga0105241_10422490 3300009174 Bacteria 1173
48 Ga0105248_10258531 3300009177 Bacteria 1960
49 Ga0105237_10099343 3300009545 Bacteria 2902
50 Ga0105237_10333301 3300009545 Bacteria 1522
51 Ga0105238_10005101 3300009551 Bacteria 12985
52 Ga0105238_11744838 3300009551 Bacteria 654
53 Ga0105239_10103577 3300010375 Bacteria 3150
54 Ga0105239_10178087 3300010375 Bacteria 2378
55 Ga0105239_10260831 3300010375 Bacteria 1947
56 Ga0105239_10515858 3300010375 Bacteria 1360
57 Ga0105239_10531121 3300010375 Bacteria 1339
58 Ga0105239_11607665 3300010375 Bacteria 752
59 Ga0105239_11865525 3300010375 Bacteria 697
60 Ga0157370_10863659 3300013104 Bacteria 822
61 Ga0157369_10068419 3300013105 Bacteria 3815
62 Ga0157374_10240318 3300013296 Bacteria 1781
63 Ga0163162_13255424 3300013306 Bacteria 521
64 Ga0157375_12426756 3300013308 Bacteria 626
65 Ga0157376_10320896 3300014969 Bacteria 1473
66 Ga0182007_10029893 3300015262 Bacteria 1864
67 Ga0209646_1005762 3300025246 Bacteria 2132
68 Ga0209026_1000025 3300025250 Bacteria 352548
69 Ga0209148_1000128 3300025254 Bacteria 179154
70 Ga0209759_1000057 3300025256 Bacteria 205181
71 Ga0209233_1000010 3300025261 Bacteria 1194329
72 Ga0209455_1000492 3300025272 Bacteria 28972
73 Ga0209758_1014517 3300025297 Bacteria 4180
74 Ga0207645_10395968 3300025907 Bacteria 928
75 Ga0207705_10277605 3300025909 Bacteria 1282
76 Ga0207705_10482291 3300025909 Bacteria 962
77 Ga0207654_10019351 3300025911 Bacteria 3593
78 Ga0207695_10189111 3300025913 Bacteria 1977
79 Ga0207695_10210210 3300025913 Bacteria 1857
80 Ga0207671_10089988 3300025914 Bacteria 2311
81 Ga0207671_10729658 3300025914 Bacteria 787
82 Ga0207657_10144412 3300025919 Bacteria 1942
83 Ga0207694_10036177 3300025924 Bacteria 3788
84 Ga0207694_11297370 3300025924 Bacteria 616
85 Ga0207690_11634892 3300025932 Bacteria 538
86 Ga0207706_10841987 3300025933 Bacteria 777
87 Ga0207669_11414051 3300025937 Bacteria 592
88 Ga0207712_10253749 3300025961 Bacteria 1423
89 Ga0207640_11119137 3300025981 Bacteria 697
90 Ga0207639_10028714 3300026041 Bacteria 4064
91 Ga0207639_10353140 3300026041 Bacteria 1314
92 Ga0207678_10204193 3300026067 Bacteria 1690
93 Ga0207702_10579568 3300026078 Bacteria 1100
94 Ga0207648_10375475 3300026089 Bacteria 1285
95 Ga0207674_10408340 3300026116 Bacteria 1312
96 Ga0207698_10632572 3300026142 Bacteria 1058
97 Ga0268266_10355031 3300028379 Bacteria 1378
98 Ga0268266_10402592 3300028379 Bacteria 1294
99 Ga0307513_10484101 3300031456 Bacteria 957
100 Ga0307408_100907698 3300031548 Bacteria 807
101 Ga0307415_102584525 3300032126 Bacteria 501
102 Ga0307510_10579059 3300033180 Bacteria 572
103 Ga0395899_0580218 3300037312 Bacteria 717
104 Ga0395900_0062465 3300037418 Bacteria 3829
105 Ga0395900_0370833 3300037418 Bacteria 1401
106 Ga0395900_1151844 3300037418 Bacteria 692
107 Ga0395898_0094818 3300037466 Bacteria 2868
108 Ga0395905_0059384 3300037471 Bacteria 3575
109 Ga0395905_0119287 3300037471 Bacteria 2479
110 Ga0395905_0306771 3300037471 Bacteria 1475
111 Ga0395905_1433348 3300037471 Bacteria 595
112 Ga0395901_0011547 3300038443 Bacteria 8951
113 Ga0395901_0233287 3300038443 Bacteria 1921
114 Ga0395901_0662946 3300038443 Bacteria 1045
115 Ga0395901_0750126 3300038443 Bacteria 969
116 Ga0395901_0814212 3300038443 Bacteria 922
117 Ga0439465_0084830 3300041413 Bacteria 1078
118 Ga0439465_0174953 3300041413 Bacteria 775
119 Ga0439465_0420422 3300041413 Bacteria 510
120 Ga0451851_0279833 3300041507 Bacteria 628
121 Ga0439448_0299957 3300042005 Bacteria 570
122 Ga0495638_0019236 3300046460 Bacteria 4520
123 Ga0495638_0054297 3300046460 Bacteria 2491
124 Ga0495620_0277527 3300046515 Bacteria 638
125 Ga0495668_0091786 3300046616 Bacteria 1664
126 Ga0495668_0132050 3300046616 Bacteria 1367
127 Ga0495625_0008181 3300046660 Bacteria 8956
128 Ga0495661_0601892 3300046665 Bacteria 517
129 Ga0495686_0288981 3300047472 Bacteria 909
130 Ga0495686_0525213 3300047472 Bacteria 621
131 Ga0496102_0125391 3300048905 Bacteria 2400
132 Ga0496103_0104081 3300048906 Bacteria 1799
133 Ga0496105_0502314 3300048908 Bacteria 952
134 Ga0496106_0782605 3300048909 Bacteria 757
135 Ga0496111_0628918 3300048914 Bacteria 784
136 Ga0496112_0003167 3300048915 Bacteria 13516
137 Ga0496112_0138485 3300048915 Bacteria 2404
138 Ga0496114_0805252 3300048917 Bacteria 818
139 Ga0496115_0780683 3300048918 Bacteria 745
140 Ga0496119_0088958 3300048922 Bacteria 1759
141 Ga0496119_0154352 3300048922 Bacteria 1227
142 Ga0496119_0449961 3300048922 Bacteria 607
143 Ga0496120_0000621 3300048923 Bacteria 53511
144 Ga0496120_0260578 3300048923 Bacteria 810
145 Ga0496121_0121523 3300048924 Bacteria 1972
146 Ga0496124_0277109 3300048927 Bacteria 1225
147 Ga0496125_0311963 3300048928 Bacteria 958
148 Ga0496125_0352437 3300048928 Bacteria 879
149 Ga0496126_0037723 3300048929 Bacteria 4506
150 Ga0496126_0360115 3300048929 Bacteria 1188
151 Ga0496126_0645469 3300048929 Bacteria 829
152 Ga0501032_0115065 3300049569 Bacteria 1778
153 Ga0501032_0300555 3300049569 Bacteria 1037
154 Ga0501032_0308091 3300049569 Bacteria 1023
155 Ga0501033_0041206 3300049570 Bacteria 3446
156 Ga0501033_0070923 3300049570 Bacteria 2559
157 Ga0501033_0646216 3300049570 Bacteria 723
158 Ga0501034_0071468 3300049571 Bacteria 3480
159 Ga0501034_0179921 3300049571 Bacteria 2079
160 Ga0501034_0205202 3300049571 Bacteria 1927
161 Ga0501034_0207431 3300049571 Bacteria 1915
162 Ga0501036_0281546 3300049572 Bacteria 1391
163 Ga0501036_0390249 3300049572 Bacteria 1161
164 Ga0501036_1461803 3300049572 Bacteria 553
165 Ga0501038_0223693 3300049574 Bacteria 1500
166 Ga0501039_0073592 3300049575 Bacteria 2654
167 Ga0501039_0312404 3300049575 Bacteria 1236
168 Ga0501042_0041867 3300049578 Bacteria 3258
169 Ga0501043_1097180 3300049579 Bacteria 562
170 Ga0501046_0102227 3300049580 Bacteria 2197
171 Ga0501047_0199552 3300049581 Bacteria 1861
172 Ga0501048_0200795 3300049582 Bacteria 1413
173 Ga0501067_0024943 3300049583 Bacteria 3316
174 Ga0501067_0238640 3300049583 Bacteria 1012
175 Ga0501068_0183839 3300049584 Bacteria 1322
176 Ga0501068_0946150 3300049584 Bacteria 567
177 Ga0501072_0361245 3300049588 Bacteria 1153
178 Ga0501072_1601815 3300049588 Bacteria 502
179 Ga0501080_0139699 3300049742 Bacteria 2240
180 Ga0501083_0408178 3300049744 Bacteria 884
181 Ga0501035_0024962 3300049822 Bacteria 5480
182 Ga0501035_0105765 3300049822 Bacteria 2467
183 Ga0501035_0218665 3300049822 Bacteria 1627
184 Ga0501035_0418267 3300049822 Bacteria 1113
185 Ga0501035_0671848 3300049822 Bacteria 838
186 Ga0501044_0144701 3300049823 Bacteria 2363
187 Ga0501044_0200940 3300049823 Bacteria 1951
188 Ga0501044_0200944 3300049823 Bacteria 1951
189 Ga0501044_0489968 3300049823 Bacteria 1131
190 Ga0501045_0348945 3300049824 Bacteria 1101
191 nmdc:mga03683_209393_c1 3300050489 Bacteria 897
192 nmdc:mga03683_288454_c1 3300050489 Bacteria 768
193 nmdc:mga03683_616214_c1 3300050489 Bacteria 532
194 nmdc:mga03n38_172765_c1 3300050490 Bacteria 1102
195 nmdc:mga03n38_270583_c1 3300050490 Bacteria 904
196 nmdc:mga00v17_142453_c1 3300050491 Bacteria 1537
197 nmdc:mga00v17_264194_c1 3300050491 Bacteria 1116
198 nmdc:mga00v17_511833_c1 3300050491 Bacteria 778
199 nmdc:mga0yw44_1007920_c1 3300050492 Bacteria 564
200 nmdc:mga0yw44_118337_c1 3300050492 Bacteria 1704
201 nmdc:mga0yw44_185598_c1 3300050492 Bacteria 1370
202 nmdc:mga0yw44_32298_c1 3300050492 Bacteria 1636
203 nmdc:mga0yw44_500471_c1 3300050492 Bacteria 824
204 nmdc:mga0yw44_68695_c2 3300050492 Bacteria 1779
205 nmdc:mga0yw44_795096_c1 3300050492 Bacteria 642
206 nmdc:mga0yw44_87874_c1 3300050492 Bacteria 1960
207 nmdc:mga06z11_138846_c1 3300050494 Bacteria 1372
208 nmdc:mga06z11_603275_c1 3300050494 Bacteria 668
209 nmdc:mga06z11_91483_c1 3300050494 Bacteria 1652
210 nmdc:mga07m45_115451_c1 3300050496 Bacteria 1548
211 nmdc:mga07m45_471513_c1 3300050496 Bacteria 728
212 nmdc:mga07m45_595340_c1 3300050496 Bacteria 639
213 nmdc:mga07m45_677708_c1 3300050496 Bacteria 594
214 nmdc:mga0sz30_103669_c1 3300050516 Bacteria 1243
215 nmdc:mga0sz30_171994_c1 3300050516 Bacteria 960
216 nmdc:mga0sz30_5099_c1 3300050516 Bacteria 4804
217 Ga0500595_031733 3300053119 Bacteria 1770
218 Ga0500658_0097564 3300053134 Bacteria 1279
219 Ga0500658_0350484 3300053134 Bacteria 678
220 Ga0500568_0000017 3300053139 Bacteria 197578
221 Ga0500604_0012727 3300053151 Bacteria 2274
222 Ga0500604_0142131 3300053151 Bacteria 812
223 Ga0500604_0267719 3300053151 Bacteria 592
224 Ga0500620_188465 3300053155 Bacteria 708
225 Ga0500627_0075671 3300053158 Bacteria 1496
226 Ga0500627_0132328 3300053158 Bacteria 1126
227 Ga0500627_0149607 3300053158 Bacteria 1054
228 Ga0500627_0330191 3300053158 Bacteria 661
229 Ga0500611_000879 3300053727 Bacteria 3131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0312404 Ga0501039_0312404_15_353 103
2 iso_pu_bacteria 2889790730 2889794512 104
3 iso_pu_bacteria 2889914905 2889920419 104
4 3300010375 Ga0105239_11607665 Ga0105239_116076651 105
5 iso_pu_bacteria 2643221550 2643773014 105
6 iso_pu_bacteria 2996310559 2996313955 106
7 3300046460 Ga0495638_0019236 Ga0495638_0019236_3201_3554 107
8 3300048908 Ga0496105_0502314 Ga0496105_0502314_141_494 107
9 3300048914 Ga0496111_0628918 Ga0496111_0628918_35_388 107
10 3300048917 Ga0496114_0805252 Ga0496114_0805252_204_557 107
11 3300049583 Ga0501067_0024943 Ga0501067_0024943_82_426 107
12 3300050489 nmdc:mga03683_616214_c1 nmdc:mga03683_616214_c1_49_405 107
13 3300050490 nmdc:mga03n38_172765_c1 nmdc:mga03n38_172765_c1_341_697 107
14 3300046460 Ga0495638_0054297 Ga0495638_0054297_636_1022 108
15 iso_pu_bacteria 2508501127 2509144838 108
16 iso_pu_bacteria 2643221564 2643840105 108
17 iso_pu_bacteria 2767802442 2770195367 108
18 iso_pu_bacteria 2775506902 2776270691 108
19 iso_pu_bacteria 2775506904 2776280486 108
20 iso_pu_bacteria 2839993093 2839996958 108
21 iso_pu_bacteria 2840764183 2840767488 108
22 iso_pu_bacteria 2894652903 2894656064 108
23 iso_pu_bacteria 3000135777 3000140524 108
24 3300025907 Ga0207645_10395968 Ga0207645_103959681 109
25 3300049571 Ga0501034_0207431 Ga0501034_0207431_210_554 109
26 3300049572 Ga0501036_1461803 Ga0501036_1461803_91_444 109
27 3300049588 Ga0501072_1601815 Ga0501072_1601815_34_393 109
28 3300049822 Ga0501035_0671848 Ga0501035_0671848_205_564 109
29 iso_pu_bacteria 2856349417 2856354884 109
30 iso_pu_bacteria 2856356410 2856360459 109
31 iso_pu_bacteria 2871488783 2871494414 109
32 iso_pu_bacteria 2878753008 2878759004 109
33 iso_pu_bacteria 2881155292 2881155437 109
34 iso_pu_bacteria 2881845957 2881846467 109
35 iso_pu_bacteria 2881853255 2881854865 109
36 iso_pu_bacteria 2881861095 2881866830 109
37 iso_pu_bacteria 2882912400 2882919546 109
38 iso_pu_bacteria 2885318864 2885320342 109
39 iso_pu_bacteria 2885342637 2885344581 109
40 iso_pu_bacteria 2885350715 2885352292 109
41 iso_pu_bacteria 2903492973 2903503756 109
42 iso_pu_bacteria 2924784321 2924789209 109
43 iso_pu_bacteria 2961127735 2961133671 109
44 iso_pu_bacteria 2961170736 2961175917 109
45 iso_pu_bacteria 2967996073 2968001805 109
46 iso_pu_bacteria 2968003550 2968009171 109
47 iso_pu_bacteria 2970503327 2970508582 109
48 iso_pu_bacteria 2977821940 2977827544 109
49 iso_pu_bacteria 2979808191 2979811769 109
50 iso_pu_bacteria 3004167301 3004169045 109
51 iso_pu_bacteria 8004374579 8004380525 109
52 iso_pu_bacteria 8004395343 8004397074 109
53 3300049570 Ga0501033_0646216 Ga0501033_0646216_83_427 110
54 3300049823 Ga0501044_0489968 Ga0501044_0489968_134_478 110
55 3300053158 Ga0500627_0075671 Ga0500627_0075671_116_460 110
56 iso_pu_bacteria 2503198000 2503201674 110
57 iso_pu_bacteria 2508501123 2509118843 110
58 iso_pu_bacteria 2509276022 2509396440 110
59 iso_pu_bacteria 2512875016 2512931355 110
60 iso_pu_bacteria 2513237090 2513613259 110
61 iso_pu_bacteria 2513237164 2514033778 110
62 iso_pu_bacteria 2513237305 2514421620 110
63 iso_pu_bacteria 2588253730 2588517185 110
64 iso_pu_bacteria 2597489875 2597813614 110
65 iso_pu_bacteria 2599185301 2599936629 110
66 iso_pu_bacteria 2687453392 2688598585 110
67 iso_pu_bacteria 2756170246 2756675332 110
68 iso_pu_bacteria 2791355123 2792749377 110
69 iso_pu_bacteria 2841734538 2841739324 110
70 iso_pu_bacteria 2844009547 2844013839 110
71 iso_pu_bacteria 2847670302 2847675724 110
72 iso_pu_bacteria 2847686936 2847692370 110
73 iso_pu_bacteria 2856314179 2856319610 110
74 iso_pu_bacteria 2856320880 2856325384 110
75 iso_pu_bacteria 2856334872 2856338271 110
76 iso_pu_bacteria 2856342000 2856347393 110
77 iso_pu_bacteria 2856364286 2856369585 110
78 iso_pu_bacteria 2857349434 2857351026 110
79 iso_pu_bacteria 2857367948 2857371482 110
80 iso_pu_bacteria 2869162929 2869167125 110
81 iso_pu_bacteria 2869169390 2869174343 110
82 iso_pu_bacteria 2869234852 2869236150 110
83 iso_pu_bacteria 2869256925 2869262686 110
84 iso_pu_bacteria 2869278585 2869285071 110
85 iso_pu_bacteria 2869285874 2869286061 110
86 iso_pu_bacteria 2871429161 2871434494 110
87 iso_pu_bacteria 2871435913 2871441751 110
88 iso_pu_bacteria 2871451962 2871455889 110
89 iso_pu_bacteria 2871466892 2871470502 110
90 iso_pu_bacteria 2871474448 2871479538 110
91 iso_pu_bacteria 2871481445 2871481940 110
92 iso_pu_bacteria 2871495908 2871501275 110
93 iso_pu_bacteria 2874102143 2874103390 110
94 iso_pu_bacteria 2874109183 2874109857 110
95 iso_pu_bacteria 2874116593 2874120386 110
96 iso_pu_bacteria 2874123672 2874130726 110
97 iso_pu_bacteria 2874139085 2874146011 110
98 iso_pu_bacteria 2874146452 2874149698 110
99 iso_pu_bacteria 2874155637 2874157958 110
100 iso_pu_bacteria 2874168670 2874174671 110
101 iso_pu_bacteria 2876363079 2876369416 110
102 iso_pu_bacteria 2876386047 2876389544 110
103 iso_pu_bacteria 2876392853 2876398567 110
104 iso_pu_bacteria 2876413966 2876416162 110
105 iso_pu_bacteria 2876420981 2876425320 110
106 iso_pu_bacteria 2878035449 2878040844 110
107 iso_pu_bacteria 2878730984 2878735066 110
108 iso_pu_bacteria 2878738818 2878745362 110
109 iso_pu_bacteria 2878745973 2878751627 110
110 iso_pu_bacteria 2878760144 2878765255 110
111 iso_pu_bacteria 2878767105 2878772962 110
112 iso_pu_bacteria 2878788777 2878791779 110
113 iso_pu_bacteria 2881161766 2881167661 110
114 iso_pu_bacteria 2882632389 2882636407 110
115 iso_pu_bacteria 2885305155 2885309553 110
116 iso_pu_bacteria 2885312484 2885317873 110
117 iso_pu_bacteria 2885326080 2885328889 110
118 iso_pu_bacteria 2885334103 2885341117 110
119 iso_pu_bacteria 2888337043 2888339560 110
120 iso_pu_bacteria 2888343758 2888346939 110
121 iso_pu_bacteria 2888350351 2888355892 110
122 iso_pu_bacteria 2889016732 2889017475 110
123 iso_pu_bacteria 2903448605 2903451466 110
124 iso_pu_bacteria 2903492973 2903504572 110
125 iso_pu_bacteria 2903513507 2903515480 110
126 iso_pu_bacteria 2903521522 2903522977 110
127 iso_pu_bacteria 2903528002 2903534563 110
128 iso_pu_bacteria 2903540706 2903546086 110
129 iso_pu_bacteria 2904659560 2904665122 110
130 iso_pu_bacteria 2906308376 2906314025 110
131 iso_pu_bacteria 2906321335 2906327191 110
132 iso_pu_bacteria 2906328253 2906329894 110
133 iso_pu_bacteria 2906354277 2906357989 110
134 iso_pu_bacteria 2906378014 2906385137 110
135 iso_pu_bacteria 2906401398 2906402169 110
136 iso_pu_bacteria 2906414383 2906420330 110
137 iso_pu_bacteria 2906427513 2906434830 110
138 iso_pu_bacteria 2922130491 2922138292 110
139 iso_pu_bacteria 2922158528 2922158791 110
140 iso_pu_bacteria 2922185730 2922193310 110
141 iso_pu_bacteria 2924710171 2924714008 110
142 iso_pu_bacteria 2924718760 2924723770 110
143 iso_pu_bacteria 2924726620 2924727821 110
144 iso_pu_bacteria 2924733363 2924733536 110
145 iso_pu_bacteria 2924741084 2924741531 110
146 iso_pu_bacteria 2924754689 2924760617 110
147 iso_pu_bacteria 2924762789 2924764927 110
148 iso_pu_bacteria 2924776078 2924783606 110
149 iso_pu_bacteria 2937813078 2937815865 110
150 iso_pu_bacteria 2937836603 2937838101 110
151 iso_pu_bacteria 2937861824 2937863372 110
152 iso_pu_bacteria 2937877337 2937881986 110
153 iso_pu_bacteria 2937972304 2937978449 110
154 iso_pu_bacteria 2937980651 2937982710 110
155 iso_pu_bacteria 2937994558 2937999944 110
156 iso_pu_bacteria 2958034702 2958040773 110
157 iso_pu_bacteria 2958041894 2958056855 110
158 iso_pu_bacteria 2958064165 2958064170 110
159 iso_pu_bacteria 2958071322 2958078079 110
160 iso_pu_bacteria 2958084443 2958089108 110
161 iso_pu_bacteria 2958092219 2958094462 110
162 iso_pu_bacteria 2958100919 2958102492 110
163 iso_pu_bacteria 2958108152 2958114021 110
164 iso_pu_bacteria 2958122699 2958126765 110
165 iso_pu_bacteria 2958130278 2958130460 110
166 iso_pu_bacteria 2958144490 2958147732 110
167 iso_pu_bacteria 2958165035 2958170408 110
168 iso_pu_bacteria 2958172287 2958178596 110
169 iso_pu_bacteria 2958179912 2958184665 110
170 iso_pu_bacteria 2961077736 2961082832 110
171 iso_pu_bacteria 2961114664 2961120123 110
172 iso_pu_bacteria 2961163497 2961168863 110
173 iso_pu_bacteria 2961183825 2961188892 110
174 iso_pu_bacteria 2963644680 2963647860 110
175 iso_pu_bacteria 2965018300 2965024150 110
176 iso_pu_bacteria 2965032056 2965036679 110
177 iso_pu_bacteria 2968016561 2968018306 110
178 iso_pu_bacteria 2968083720 2968085985 110
179 iso_pu_bacteria 2968110612 2968116480 110
180 iso_pu_bacteria 2968117919 2968120753 110
181 iso_pu_bacteria 2968138860 2968141816 110
182 iso_pu_bacteria 2968171901 2968177257 110
183 iso_pu_bacteria 2970469710 2970471520 110
184 iso_pu_bacteria 2970510686 2970513727 110
185 iso_pu_bacteria 2970524798 2970528738 110
186 iso_pu_bacteria 2970532167 2970533541 110
187 iso_pu_bacteria 2970540015 2970545537 110
188 iso_pu_bacteria 2970554993 2970560103 110
189 iso_pu_bacteria 2970593180 2970599685 110
190 iso_pu_bacteria 2970619444 2970623442 110
191 iso_pu_bacteria 2970627176 2970627919 110
192 iso_pu_bacteria 2977843712 2977846100 110
193 iso_pu_bacteria 2977851361 2977851426 110
194 iso_pu_bacteria 2977864932 2977866966 110
195 iso_pu_bacteria 2977872689 2977876826 110
196 iso_pu_bacteria 2977898635 2977904742 110
197 iso_pu_bacteria 2977907340 2977911943 110
198 iso_pu_bacteria 2977942078 2977945473 110
199 iso_pu_bacteria 2977957713 2977958379 110
200 iso_pu_bacteria 2977971508 2977978900 110
201 iso_pu_bacteria 2977986579 2977991540 110
202 iso_pu_bacteria 2979710463 2979711368 110
203 iso_pu_bacteria 2979742915 2979747632 110
204 iso_pu_bacteria 2979764755 2979769780 110
205 iso_pu_bacteria 2979772303 2979775511 110
206 iso_pu_bacteria 2987636660 2987638211 110
207 iso_pu_bacteria 2987652177 2987655067 110
208 iso_pu_bacteria 2987659509 2987664894 110
209 iso_pu_bacteria 2987666974 2987669109 110
210 iso_pu_bacteria 2996348954 2996350306 110
211 iso_pu_bacteria 2996386984 2996388167 110
212 iso_pu_bacteria 3004188549 3004193951 110
213 iso_pu_bacteria 3004203850 3004205545 110
214 iso_pu_bacteria 3004232784 3004235997 110
215 iso_pu_bacteria 3004239961 3004241985 110
216 iso_pu_bacteria 3004248173 3004249136 110
217 iso_pu_bacteria 3004275668 3004277004 110
218 iso_pu_bacteria 3004289098 3004290107 110
219 iso_pu_bacteria 3004334049 3004334197 110
220 iso_pu_bacteria 8004312739 8004313249 110
221 iso_pu_bacteria 8004387939 8004393515 110
222 iso_pu_bacteria 8004633249 8004638294 110
223 iso_pu_bacteria 8004714634 8004720283 110
224 iso_pu_bacteria 8004727605 8004730313 110
225 iso_pu_bacteria 8055617313 8055620907 110
226 3300005937 Ga0081455_10074784 Ga0081455_100747843 111
227 iso_pu_bacteria 2937843397 2937847941 111
228 3300003578 Ga0006562J51391_1097299 Ga0006562J51391_10972992 112
229 3300005337 Ga0070682_100599423 Ga0070682_1005994232 112
230 3300005456 Ga0070678_100390022 Ga0070678_1003900221 112
231 3300005466 Ga0070685_10906694 Ga0070685_109066941 112
232 3300009093 Ga0105240_10163409 Ga0105240_101634093 112
233 3300009101 Ga0105247_11240651 Ga0105247_112406512 112
234 3300013308 Ga0157375_12426756 Ga0157375_124267562 112
235 3300025913 Ga0207695_10210210 Ga0207695_102102101 112
236 3300031548 Ga0307408_100907698 Ga0307408_1009076982 112
237 3300032126 Ga0307415_102584525 Ga0307415_1025845251 112
238 3300041413 Ga0439465_0084830 Ga0439465_0084830_222_584 112
239 3300041413 Ga0439465_0174953 Ga0439465_0174953_132_470 112
240 3300046515 Ga0495620_0277527 Ga0495620_0277527_126_470 112
241 3300046616 Ga0495668_0091786 Ga0495668_0091786_856_1206 112
242 3300046616 Ga0495668_0132050 Ga0495668_0132050_378_749 112
243 3300047472 Ga0495686_0288981 Ga0495686_0288981_477_821 112
244 3300049569 Ga0501032_0115065 Ga0501032_0115065_737_1111 112
245 3300049569 Ga0501032_0300555 Ga0501032_0300555_618_992 112
246 3300049570 Ga0501033_0070923 Ga0501033_0070923_1347_1721 112
247 3300049571 Ga0501034_0179921 Ga0501034_0179921_179_553 112
248 3300049571 Ga0501034_0205202 Ga0501034_0205202_739_1113 112
249 3300049572 Ga0501036_0281546 Ga0501036_0281546_853_1227 112
250 3300049572 Ga0501036_0390249 Ga0501036_0390249_673_1047 112
251 3300049574 Ga0501038_0223693 Ga0501038_0223693_115_489 112
252 3300049575 Ga0501039_0073592 Ga0501039_0073592_165_539 112
253 3300049578 Ga0501042_0041867 Ga0501042_0041867_156_530 112
254 3300049579 Ga0501043_1097180 Ga0501043_1097180_165_539 112
255 3300049580 Ga0501046_0102227 Ga0501046_0102227_583_957 112
256 3300049581 Ga0501047_0199552 Ga0501047_0199552_749_1123 112
257 3300049582 Ga0501048_0200795 Ga0501048_0200795_28_402 112
258 3300049584 Ga0501068_0183839 Ga0501068_0183839_186_560 112
259 3300049584 Ga0501068_0946150 Ga0501068_0946150_18_392 112
260 3300049588 Ga0501072_0361245 Ga0501072_0361245_164_538 112
261 3300049742 Ga0501080_0139699 Ga0501080_0139699_1741_2115 112
262 3300049744 Ga0501083_0408178 Ga0501083_0408178_402_776 112
263 3300049822 Ga0501035_0024962 Ga0501035_0024962_3760_4134 112
264 3300049822 Ga0501035_0105765 Ga0501035_0105765_837_1211 112
265 3300049823 Ga0501044_0144701 Ga0501044_0144701_643_1017 112
266 3300049823 Ga0501044_0200940 Ga0501044_0200940_739_1113 112
267 3300049823 Ga0501044_0200944 Ga0501044_0200944_739_1113 112
268 3300049824 Ga0501045_0348945 Ga0501045_0348945_11_385 112
269 3300050492 nmdc:mga0yw44_118337_c1 nmdc:mga0yw44_118337_c1_569_931 112
270 3300053134 Ga0500658_0097564 Ga0500658_0097564_551_889 112
271 3300053727 Ga0500611_000879 Ga0500611_000879_2004_2342 112
272 iso_pu_bacteria 2512875024 2512959184 112
273 iso_pu_bacteria 2513237351 2514589151 112
274 iso_pu_bacteria 2965119406 2965120552 112
275 3300006038 Ga0075365_10480634 Ga0075365_104806342 113
276 3300031456 Ga0307513_10484101 Ga0307513_104841012 113
277 3300042005 Ga0439448_0299957 Ga0439448_0299957_99_446 113
278 3300050489 nmdc:mga03683_209393_c1 nmdc:mga03683_209393_c1_93_440 113
279 3300050491 nmdc:mga00v17_264194_c1 nmdc:mga00v17_264194_c1_93_440 113
280 3300050492 nmdc:mga0yw44_185598_c1 nmdc:mga0yw44_185598_c1_958_1305 113
281 3300050492 nmdc:mga0yw44_68695_c2 nmdc:mga0yw44_68695_c2_1087_1473 113
282 3300050492 nmdc:mga0yw44_795096_c1 nmdc:mga0yw44_795096_c1_110_496 113
283 3300050492 nmdc:mga0yw44_87874_c1 nmdc:mga0yw44_87874_c1_806_1153 113
284 3300050494 nmdc:mga06z11_138846_c1 nmdc:mga06z11_138846_c1_50_415 113
285 3300050516 nmdc:mga0sz30_5099_c1 nmdc:mga0sz30_5099_c1_3729_4076 113
286 3300053151 Ga0500604_0142131 Ga0500604_0142131_97_483 113
287 3300053158 Ga0500627_0132328 Ga0500627_0132328_155_541 113
288 3300053158 Ga0500627_0330191 Ga0500627_0330191_94_447 113
289 3300001989 JGI24739J22299_10074606 JGI24739J22299_100746062 114
290 3300003762 Ga0055542_1000519 Ga0055542_100051929 114
291 3300003763 Ga0055529_1002792 Ga0055529_10027922 114
292 3300005328 Ga0070676_10644859 Ga0070676_106448592 114
293 3300005339 Ga0070660_100244702 Ga0070660_1002447023 114
294 3300005344 Ga0070661_100608912 Ga0070661_1006089121 114
295 3300005353 Ga0070669_101400328 Ga0070669_1014003281 114
296 3300005459 Ga0068867_100334477 Ga0068867_1003344772 114
297 3300005459 Ga0068867_100962632 Ga0068867_1009626322 114
298 3300005539 Ga0068853_100013344 Ga0068853_1000133444 114
299 3300005539 Ga0068853_100435464 Ga0068853_1004354642 114
300 3300005539 Ga0068853_102325826 Ga0068853_1023258262 114
301 3300005548 Ga0070665_100143222 Ga0070665_1001432222 114
302 3300005548 Ga0070665_100153061 Ga0070665_1001530613 114
303 3300005578 Ga0068854_100361515 Ga0068854_1003615152 114
304 3300005578 Ga0068854_101460694 Ga0068854_1014606942 114
305 3300005614 Ga0068856_100782731 Ga0068856_1007827312 114
306 3300005616 Ga0068852_100110797 Ga0068852_1001107974 114
307 3300006038 Ga0075365_10005895 Ga0075365_100058955 114
308 3300006038 Ga0075365_10194002 Ga0075365_101940022 114
309 3300006038 Ga0075365_10460852 Ga0075365_104608522 114
310 3300006038 Ga0075365_10746032 Ga0075365_107460322 114
311 3300006042 Ga0075368_10089499 Ga0075368_100894992 114
312 3300006048 Ga0075363_100250767 Ga0075363_1002507672 114
313 3300006051 Ga0075364_10020174 Ga0075364_100201742 114
314 3300006051 Ga0075364_10453853 Ga0075364_104538532 114
315 3300006051 Ga0075364_10555673 Ga0075364_105556732 114
316 3300006177 Ga0075362_10208122 Ga0075362_102081221 114
317 3300006177 Ga0075362_10545204 Ga0075362_105452041 114
318 3300006178 Ga0075367_10056215 Ga0075367_100562154 114
319 3300006178 Ga0075367_10134082 Ga0075367_101340822 114
320 3300006186 Ga0075369_10123994 Ga0075369_101239942 114
321 3300006353 Ga0075370_10133816 Ga0075370_101338162 114
322 3300006353 Ga0075370_10985104 Ga0075370_109851042 114
323 3300009093 Ga0105240_10118413 Ga0105240_101184133 114
324 3300009093 Ga0105240_10322618 Ga0105240_103226182 114
325 3300009101 Ga0105247_11781149 Ga0105247_117811492 114
326 3300009148 Ga0105243_12326652 Ga0105243_123266522 114
327 3300009174 Ga0105241_10422490 Ga0105241_104224902 114
328 3300009177 Ga0105248_10258531 Ga0105248_102585313 114
329 3300009545 Ga0105237_10099343 Ga0105237_100993432 114
330 3300009545 Ga0105237_10333301 Ga0105237_103333012 114
331 3300009551 Ga0105238_10005101 Ga0105238_100051015 114
332 3300009551 Ga0105238_11744838 Ga0105238_117448381 114
333 3300010375 Ga0105239_10103577 Ga0105239_101035773 114
334 3300010375 Ga0105239_10178087 Ga0105239_101780872 114
335 3300010375 Ga0105239_10260831 Ga0105239_102608314 114
336 3300010375 Ga0105239_10515858 Ga0105239_105158581 114
337 3300010375 Ga0105239_10531121 Ga0105239_105311212 114
338 3300010375 Ga0105239_11865525 Ga0105239_118655252 114
339 3300013104 Ga0157370_10863659 Ga0157370_108636591 114
340 3300013105 Ga0157369_10068419 Ga0157369_100684193 114
341 3300013296 Ga0157374_10240318 Ga0157374_102403183 114
342 3300013306 Ga0163162_13255424 Ga0163162_132554241 114
343 3300014969 Ga0157376_10320896 Ga0157376_103208961 114
344 3300015262 Ga0182007_10029893 Ga0182007_100298933 114
345 3300025246 Ga0209646_1005762 Ga0209646_10057623 114
346 3300025250 Ga0209026_1000025 Ga0209026_1000025270 114
347 3300025254 Ga0209148_1000128 Ga0209148_1000128138 114
348 3300025256 Ga0209759_1000057 Ga0209759_100005739 114
349 3300025261 Ga0209233_1000010 Ga0209233_1000010146 114
350 3300025272 Ga0209455_1000492 Ga0209455_100049223 114
351 3300025297 Ga0209758_1014517 Ga0209758_10145174 114
352 3300025909 Ga0207705_10277605 Ga0207705_102776052 114
353 3300025909 Ga0207705_10482291 Ga0207705_104822912 114
354 3300025911 Ga0207654_10019351 Ga0207654_100193515 114
355 3300025913 Ga0207695_10189111 Ga0207695_101891112 114
356 3300025914 Ga0207671_10089988 Ga0207671_100899882 114
357 3300025914 Ga0207671_10729658 Ga0207671_107296582 114
358 3300025919 Ga0207657_10144412 Ga0207657_101444122 114
359 3300025924 Ga0207694_10036177 Ga0207694_100361773 114
360 3300025924 Ga0207694_11297370 Ga0207694_112973701 114
361 3300025932 Ga0207690_11634892 Ga0207690_116348921 114
362 3300025933 Ga0207706_10841987 Ga0207706_108419871 114
363 3300025937 Ga0207669_11414051 Ga0207669_114140512 114
364 3300025961 Ga0207712_10253749 Ga0207712_102537491 114
365 3300025981 Ga0207640_11119137 Ga0207640_111191371 114
366 3300026041 Ga0207639_10028714 Ga0207639_100287143 114
367 3300026041 Ga0207639_10353140 Ga0207639_103531403 114
368 3300026067 Ga0207678_10204193 Ga0207678_102041932 114
369 3300026078 Ga0207702_10579568 Ga0207702_105795682 114
370 3300026089 Ga0207648_10375475 Ga0207648_103754752 114
371 3300026116 Ga0207674_10408340 Ga0207674_104083402 114
372 3300026142 Ga0207698_10632572 Ga0207698_106325722 114
373 3300028379 Ga0268266_10355031 Ga0268266_103550313 114
374 3300028379 Ga0268266_10402592 Ga0268266_104025922 114
375 3300033180 Ga0307510_10579059 Ga0307510_105790592 114
376 3300037312 Ga0395899_0580218 Ga0395899_0580218_123_467 114
377 3300037418 Ga0395900_0062465 Ga0395900_0062465_2113_2457 114
378 3300037418 Ga0395900_0370833 Ga0395900_0370833_772_1122 114
379 3300037418 Ga0395900_1151844 Ga0395900_1151844_298_663 114
380 3300037466 Ga0395898_0094818 Ga0395898_0094818_1159_1509 114
381 3300037471 Ga0395905_0059384 Ga0395905_0059384_2134_2484 114
382 3300037471 Ga0395905_0119287 Ga0395905_0119287_1161_1511 114
383 3300037471 Ga0395905_0306771 Ga0395905_0306771_290_634 114
384 3300037471 Ga0395905_1433348 Ga0395905_1433348_119_469 114
385 3300038443 Ga0395901_0011547 Ga0395901_0011547_3363_3707 114
386 3300038443 Ga0395901_0233287 Ga0395901_0233287_1042_1392 114
387 3300038443 Ga0395901_0662946 Ga0395901_0662946_221_571 114
388 3300038443 Ga0395901_0750126 Ga0395901_0750126_572_922 114
389 3300038443 Ga0395901_0814212 Ga0395901_0814212_294_638 114
390 3300041413 Ga0439465_0420422 Ga0439465_0420422_11_364 114
391 3300041507 Ga0451851_0279833 Ga0451851_0279833_63_413 114
392 3300046660 Ga0495625_0008181 Ga0495625_0008181_7790_8140 114
393 3300046665 Ga0495661_0601892 Ga0495661_0601892_116_484 114
394 3300047472 Ga0495686_0525213 Ga0495686_0525213_82_456 114
395 3300048905 Ga0496102_0125391 Ga0496102_0125391_1734_2081 114
396 3300048906 Ga0496103_0104081 Ga0496103_0104081_1004_1348 114
397 3300048909 Ga0496106_0782605 Ga0496106_0782605_21_368 114
398 3300048915 Ga0496112_0003167 Ga0496112_0003167_6934_7293 114
399 3300048915 Ga0496112_0138485 Ga0496112_0138485_13_357 114
400 3300048918 Ga0496115_0780683 Ga0496115_0780683_270_635 114
401 3300048922 Ga0496119_0088958 Ga0496119_0088958_1077_1436 114
402 3300048922 Ga0496119_0154352 Ga0496119_0154352_577_927 114
403 3300048922 Ga0496119_0449961 Ga0496119_0449961_232_576 114
404 3300048923 Ga0496120_0000621 Ga0496120_0000621_7827_8177 114
405 3300048923 Ga0496120_0260578 Ga0496120_0260578_204_569 114
406 3300048924 Ga0496121_0121523 Ga0496121_0121523_630_977 114
407 3300048927 Ga0496124_0277109 Ga0496124_0277109_187_552 114
408 3300048928 Ga0496125_0311963 Ga0496125_0311963_20_367 114
409 3300048928 Ga0496125_0352437 Ga0496125_0352437_230_595 114
410 3300048929 Ga0496126_0037723 Ga0496126_0037723_1766_2113 114
411 3300048929 Ga0496126_0360115 Ga0496126_0360115_121_486 114
412 3300048929 Ga0496126_0645469 Ga0496126_0645469_37_396 114
413 3300049569 Ga0501032_0308091 Ga0501032_0308091_281_661 114
414 3300049570 Ga0501033_0041206 Ga0501033_0041206_2645_3025 114
415 3300049571 Ga0501034_0071468 Ga0501034_0071468_1788_2168 114
416 3300049583 Ga0501067_0238640 Ga0501067_0238640_31_381 114
417 3300049822 Ga0501035_0218665 Ga0501035_0218665_1131_1511 114
418 3300049822 Ga0501035_0418267 Ga0501035_0418267_663_1037 114
419 3300050489 nmdc:mga03683_288454_c1 nmdc:mga03683_288454_c1_134_502 114
420 3300050490 nmdc:mga03n38_270583_c1 nmdc:mga03n38_270583_c1_266_634 114
421 3300050491 nmdc:mga00v17_142453_c1 nmdc:mga00v17_142453_c1_620_970 114
422 3300050491 nmdc:mga00v17_511833_c1 nmdc:mga00v17_511833_c1_382_741 114
423 3300050492 nmdc:mga0yw44_1007920_c1 nmdc:mga0yw44_1007920_c1_26_385 114
424 3300050492 nmdc:mga0yw44_32298_c1 nmdc:mga0yw44_32298_c1_938_1324 114
425 3300050492 nmdc:mga0yw44_500471_c1 nmdc:mga0yw44_500471_c1_455_805 114
426 3300050494 nmdc:mga06z11_603275_c1 nmdc:mga06z11_603275_c1_235_603 114
427 3300050494 nmdc:mga06z11_91483_c1 nmdc:mga06z11_91483_c1_813_1172 114
428 3300050496 nmdc:mga07m45_115451_c1 nmdc:mga07m45_115451_c1_162_521 114
429 3300050496 nmdc:mga07m45_471513_c1 nmdc:mga07m45_471513_c1_193_561 114
430 3300050496 nmdc:mga07m45_595340_c1 nmdc:mga07m45_595340_c1_93_461 114
431 3300050496 nmdc:mga07m45_677708_c1 nmdc:mga07m45_677708_c1_35_403 114
432 3300050516 nmdc:mga0sz30_103669_c1 nmdc:mga0sz30_103669_c1_540_899 114
433 3300050516 nmdc:mga0sz30_171994_c1 nmdc:mga0sz30_171994_c1_19_369 114
434 3300053119 Ga0500595_031733 Ga0500595_031733_1338_1715 114
435 3300053134 Ga0500658_0350484 Ga0500658_0350484_42_410 114
436 3300053139 Ga0500568_0000017 Ga0500568_0000017_66954_67319 114
437 3300053151 Ga0500604_0012727 Ga0500604_0012727_1096_1455 114
438 3300053151 Ga0500604_0267719 Ga0500604_0267719_101_451 114
439 3300053155 Ga0500620_188465 Ga0500620_188465_336_680 114
440 3300053158 Ga0500627_0149607 Ga0500627_0149607_76_426 114
441 iso_pu_bacteria 2937891427 2937893760 114
442 iso_pu_bacteria 2958115193 2958118572 114
443 iso_pu_bacteria 2968091066 2968093259 114
444 iso_pu_bacteria 2968097103 2968102835 114
445 iso_pu_bacteria 2977858184 2977861872 114
446 iso_pu_bacteria 2979779861 2979782734 114
447 iso_pu_bacteria 2996341866 2996346431 114
448 iso_pu_bacteria 8004445564 8004451398 114
449 iso_pu_bacteria 8004703790 8004709474 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

4

114

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a8g-assembly1.cif.gz_B crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetonitrile 0.652 3 91
3a8m-assembly1.cif.gz_B crystal structure of nitrile hydratase mutant y72f complexed with trimethylacetonitrile 0.6518 3 91
3wvd-assembly1.cif.gz_B crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 50 min 0.6507 3 91
1ahj-assembly1.cif.gz_B nitrile hydratase 0.6207 3 91
4fm4-assembly7.cif.gz_N wild type fe-type nitrile hydratase from comamonas testosteroni ni1 0.592 2 114
ID Description Score Start End Superfamily
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.6821 2 89 1.10.472.20
1jdeA05 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.6471 21 79 1.20.80.30
3hhtB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.6073 5 112 1.10.472.20
af_Q4CSP6_205_383_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.5934 40 93 3.90.230.10
1ireB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5776 6 109 1.10.472.20
ID Description Score Start End GO Terms
AF-A0A527ZK94-F1-model_v4 Nitrile hydratase accessory protein 0.8995 8 75
AF-A0A527ZK94-F1-model_v4 Nitrile hydratase accessory protein 0.8748 8 75
AF-A0A528UF99-F1-model_v4 Nitrile hydratase accessory protein 0.8701 29 94
AF-A0A5C1WHD2-F1-model_v4 Nitrile hydratase accessory protein 0.8544 4 81
AF-A0A528UF99-F1-model_v4 Nitrile hydratase accessory protein 0.8462 29 94

Feature Viewer

pLDDT pTM Quality
76.65 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map