F446513

General Info

Members Datasets Scaffolds Average Seq Length
450 265 446 327

Family's Representative Sequence

Representative Sequence 3300001976|JGI24752J21851_1002148|JGI24752J21851_10021483
Length 333
Sequence VPYLLRRLGFFLLTLWAALTLNFIIPRFMPGSPLQALRDRTHNKLSPAALEQMLTSYGFKPDENVVVQYLDYLKNMVTGQWGISIGATLGEPVTRIVRQALPWTLGLVGVTTVLAFLLGSLIGVVSGWRRGSRLDSLLPPAFVVTSALPYFWVGLLLILVFSVWTGGLLPSDFNYDSGLQPAFTPAFVFSVFSHALLPAATILITSIGGWILTMRNNMITTLAEDYVRMGRAKGLSDRRIMTAYAARNAMLPNLSGFAMSLGFVIAGSILVEYVFNYPGLGYLLYNSVQNTDYPLMQALFMLFTVAVLVAVLVCDIAIAILDPRSRERDRSGR

Samples

Sample ID Description Type Environment
1 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
2 2862574272 Streptomyces sp. AcE210 Isolate Nodule
3 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
261 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
262 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
263 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 0.67
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0.22
Rhizoplane 7.11
Rhizosphere 87.33
Stem 0
Stem Tuber 0
Unclassified 3.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002148 3300001976 Bacteria 2633
2 JGI24751J29686_10001163 3300002459 Bacteria 5628
3 rootH1_10255697 3300003323 Bacteria 1795
4 Ga0055540_1001492 3300003792 Bacteria 13904
5 Ga0070658_10037938 3300005327 Bacteria 3885
6 Ga0070658_10042503 3300005327 Bacteria 3671
7 Ga0070658_10069026 3300005327 Bacteria 2891
8 Ga0070676_10024556 3300005328 Bacteria 3397
9 Ga0070683_100035866 3300005329 Bacteria 4536
10 Ga0068869_100072710 3300005334 Bacteria 2548
11 Ga0070680_100003841 3300005336 Bacteria 11228
12 Ga0070680_100033274 3300005336 Bacteria 4154
13 Ga0070682_100002208 3300005337 Bacteria 10787
14 Ga0070682_100052420 3300005337 Bacteria 2553
15 Ga0068868_100009852 3300005338 Bacteria 6899
16 Ga0068868_100046273 3300005338 Bacteria 3406
17 Ga0070660_100006399 3300005339 Bacteria 8164
18 Ga0070660_100009712 3300005339 Bacteria 6780
19 Ga0070660_100421598 3300005339 Bacteria 1105
20 Ga0070689_100015704 3300005340 Bacteria 5528
21 Ga0070691_10002949 3300005341 Bacteria 7627
22 Ga0070687_100089046 3300005343 Bacteria 1703
23 Ga0070661_100011885 3300005344 Bacteria 6075
24 Ga0070661_100022644 3300005344 Bacteria 4499
25 Ga0070692_10001488 3300005345 Bacteria 8550
26 Ga0070692_10028784 3300005345 Bacteria 2764
27 Ga0070692_10096115 3300005345 Bacteria 1618
28 Ga0070668_100024302 3300005347 Bacteria 4589
29 Ga0070668_100071498 3300005347 Bacteria 2703
30 Ga0070668_100074191 3300005347 Bacteria 2654
31 Ga0070675_100013299 3300005354 Bacteria 6467
32 Ga0070673_100008420 3300005364 Bacteria 6858
33 Ga0070659_100005968 3300005366 Bacteria 8782
34 Ga0070667_100208533 3300005367 Bacteria 1736
35 Ga0070709_10006045 3300005434 Bacteria 6583
36 Ga0070709_10037222 3300005434 Bacteria 2970
37 Ga0070714_100003195 3300005435 Bacteria 12185
38 Ga0070714_100007099 3300005435 Bacteria 8686
39 Ga0070714_100031755 3300005435 Bacteria 4409
40 Ga0070714_100376286 3300005435 Bacteria 1338
41 Ga0070713_100002909 3300005436 Bacteria 11210
42 Ga0070713_100004044 3300005436 Bacteria 9769
43 Ga0070713_100065266 3300005436 Bacteria 3057
44 Ga0070710_10007061 3300005437 Bacteria 5422
45 Ga0070705_100011838 3300005440 Bacteria 4416
46 Ga0070694_100008734 3300005444 Bacteria 6205
47 Ga0070663_100023836 3300005455 Bacteria 4108
48 Ga0070663_100116043 3300005455 Bacteria 2017
49 Ga0070678_100005181 3300005456 Bacteria 7497
50 Ga0070662_100123973 3300005457 Bacteria 1983
51 Ga0070681_10023672 3300005458 Bacteria 6180
52 Ga0070706_100000802 3300005467 Bacteria 34929
53 Ga0070706_100066693 3300005467 Bacteria 3329
54 Ga0070707_100000261 3300005468 Bacteria 52696
55 Ga0070698_100000396 3300005471 Bacteria 45923
56 Ga0070699_100438905 3300005518 Bacteria 1183
57 Ga0070679_100010266 3300005530 Bacteria 8877
58 Ga0070679_100016122 3300005530 Bacteria 7199
59 Ga0070679_100091820 3300005530 Bacteria 3024
60 Ga0070697_100120654 3300005536 Bacteria 2193
61 Ga0068853_100078072 3300005539 Bacteria 2893
62 Ga0068853_100238271 3300005539 Bacteria 1667
63 Ga0070693_100002658 3300005547 Bacteria 8229
64 Ga0070665_100040764 3300005548 Bacteria 4667
65 Ga0070665_100099194 3300005548 Bacteria 2917
66 Ga0070665_100167585 3300005548 Bacteria 2198
67 Ga0070704_100016928 3300005549 Bacteria 4622
68 Ga0068855_100012152 3300005563 Bacteria 10404
69 Ga0068855_100026980 3300005563 Bacteria 6873
70 Ga0068855_100159724 3300005563 Bacteria 2559
71 Ga0070664_100147907 3300005564 Bacteria 2072
72 Ga0068857_100107661 3300005577 Bacteria 2504
73 Ga0068857_100204340 3300005577 Bacteria 1801
74 Ga0068854_100014109 3300005578 Bacteria 5259
75 Ga0068856_100012844 3300005614 Bacteria 8104
76 Ga0068856_100012979 3300005614 Bacteria 8067
77 Ga0068856_100013286 3300005614 Bacteria 7975
78 Ga0068852_100036384 3300005616 Bacteria 4118
79 Ga0068859_100036772 3300005617 Bacteria 4915
80 Ga0068859_100052159 3300005617 Bacteria 4112
81 Ga0068864_100043428 3300005618 Bacteria 3849
82 Ga0068870_10000206 3300005840 Bacteria 21149
83 Ga0068863_100040827 3300005841 Bacteria 4411
84 Ga0068863_100053500 3300005841 Bacteria 3827
85 Ga0068858_100025174 3300005842 Bacteria 5537
86 Ga0068858_100104473 3300005842 Bacteria 2643
87 Ga0068860_100021390 3300005843 Bacteria 6263
88 Ga0068862_100091562 3300005844 Bacteria 2649
89 Ga0081455_10072274 3300005937 Bacteria 2856
90 Ga0081540_1000144 3300005983 Bacteria 74266
91 Ga0081540_1011090 3300005983 Bacteria 6050
92 Ga0081540_1015946 3300005983 Bacteria 4733
93 Ga0070717_10018485 3300006028 Bacteria 5442
94 Ga0075432_10004466 3300006058 Bacteria 4772
95 Ga0070712_100091464 3300006175 Bacteria 2229
96 Ga0097621_100007330 3300006237 Bacteria 7883
97 Ga0068871_100008339 3300006358 Bacteria 7450
98 Ga0075431_100306477 3300006847 Bacteria 1604
99 Ga0075433_10005121 3300006852 Bacteria 10283
100 Ga0075433_10006126 3300006852 Bacteria 9472
101 Ga0075433_10023998 3300006852 Bacteria 5141
102 Ga0075434_100005408 3300006871 Bacteria 11620
103 Ga0068865_100032145 3300006881 Bacteria 3504
104 Ga0075436_100000490 3300006914 Bacteria 25561
105 Ga0075436_100018469 3300006914 Bacteria 4774
106 Ga0097620_100036773 3300006931 Bacteria 4915
107 Ga0097620_100052159 3300006931 Bacteria 4112
108 Ga0075435_100000491 3300007076 Bacteria 24044
109 Ga0075435_100007021 3300007076 Bacteria 7992
110 Ga0105251_10052775 3300009011 Bacteria 1935
111 Ga0105240_10018132 3300009093 Bacteria 9463
112 Ga0105240_10087504 3300009093 Bacteria 3815
113 Ga0105240_10091504 3300009093 Bacteria 3716
114 Ga0111539_10006134 3300009094 Bacteria 15519
115 Ga0105245_10003362 3300009098 Bacteria 14342
116 Ga0105245_10010100 3300009098 Bacteria 8224
117 Ga0105247_10015340 3300009101 Bacteria 4590
118 Ga0105247_10044035 3300009101 Bacteria 2736
119 Ga0105243_10008646 3300009148 Bacteria 7810
120 Ga0105241_10006616 3300009174 Bacteria 8539
121 Ga0105241_10100872 3300009174 Bacteria 2294
122 Ga0105242_10014477 3300009176 Bacteria 6111
123 Ga0105248_10017820 3300009177 Bacteria 7837
124 Ga0105248_10024030 3300009177 Bacteria 6774
125 Ga0105248_10026953 3300009177 Bacteria 6391
126 Ga0105248_10119344 3300009177 Bacteria 2975
127 Ga0105237_10026178 3300009545 Bacteria 5962
128 Ga0105237_10037830 3300009545 Bacteria 4875
129 Ga0105238_10031540 3300009551 Bacteria 5396
130 Ga0105238_10035704 3300009551 Bacteria 5052
131 Ga0105249_10008439 3300009553 Bacteria 8974
132 Ga0105249_10255165 3300009553 Bacteria 1740
133 Ga0105239_10006708 3300010375 Bacteria 13298
134 Ga0105239_10040701 3300010375 Bacteria 5092
135 Ga0105246_10001215 3300011119 Bacteria 15095
136 Ga0105246_10012092 3300011119 Bacteria 5378
137 Ga0157370_10006967 3300013104 Bacteria 12345
138 Ga0157370_10014083 3300013104 Bacteria 8204
139 Ga0157370_10050187 3300013104 Bacteria 3989
140 Ga0157370_10116625 3300013104 Bacteria 2494
141 Ga0157369_10010186 3300013105 Bacteria 10726
142 Ga0157369_10018390 3300013105 Bacteria 7836
143 Ga0157369_10018418 3300013105 Bacteria 7830
144 Ga0157369_10021816 3300013105 Bacteria 7161
145 Ga0157374_10009748 3300013296 Bacteria 8246
146 Ga0157374_10025934 3300013296 Bacteria 5269
147 Ga0157374_10104891 3300013296 Bacteria 2714
148 Ga0157378_10056487 3300013297 Bacteria 3498
149 Ga0163162_10004860 3300013306 Bacteria 12967
150 Ga0157372_10000043 3300013307 Bacteria 153958
151 Ga0157372_10010920 3300013307 Bacteria 9665
152 Ga0157372_10011766 3300013307 Bacteria 9319
153 Ga0157372_10160972 3300013307 Bacteria 2594
154 Ga0157372_10161785 3300013307 Bacteria 2587
155 Ga0157372_10373130 3300013307 Bacteria 1662
156 Ga0157372_10839131 3300013307 Bacteria 1067
157 Ga0157375_10052610 3300013308 Bacteria 4004
158 Ga0163163_10069610 3300014325 Unclassified 3503
159 Ga0163163_10238657 3300014325 Bacteria 1867
160 Ga0157377_10005230 3300014745 Bacteria 6076
161 Ga0157377_10054214 3300014745 Bacteria 2269
162 Ga0157379_10049331 3300014968 Bacteria 3758
163 Ga0206356_11870205 3300020070 Bacteria 2489
164 Ga0206354_10109562 3300020081 Bacteria 3494
165 Ga0206353_10123281 3300020082 Bacteria 5671
166 Ga0209051_1003334 3300025303 Bacteria 10614
167 Ga0207656_10006016 3300025321 Bacteria 4338
168 Ga0207692_10005862 3300025898 Bacteria 4952
169 Ga0207692_10017179 3300025898 Bacteria 3222
170 Ga0207710_10007632 3300025900 Bacteria 4576
171 Ga0207710_10018666 3300025900 Bacteria 2952
172 Ga0207688_10002927 3300025901 Bacteria 9280
173 Ga0207699_10001943 3300025906 Bacteria 9746
174 Ga0207699_10007023 3300025906 Bacteria 5485
175 Ga0207645_10020923 3300025907 Bacteria 4274
176 Ga0207643_10000816 3300025908 Bacteria 18940
177 Ga0207705_10012126 3300025909 Bacteria 6230
178 Ga0207705_10044155 3300025909 Bacteria 3203
179 Ga0207684_10001022 3300025910 Bacteria 31388
180 Ga0207684_10026265 3300025910 Bacteria 4965
181 Ga0207654_10005779 3300025911 Bacteria 6246
182 Ga0207707_10022368 3300025912 Bacteria 5527
183 Ga0207707_10113307 3300025912 Bacteria 2370
184 Ga0207695_10033487 3300025913 Bacteria 5602
185 Ga0207695_10184222 3300025913 Bacteria 2008
186 Ga0207671_10021465 3300025914 Bacteria 4900
187 Ga0207693_10129899 3300025915 Bacteria 1980
188 Ga0207660_10009296 3300025917 Bacteria 6364
189 Ga0207660_10056960 3300025917 Bacteria 2798
190 Ga0207657_10008273 3300025919 Bacteria 10588
191 Ga0207657_10112624 3300025919 Bacteria 2245
192 Ga0207657_10242929 3300025919 Bacteria 1437
193 Ga0207652_10014129 3300025921 Bacteria 6464
194 Ga0207652_10029837 3300025921 Bacteria 4564
195 Ga0207652_10037427 3300025921 Bacteria 4107
196 Ga0207646_10000277 3300025922 Bacteria 70138
197 Ga0207646_10026984 3300025922 Bacteria 5236
198 Ga0207681_10064469 3300025923 Bacteria 2530
199 Ga0207694_10011791 3300025924 Bacteria 6594
200 Ga0207694_10012684 3300025924 Bacteria 6349
201 Ga0207650_10009680 3300025925 Bacteria 6588
202 Ga0207659_10002300 3300025926 Bacteria 11379
203 Ga0207687_10007969 3300025927 Bacteria 6935
204 Ga0207700_10005422 3300025928 Bacteria 7630
205 Ga0207700_10005953 3300025928 Bacteria 7338
206 Ga0207700_10070833 3300025928 Bacteria 2682
207 Ga0207664_10004421 3300025929 Bacteria 9516
208 Ga0207664_10011839 3300025929 Bacteria 6221
209 Ga0207664_10134668 3300025929 Bacteria 2084
210 Ga0207644_10023479 3300025931 Bacteria 4224
211 Ga0207690_10013229 3300025932 Bacteria 4954
212 Ga0207690_10312252 3300025932 Bacteria 1233
213 Ga0207706_10073719 3300025933 Bacteria 3002
214 Ga0207686_10030431 3300025934 Bacteria 3196
215 Ga0207670_10011678 3300025936 Bacteria 5110
216 Ga0207704_10242009 3300025938 Bacteria 1349
217 Ga0207691_10260903 3300025940 Bacteria 1494
218 Ga0207711_10019355 3300025941 Bacteria 5668
219 Ga0207711_10038327 3300025941 Bacteria 4075
220 Ga0207711_10080052 3300025941 Bacteria 2853
221 Ga0207711_10241924 3300025941 Bacteria 1655
222 Ga0207689_10033484 3300025942 Bacteria 4270
223 Ga0207661_10013774 3300025944 Bacteria 5907
224 Ga0207661_10050437 3300025944 Bacteria 3316
225 Ga0207661_10114802 3300025944 Bacteria 2284
226 Ga0207679_10013112 3300025945 Bacteria 5427
227 Ga0207667_10033476 3300025949 Bacteria 5524
228 Ga0207667_10039699 3300025949 Bacteria 5015
229 Ga0207667_10107642 3300025949 Bacteria 2876
230 Ga0207667_10119586 3300025949 Bacteria 2715
231 Ga0207712_10004423 3300025961 Bacteria 8880
232 Ga0207668_10008893 3300025972 Bacteria 6007
233 Ga0207668_10231507 3300025972 Bacteria 1490
234 Ga0207677_10003273 3300026023 Bacteria 8556
235 Ga0207677_10063049 3300026023 Bacteria 2575
236 Ga0207703_10022551 3300026035 Bacteria 4940
237 Ga0207703_10212263 3300026035 Bacteria 1726
238 Ga0207639_10095503 3300026041 Bacteria 2389
239 Ga0207678_10003464 3300026067 Bacteria 14200
240 Ga0207702_10002143 3300026078 Bacteria 18963
241 Ga0207702_10009643 3300026078 Bacteria 8106
242 Ga0207702_10105569 3300026078 Bacteria 2495
243 Ga0207702_10121041 3300026078 Bacteria 2343
244 Ga0207641_10015123 3300026088 Bacteria 6323
245 Ga0207641_10131180 3300026088 Bacteria 2251
246 Ga0207676_10002108 3300026095 Bacteria 14407
247 Ga0207674_10046962 3300026116 Bacteria 4430
248 Ga0207674_10258805 3300026116 Bacteria 1687
249 Ga0207675_100039640 3300026118 Bacteria 4396
250 Ga0207675_100216779 3300026118 Bacteria 1843
251 Ga0207683_10000446 3300026121 Bacteria 38241
252 Ga0207683_10009232 3300026121 Bacteria 8403
253 Ga0207698_10039974 3300026142 Bacteria 3479
254 Ga0207698_10054927 3300026142 Bacteria 3066
255 Ga0207428_10002274 3300027907 Bacteria 19270
256 Ga0268266_10032252 3300028379 Bacteria 4452
257 Ga0268265_10098994 3300028380 Bacteria 2350
258 Ga0307517_10063281 3300028786 Bacteria 3462
259 Ga0307515_10040599 3300028794 Bacteria 7352
260 Ga0265338_10035284 3300028800 Bacteria 4812
261 Ga0265338_10110432 3300028800 Bacteria 2216
262 Ga0307512_10012187 3300030522 Bacteria 8128
263 Ga0307512_10012723 3300030522 Bacteria 7926
264 Ga0307512_10058316 3300030522 Bacteria 3009
265 Ga0265340_10050863 3300031247 Bacteria 2008
266 Ga0307513_10004058 3300031456 Bacteria 19623
267 Ga0307509_10014108 3300031507 Bacteria 9423
268 Ga0265313_10028112 3300031595 Bacteria 2929
269 Ga0307508_10003645 3300031616 Bacteria 15439
270 Ga0307508_10007971 3300031616 Bacteria 9823
271 Ga0307508_10247560 3300031616 Bacteria 1379
272 Ga0265342_10045570 3300031712 Bacteria 2639
273 Ga0307516_10006521 3300031730 Bacteria 13664
274 Ga0373959_0015339 3300034820 Bacteria 1406
275 Ga0373934_0000085 3300035086 Bacteria 32802
276 Ga0373940_0011781 3300035088 Bacteria 2084
277 Ga0373949_0014584 3300035090 Bacteria 1751
278 Ga0373923_0015959 3300035111 Bacteria 2843
279 Ga0373953_0014714 3300035117 Bacteria 2820
280 Ga0373956_0000101 3300035119 Bacteria 29430
281 Ga0373957_0000234 3300035120 Bacteria 13854
282 Ga0373960_0010713 3300035121 Bacteria 2245
283 Ga0373955_0000756 3300035172 Bacteria 13890
284 Ga0373942_0002084 3300035207 Bacteria 4970
285 Ga0373962_0003547 3300035242 Bacteria 3749
286 Ga0373931_0003486 3300035691 Bacteria 7075
287 Ga0373931_0104375 3300035691 Bacteria 1599
288 Ga0373935_0047414 3300035692 Bacteria 2717
289 Ga0373933_0000001 3300035724 Bacteria 228234
290 Ga0373937_0000033 3300036401 Bacteria 120102
291 Ga0373925_0002092 3300037068 Bacteria 16399
292 Ga0395899_0060226 3300037312 Bacteria 2797
293 Ga0395900_0004418 3300037418 Bacteria 14911
294 Ga0395900_0041472 3300037418 Bacteria 4745
295 Ga0395898_0070897 3300037466 Bacteria 3368
296 Ga0395898_0079252 3300037466 Bacteria 3169
297 Ga0436364_0147188 3300037853 Bacteria 17063
298 Ga0436364_1292946 3300037853 Bacteria 2045
299 Ga0395901_0012561 3300038443 Bacteria 8594
300 Ga0395901_0097377 3300038443 Bacteria 3084
301 Ga0395901_0208288 3300038443 Bacteria 2047
302 Ga0436365_1221295 3300039437 Bacteria 6969
303 Ga0466972_0063275 3300044658 Bacteria 1772
304 Ga0466965_0013835 3300044683 Bacteria 3811
305 Ga0466965_0166840 3300044683 Bacteria 1156
306 Ga0466966_0005133 3300044684 Bacteria 8603
307 Ga0466966_0009028 3300044684 Bacteria 6606
308 Ga0466966_0143212 3300044684 Bacteria 1460
309 Ga0466966_0170050 3300044684 Bacteria 1325
310 Ga0466961_0003109 3300044693 Bacteria 10334
311 Ga0466961_0040395 3300044693 Bacteria 2991
312 Ga0466961_0131422 3300044693 Bacteria 1569
313 Ga0466963_0021965 3300044694 Bacteria 4034
314 Ga0466963_0043138 3300044694 Bacteria 2964
315 Ga0466963_0046944 3300044694 Bacteria 2849
316 Ga0466963_0067627 3300044694 Bacteria 2398
317 Ga0466963_0070328 3300044694 Bacteria 2354
318 Ga0466963_0073161 3300044694 Bacteria 2310
319 Ga0466963_0092577 3300044694 Bacteria 2060
320 Ga0466963_0100125 3300044694 Unclassified 1983
321 Ga0466963_0162389 3300044694 Bacteria 1555
322 Ga0466963_0164682 3300044694 Bacteria 1544
323 Ga0466964_0008753 3300044706 Bacteria 3804
324 Ga0466971_0000661 3300044719 Bacteria 13719
325 Ga0466971_0023100 3300044719 Bacteria 2771
326 Ga0466971_0037737 3300044719 Bacteria 2166
327 Ga0466971_0067955 3300044719 Bacteria 1616
328 Ga0466957_0050149 3300044842 Bacteria 2539
329 Ga0466957_0063332 3300044842 Bacteria 2273
330 Ga0466957_0311628 3300044842 Bacteria 1060
331 Ga0466960_0068780 3300044901 Bacteria 1758
332 Ga0466960_0095784 3300044901 Bacteria 1520
333 Ga0466959_0001596 3300045049 Bacteria 13982
334 Ga0466959_0120161 3300045049 Bacteria 1869
335 Ga0466959_0200097 3300045049 Bacteria 1391
336 Ga0466958_0026875 3300045836 Bacteria 3402
337 Ga0466958_0042347 3300045836 Bacteria 2742
338 Ga0466958_0085327 3300045836 Bacteria 1948
339 Ga0466958_0103000 3300045836 Bacteria 1777
340 Ga0466958_0137146 3300045836 Unclassified 1539
341 Ga0466958_0173177 3300045836 Bacteria 1367
342 Ga0466967_0000744 3300045976 Bacteria 16732
343 Ga0466967_0000876 3300045976 Bacteria 16017
344 Ga0466967_0006476 3300045976 Bacteria 8294
345 Ga0466967_0012542 3300045976 Bacteria 6489
346 Ga0466967_0216118 3300045976 Bacteria 1820
347 Ga0466967_0301488 3300045976 Bacteria 1542
348 Ga0495592_0000002 3300046454 Bacteria 209491
349 Ga0495592_0014493 3300046454 Bacteria 5983
350 Ga0495603_0018253 3300046455 Bacteria 4243
351 Ga0495638_0049867 3300046460 Bacteria 2616
352 Ga0495651_0000002 3300046462 Bacteria 209492
353 Ga0495653_0002193 3300046463 Bacteria 15456
354 Ga0495653_0014002 3300046463 Bacteria 6540
355 Ga0495664_0031484 3300046477 Bacteria 3110
356 Ga0495585_0012766 3300046492 Bacteria 4942
357 Ga0495608_0000027 3300046511 Bacteria 152979
358 Ga0495618_0015074 3300046514 Bacteria 4715
359 Ga0495620_0023734 3300046515 Bacteria 2927
360 Ga0495628_0002351 3300046516 Bacteria 17082
361 Ga0495628_0225620 3300046516 Bacteria 1405
362 Ga0495652_0004197 3300046529 Bacteria 13870
363 Ga0495652_0008945 3300046529 Bacteria 9113
364 Ga0495587_0000588 3300046536 Bacteria 24923
365 Ga0495645_0053534 3300046543 Bacteria 2933
366 Ga0495667_0001897 3300046559 Bacteria 13870
367 Ga0495611_0016973 3300046648 Bacteria 3112
368 Ga0495635_0001507 3300046663 Bacteria 15611
369 Ga0495657_0001117 3300046675 Bacteria 23500
370 Ga0495599_0000006 3300046678 Bacteria 283487
371 Ga0495623_0001890 3300046679 Bacteria 14069
372 Ga0495623_0096111 3300046679 Bacteria 1811
373 Ga0495646_0004006 3300046680 Bacteria 9225
374 Ga0495646_0010666 3300046680 Bacteria 5837
375 Ga0495589_0013698 3300046794 Bacteria 4181
376 Ga0495589_0017900 3300046794 Bacteria 3634
377 Ga0495600_0000601 3300046809 Bacteria 18587
378 Ga0495600_0034124 3300046809 Bacteria 3303
379 Ga0495581_0070569 3300047315 Bacteria 2021
380 Ga0495604_0002777 3300047317 Bacteria 14044
381 Ga0495676_0201655 3300047321 Bacteria 1382
382 Ga0495680_0004160 3300047322 Bacteria 13908
383 Ga0495675_0001558 3300047444 Bacteria 13841
384 Ga0495686_0024203 3300047472 Bacteria 3993
385 Ga0495602_0004579 3300048088 Bacteria 14425
386 Ga0496100_0006848 3300048903 Bacteria 6244
387 Ga0496101_0044473 3300048904 Bacteria 3178
388 Ga0496102_0000319 3300048905 Bacteria 60314
389 Ga0496102_0015079 3300048905 Bacteria 6728
390 Ga0496103_0038447 3300048906 Bacteria 2936
391 Ga0496104_0007131 3300048907 Bacteria 9853
392 Ga0496104_0025215 3300048907 Bacteria 5480
393 Ga0496104_0282141 3300048907 Bacteria 1574
394 Ga0496105_0002982 3300048908 Bacteria 12442
395 Ga0496105_0039210 3300048908 Bacteria 3904
396 Ga0496107_0233427 3300048910 Bacteria 1369
397 Ga0496108_0004925 3300048911 Bacteria 10785
398 Ga0496108_0013116 3300048911 Bacteria 6756
399 Ga0496108_0298518 3300048911 Bacteria 1403
400 Ga0496108_0387163 3300048911 Bacteria 1221
401 Ga0496109_0010642 3300048912 Bacteria 7867
402 Ga0496109_0016368 3300048912 Bacteria 6482
403 Ga0496109_0092376 3300048912 Bacteria 2799
404 Ga0496109_0185160 3300048912 Bacteria 1957
405 Ga0496109_0190492 3300048912 Bacteria 1927
406 Ga0496110_0003418 3300048913 Bacteria 12144
407 Ga0496110_0025030 3300048913 Bacteria 5096
408 Ga0496110_0036368 3300048913 Bacteria 4275
409 Ga0496111_0000654 3300048914 Bacteria 18257
410 Ga0496111_0111465 3300048914 Bacteria 2015
411 Ga0496112_0020453 3300048915 Bacteria 6274
412 Ga0496112_0092069 3300048915 Bacteria 3001
413 Ga0496112_0250918 3300048915 Bacteria 1720
414 Ga0496113_0002535 3300048916 Bacteria 10647
415 Ga0496113_0004740 3300048916 Bacteria 8395
416 Ga0496113_0120811 3300048916 Bacteria 2048
417 Ga0496115_0061702 3300048918 Bacteria 3023
418 Ga0496119_0050878 3300048922 Bacteria 2550
419 Ga0501047_0012538 3300049581 Bacteria 8027
420 Ga0501069_0006545 3300049585 Bacteria 6093
421 Ga0501070_0003626 3300049586 Bacteria 13335
422 Ga0501073_0244926 3300049589 Bacteria 1238
423 Ga0501074_0044829 3300049590 Bacteria 3200
424 Ga0501080_0087630 3300049742 Bacteria 2892
425 nmdc:mga05p37_65865_c1 3300050507 Bacteria 4457
426 nmdc:mga06r32_218414_c1 3300050510 Bacteria 1894
427 nmdc:mga0n895_12207_c1 3300050512 Bacteria 7697
428 nmdc:mga0n895_21550_c1 3300050512 Bacteria 6030
429 nmdc:mga0n895_43097_c1 3300050512 Bacteria 4396
430 nmdc:mga0n895_60975_c1 3300050512 Bacteria 3723
431 nmdc:mga0rr50_1297_c1 3300050513 Bacteria 13631
432 nmdc:mga0rr50_5589_c1 3300050513 Bacteria 7520
433 nmdc:mga08x19_26276_c1 3300050514 Bacteria 3632
434 nmdc:mga0a205_15078_c1 3300050515 Bacteria 7217
435 nmdc:mga0a205_8696_c1 3300050515 Bacteria 9246
436 nmdc:mga0a205_9554_c1 3300050515 Bacteria 8875
437 Ga0495601_0127514 3300053077 Bacteria 1656
438 Ga0495601_0161900 3300053077 Bacteria 1462
439 Ga0495612_0003851 3300053078 Bacteria 6228
440 Ga0500644_0049332 3300053088 Bacteria 1436
441 Ga0500651_0037281 3300053093 Bacteria 3063
442 Ga0500594_0023030 3300053118 Bacteria 1575
443 Ga0500652_102479 3300053131 Bacteria 1196
444 Ga0500600_0033733 3300053149 Bacteria 2992
445 Ga0466962_0001104 3300061719 Bacteria 12420
446 Ga0466962_0010306 3300061719 Bacteria 4490

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0024203 Ga0495686_0024203_605_1582 268
2 3300003792 Ga0055540_1001492 Ga0055540_10014928 284
3 3300025303 Ga0209051_1003334 Ga0209051_10033347 284
4 3300046463 Ga0495653_0014002 Ga0495653_0014002_2360_3262 288
5 3300005539 Ga0068853_100078072 Ga0068853_1000780723 291
6 3300044684 Ga0466966_0143212 Ga0466966_0143212_26_916 296
7 3300048905 Ga0496102_0000319 Ga0496102_0000319_56482_57471 297
8 3300048906 Ga0496103_0038447 Ga0496103_0038447_499_1488 297
9 3300046543 Ga0495645_0053534 Ga0495645_0053534_21_923 300
10 3300053088 Ga0500644_0049332 Ga0500644_0049332_20_925 301
11 3300053131 Ga0500652_102479 Ga0500652_102479_270_1175 301
12 3300005345 Ga0070692_10096115 Ga0070692_100961151 302
13 3300048912 Ga0496109_0185160 Ga0496109_0185160_363_1355 303
14 3300005336 Ga0070680_100033274 Ga0070680_1000332743 304
15 3300005344 Ga0070661_100011885 Ga0070661_1000118853 304
16 3300013104 Ga0157370_10050187 Ga0157370_100501872 304
17 3300013105 Ga0157369_10021816 Ga0157369_100218164 304
18 3300025912 Ga0207707_10113307 Ga0207707_101133072 304
19 3300025917 Ga0207660_10056960 Ga0207660_100569602 304
20 3300025932 Ga0207690_10312252 Ga0207690_103122522 304
21 3300025944 Ga0207661_10013774 Ga0207661_100137742 304
22 3300026116 Ga0207674_10046962 Ga0207674_100469624 304
23 3300048915 Ga0496112_0092069 Ga0496112_0092069_1050_2042 304
24 3300013296 Ga0157374_10104891 Ga0157374_101048912 306
25 3300035207 Ga0373942_0002084 Ga0373942_0002084_3317_4312 307
26 3300005435 Ga0070714_100376286 Ga0070714_1003762862 309
27 3300013307 Ga0157372_10373130 Ga0157372_103731301 310
28 3300045976 Ga0466967_0012542 Ga0466967_0012542_2458_3435 310
29 3300005518 Ga0070699_100438905 Ga0070699_1004389051 313
30 3300039437 Ga0436365_1221295 Ga0436365_1221295_5516_6505 313
31 3300045976 Ga0466967_0216118 Ga0466967_0216118_506_1495 314
32 3300031616 Ga0307508_10247560 Ga0307508_102475601 315
33 3300048915 Ga0496112_0020453 Ga0496112_0020453_1541_2530 315
34 3300053149 Ga0500600_0033733 Ga0500600_0033733_874_1821 315
35 3300035086 Ga0373934_0000085 Ga0373934_0000085_12259_13242 316
36 3300035111 Ga0373923_0015959 Ga0373923_0015959_1736_2719 316
37 3300035117 Ga0373953_0014714 Ga0373953_0014714_1696_2679 316
38 3300035119 Ga0373956_0000101 Ga0373956_0000101_12824_13807 316
39 3300035120 Ga0373957_0000234 Ga0373957_0000234_153_1136 316
40 3300035172 Ga0373955_0000756 Ga0373955_0000756_145_1128 316
41 3300035724 Ga0373933_0000001 Ga0373933_0000001_12734_13717 316
42 3300036401 Ga0373937_0000033 Ga0373937_0000033_106357_107340 316
43 3300037853 Ga0436364_0147188 Ga0436364_0147188_6455_7441 316
44 3300044694 Ga0466963_0092577 Ga0466963_0092577_963_1946 316
45 3300046454 Ga0495592_0000002 Ga0495592_0000002_12763_13746 316
46 3300046462 Ga0495651_0000002 Ga0495651_0000002_195747_196730 316
47 3300046463 Ga0495653_0002193 Ga0495653_0002193_155_1138 316
48 3300046511 Ga0495608_0000027 Ga0495608_0000027_12763_13746 316
49 3300046516 Ga0495628_0002351 Ga0495628_0002351_142_1125 316
50 3300046529 Ga0495652_0004197 Ga0495652_0004197_12732_13715 316
51 3300046536 Ga0495587_0000588 Ga0495587_0000588_146_1129 316
52 3300046559 Ga0495667_0001897 Ga0495667_0001897_12763_13746 316
53 3300046675 Ga0495657_0001117 Ga0495657_0001117_178_1161 316
54 3300046678 Ga0495599_0000006 Ga0495599_0000006_13182_14165 316
55 3300046679 Ga0495623_0001890 Ga0495623_0001890_12908_13891 316
56 3300046680 Ga0495646_0004006 Ga0495646_0004006_8089_9072 316
57 3300046809 Ga0495600_0000601 Ga0495600_0000601_8404_9387 316
58 3300047317 Ga0495604_0002777 Ga0495604_0002777_12908_13891 316
59 3300047322 Ga0495680_0004160 Ga0495680_0004160_163_1146 316
60 3300047444 Ga0495675_0001558 Ga0495675_0001558_12710_13693 316
61 3300048088 Ga0495602_0004579 Ga0495602_0004579_13182_14165 316
62 3300053077 Ga0495601_0127514 Ga0495601_0127514_119_1102 316
63 3300003323 rootH1_10255697 rootH1_102556972 317
64 3300005435 Ga0070714_100003195 Ga0070714_1000031954 317
65 3300025929 Ga0207664_10004421 Ga0207664_100044214 317
66 3300005564 Ga0070664_100147907 Ga0070664_1001479072 318
67 3300047315 Ga0495581_0070569 Ga0495581_0070569_613_1569 318
68 3300049589 Ga0501073_0244926 Ga0501073_0244926_109_1065 318
69 3300044684 Ga0466966_0005133 Ga0466966_0005133_5679_6638 319
70 3300044693 Ga0466961_0003109 Ga0466961_0003109_5672_6631 319
71 3300044719 Ga0466971_0000661 Ga0466971_0000661_2771_3730 319
72 3300045049 Ga0466959_0001596 Ga0466959_0001596_6649_7608 319
73 3300046454 Ga0495592_0014493 Ga0495592_0014493_1182_2141 319
74 3300046477 Ga0495664_0031484 Ga0495664_0031484_1159_2118 319
75 3300046529 Ga0495652_0008945 Ga0495652_0008945_4332_5291 319
76 3300046663 Ga0495635_0001507 Ga0495635_0001507_5289_6248 319
77 3300046679 Ga0495623_0096111 Ga0495623_0096111_640_1599 319
78 3300046680 Ga0495646_0010666 Ga0495646_0010666_3216_4175 319
79 3300046809 Ga0495600_0034124 Ga0495600_0034124_796_1755 319
80 3300053077 Ga0495601_0161900 Ga0495601_0161900_15_974 319
81 3300053078 Ga0495612_0003851 Ga0495612_0003851_2091_3050 319
82 3300061719 Ga0466962_0001104 Ga0466962_0001104_854_1813 319
83 3300025940 Ga0207691_10260903 Ga0207691_102609031 321
84 3300005530 Ga0070679_100091820 Ga0070679_1000918203 322
85 3300005563 Ga0068855_100012152 Ga0068855_1000121523 322
86 3300009093 Ga0105240_10018132 Ga0105240_100181325 322
87 3300009174 Ga0105241_10100872 Ga0105241_101008722 322
88 3300013104 Ga0157370_10006967 Ga0157370_100069673 322
89 3300013105 Ga0157369_10010186 Ga0157369_100101865 322
90 3300013307 Ga0157372_10160972 Ga0157372_101609722 322
91 3300013307 Ga0157372_10161785 Ga0157372_101617853 322
92 3300025913 Ga0207695_10033487 Ga0207695_100334873 322
93 3300025919 Ga0207657_10112624 Ga0207657_101126242 322
94 3300025921 Ga0207652_10037427 Ga0207652_100374272 322
95 3300025949 Ga0207667_10039699 Ga0207667_100396994 322
96 3300035692 Ga0373935_0047414 Ga0373935_0047414_1155_2123 322
97 3300037312 Ga0395899_0060226 Ga0395899_0060226_1514_2515 322
98 3300037418 Ga0395900_0041472 Ga0395900_0041472_2506_3507 322
99 3300037466 Ga0395898_0070897 Ga0395898_0070897_299_1300 322
100 3300038443 Ga0395901_0208288 Ga0395901_0208288_837_1838 322
101 3300045976 Ga0466967_0006476 Ga0466967_0006476_2108_3097 324
102 3300046455 Ga0495603_0018253 Ga0495603_0018253_54_1043 324
103 3300046460 Ga0495638_0049867 Ga0495638_0049867_747_1736 324
104 3300046492 Ga0495585_0012766 Ga0495585_0012766_3448_4437 324
105 3300046514 Ga0495618_0015074 Ga0495618_0015074_1894_2868 324
106 3300046515 Ga0495620_0023734 Ga0495620_0023734_97_1086 324
107 3300046516 Ga0495628_0225620 Ga0495628_0225620_62_1036 324
108 3300046648 Ga0495611_0016973 Ga0495611_0016973_1614_2603 324
109 3300046794 Ga0495589_0013698 Ga0495589_0013698_3063_4052 324
110 3300046794 Ga0495589_0017900 Ga0495589_0017900_130_1119 324
111 3300037466 Ga0395898_0079252 Ga0395898_0079252_1834_2811 325
112 iso_pu_bacteria 2751185782 2753264077 325
113 iso_pu_bacteria 2862574272 2862583507 325
114 iso_pu_bacteria 2902792274 2902797586 325
115 iso_pu_bacteria 8057568493 8057572551 325
116 3300044683 Ga0466965_0013835 Ga0466965_0013835_2160_3140 326
117 3300044693 Ga0466961_0131422 Ga0466961_0131422_441_1421 326
118 3300044694 Ga0466963_0021965 Ga0466963_0021965_204_1184 326
119 3300044706 Ga0466964_0008753 Ga0466964_0008753_537_1517 326
120 3300044719 Ga0466971_0023100 Ga0466971_0023100_1761_2741 326
121 3300048910 Ga0496107_0233427 Ga0496107_0233427_284_1264 326
122 3300061719 Ga0466962_0010306 Ga0466962_0010306_536_1516 326
123 3300005467 Ga0070706_100000802 Ga0070706_10000080224 327
124 3300005467 Ga0070706_100066693 Ga0070706_1000666932 327
125 3300005468 Ga0070707_100000261 Ga0070707_10000026127 327
126 3300005471 Ga0070698_100000396 Ga0070698_10000039615 327
127 3300005536 Ga0070697_100120654 Ga0070697_1001206541 327
128 3300005983 Ga0081540_1000144 Ga0081540_100014428 327
129 3300006058 Ga0075432_10004466 Ga0075432_100044664 327
130 3300006852 Ga0075433_10023998 Ga0075433_100239983 327
131 3300006914 Ga0075436_100018469 Ga0075436_1000184693 327
132 3300025910 Ga0207684_10001022 Ga0207684_1000102215 327
133 3300025910 Ga0207684_10026265 Ga0207684_100262651 327
134 3300025922 Ga0207646_10000277 Ga0207646_1000027755 327
135 3300025922 Ga0207646_10026984 Ga0207646_100269844 327
136 3300037068 Ga0373925_0002092 Ga0373925_0002092_1770_2753 327
137 3300037853 Ga0436364_1292946 Ga0436364_1292946_1024_2007 327
138 3300038443 Ga0395901_0012561 Ga0395901_0012561_7433_8416 327
139 3300044694 Ga0466963_0100125 Ga0466963_0100125_132_1115 327
140 3300044842 Ga0466957_0063332 Ga0466957_0063332_696_1679 327
141 3300045836 Ga0466958_0137146 Ga0466958_0137146_112_1095 327
142 3300050507 nmdc:mga05p37_65865_c1 nmdc:mga05p37_65865_c1_1521_2504 327
143 3300050512 nmdc:mga0n895_43097_c1 nmdc:mga0n895_43097_c1_2106_3089 327
144 3300050512 nmdc:mga0n895_60975_c1 nmdc:mga0n895_60975_c1_679_1662 327
145 3300050513 nmdc:mga0rr50_5589_c1 nmdc:mga0rr50_5589_c1_4532_5515 327
146 3300050514 nmdc:mga08x19_26276_c1 nmdc:mga08x19_26276_c1_1599_2582 327
147 3300050515 nmdc:mga0a205_8696_c1 nmdc:mga0a205_8696_c1_4432_5415 327
148 3300005327 Ga0070658_10069026 Ga0070658_100690262 328
149 3300005329 Ga0070683_100035866 Ga0070683_1000358665 328
150 3300009098 Ga0105245_10003362 Ga0105245_100033629 328
151 3300009101 Ga0105247_10044035 Ga0105247_100440352 328
152 3300009148 Ga0105243_10008646 Ga0105243_100086462 328
153 3300009176 Ga0105242_10014477 Ga0105242_100144772 328
154 3300009177 Ga0105248_10017820 Ga0105248_100178207 328
155 3300009545 Ga0105237_10037830 Ga0105237_100378302 328
156 3300009551 Ga0105238_10035704 Ga0105238_100357045 328
157 3300009553 Ga0105249_10008439 Ga0105249_100084397 328
158 3300010375 Ga0105239_10006708 Ga0105239_100067089 328
159 3300011119 Ga0105246_10012092 Ga0105246_100120923 328
160 3300013104 Ga0157370_10116625 Ga0157370_101166253 328
161 3300013105 Ga0157369_10018390 Ga0157369_100183903 328
162 3300013296 Ga0157374_10025934 Ga0157374_100259343 328
163 3300013306 Ga0163162_10004860 Ga0163162_100048604 328
164 3300013307 Ga0157372_10010920 Ga0157372_100109207 328
165 3300025944 Ga0207661_10114802 Ga0207661_101148023 328
166 3300031616 Ga0307508_10007971 Ga0307508_100079715 328
167 3300034820 Ga0373959_0015339 Ga0373959_0015339_102_1088 328
168 3300035088 Ga0373940_0011781 Ga0373940_0011781_717_1703 328
169 3300035090 Ga0373949_0014584 Ga0373949_0014584_471_1457 328
170 3300035121 Ga0373960_0010713 Ga0373960_0010713_1059_2045 328
171 3300035691 Ga0373931_0003486 Ga0373931_0003486_633_1619 328
172 3300037418 Ga0395900_0004418 Ga0395900_0004418_581_1567 328
173 3300044683 Ga0466965_0166840 Ga0466965_0166840_140_1126 328
174 3300044694 Ga0466963_0073161 Ga0466963_0073161_1295_2281 328
175 3300044694 Ga0466963_0164682 Ga0466963_0164682_474_1460 328
176 3300044901 Ga0466960_0068780 Ga0466960_0068780_333_1319 328
177 3300044901 Ga0466960_0095784 Ga0466960_0095784_95_1081 328
178 3300045836 Ga0466958_0173177 Ga0466958_0173177_365_1351 328
179 3300045976 Ga0466967_0301488 Ga0466967_0301488_207_1193 328
180 3300048911 Ga0496108_0298518 Ga0496108_0298518_126_1112 328
181 3300048911 Ga0496108_0387163 Ga0496108_0387163_208_1194 328
182 3300048912 Ga0496109_0190492 Ga0496109_0190492_334_1320 328
183 3300048913 Ga0496110_0036368 Ga0496110_0036368_136_1122 328
184 3300048918 Ga0496115_0061702 Ga0496115_0061702_1374_2360 328
185 3300050512 nmdc:mga0n895_21550_c1 nmdc:mga0n895_21550_c1_3246_4232 328
186 3300050515 nmdc:mga0a205_9554_c1 nmdc:mga0a205_9554_c1_4184_5170 328
187 3300005327 Ga0070658_10037938 Ga0070658_100379381 329
188 3300005339 Ga0070660_100421598 Ga0070660_1004215981 329
189 3300005347 Ga0070668_100071498 Ga0070668_1000714982 329
190 3300005367 Ga0070667_100208533 Ga0070667_1002085332 329
191 3300005436 Ga0070713_100065266 Ga0070713_1000652662 329
192 3300005455 Ga0070663_100116043 Ga0070663_1001160432 329
193 3300005530 Ga0070679_100016122 Ga0070679_1000161225 329
194 3300005548 Ga0070665_100099194 Ga0070665_1000991943 329
195 3300005548 Ga0070665_100167585 Ga0070665_1001675852 329
196 3300005563 Ga0068855_100159724 Ga0068855_1001597242 329
197 3300005577 Ga0068857_100107661 Ga0068857_1001076612 329
198 3300005617 Ga0068859_100052159 Ga0068859_1000521593 329
199 3300005618 Ga0068864_100043428 Ga0068864_1000434284 329
200 3300005843 Ga0068860_100021390 Ga0068860_1000213906 329
201 3300005844 Ga0068862_100091562 Ga0068862_1000915622 329
202 3300005937 Ga0081455_10072274 Ga0081455_100722742 329
203 3300005983 Ga0081540_1015946 Ga0081540_10159464 329
204 3300006931 Ga0097620_100052159 Ga0097620_1000521593 329
205 3300009093 Ga0105240_10091504 Ga0105240_100915042 329
206 3300009177 Ga0105248_10026953 Ga0105248_100269536 329
207 3300009177 Ga0105248_10119344 Ga0105248_101193442 329
208 3300013297 Ga0157378_10056487 Ga0157378_100564872 329
209 3300013307 Ga0157372_10000043 Ga0157372_10000043122 329
210 3300013307 Ga0157372_10839131 Ga0157372_108391311 329
211 3300014325 Ga0163163_10069610 Ga0163163_100696102 329
212 3300014745 Ga0157377_10054214 Ga0157377_100542143 329
213 3300025898 Ga0207692_10017179 Ga0207692_100171792 329
214 3300025909 Ga0207705_10044155 Ga0207705_100441554 329
215 3300025913 Ga0207695_10184222 Ga0207695_101842222 329
216 3300025919 Ga0207657_10242929 Ga0207657_102429292 329
217 3300025921 Ga0207652_10029837 Ga0207652_100298372 329
218 3300025928 Ga0207700_10070833 Ga0207700_100708332 329
219 3300025941 Ga0207711_10019355 Ga0207711_100193555 329
220 3300025941 Ga0207711_10038327 Ga0207711_100383273 329
221 3300025944 Ga0207661_10050437 Ga0207661_100504373 329
222 3300025949 Ga0207667_10033476 Ga0207667_100334764 329
223 3300025949 Ga0207667_10107642 Ga0207667_101076422 329
224 3300026035 Ga0207703_10022551 Ga0207703_100225513 329
225 3300026035 Ga0207703_10212263 Ga0207703_102122632 329
226 3300026078 Ga0207702_10121041 Ga0207702_101210412 329
227 3300026116 Ga0207674_10258805 Ga0207674_102588051 329
228 3300028379 Ga0268266_10032252 Ga0268266_100322522 329
229 3300028380 Ga0268265_10098994 Ga0268265_100989942 329
230 3300028786 Ga0307517_10063281 Ga0307517_100632813 329
231 3300028794 Ga0307515_10040599 Ga0307515_100405996 329
232 3300028800 Ga0265338_10035284 Ga0265338_100352844 329
233 3300028800 Ga0265338_10110432 Ga0265338_101104322 329
234 3300030522 Ga0307512_10012187 Ga0307512_100121873 329
235 3300030522 Ga0307512_10012723 Ga0307512_100127233 329
236 3300030522 Ga0307512_10058316 Ga0307512_100583162 329
237 3300031247 Ga0265340_10050863 Ga0265340_100508632 329
238 3300031456 Ga0307513_10004058 Ga0307513_100040587 329
239 3300031507 Ga0307509_10014108 Ga0307509_100141087 329
240 3300031595 Ga0265313_10028112 Ga0265313_100281122 329
241 3300031616 Ga0307508_10003645 Ga0307508_100036456 329
242 3300031712 Ga0265342_10045570 Ga0265342_100455702 329
243 3300031730 Ga0307516_10006521 Ga0307516_100065212 329
244 3300044658 Ga0466972_0063275 Ga0466972_0063275_513_1502 329
245 3300044684 Ga0466966_0009028 Ga0466966_0009028_1246_2247 329
246 3300044684 Ga0466966_0170050 Ga0466966_0170050_38_1027 329
247 3300044693 Ga0466961_0040395 Ga0466961_0040395_495_1496 329
248 3300044694 Ga0466963_0043138 Ga0466963_0043138_1847_2842 329
249 3300044694 Ga0466963_0046944 Ga0466963_0046944_1780_2769 329
250 3300044694 Ga0466963_0067627 Ga0466963_0067627_617_1606 329
251 3300044694 Ga0466963_0070328 Ga0466963_0070328_1057_2046 329
252 3300044694 Ga0466963_0162389 Ga0466963_0162389_394_1392 329
253 3300044719 Ga0466971_0037737 Ga0466971_0037737_991_1986 329
254 3300044719 Ga0466971_0067955 Ga0466971_0067955_583_1572 329
255 3300044842 Ga0466957_0050149 Ga0466957_0050149_562_1551 329
256 3300044842 Ga0466957_0311628 Ga0466957_0311628_11_1000 329
257 3300045049 Ga0466959_0120161 Ga0466959_0120161_645_1646 329
258 3300045049 Ga0466959_0200097 Ga0466959_0200097_379_1368 329
259 3300045836 Ga0466958_0026875 Ga0466958_0026875_425_1420 329
260 3300045836 Ga0466958_0042347 Ga0466958_0042347_56_1045 329
261 3300045836 Ga0466958_0085327 Ga0466958_0085327_936_1925 329
262 3300045836 Ga0466958_0103000 Ga0466958_0103000_111_1100 329
263 3300045976 Ga0466967_0000744 Ga0466967_0000744_11565_12563 329
264 3300045976 Ga0466967_0000876 Ga0466967_0000876_9106_10095 329
265 3300048907 Ga0496104_0007131 Ga0496104_0007131_8325_9314 329
266 3300048907 Ga0496104_0282141 Ga0496104_0282141_117_1106 329
267 3300048908 Ga0496105_0039210 Ga0496105_0039210_611_1600 329
268 3300048911 Ga0496108_0013116 Ga0496108_0013116_3844_4833 329
269 3300048912 Ga0496109_0016368 Ga0496109_0016368_4214_5203 329
270 3300048912 Ga0496109_0092376 Ga0496109_0092376_977_1966 329
271 3300048913 Ga0496110_0025030 Ga0496110_0025030_572_1561 329
272 3300048914 Ga0496111_0111465 Ga0496111_0111465_756_1745 329
273 3300048916 Ga0496113_0004740 Ga0496113_0004740_6018_7007 329
274 3300048916 Ga0496113_0120811 Ga0496113_0120811_288_1277 329
275 3300048922 Ga0496119_0050878 Ga0496119_0050878_1458_2447 329
276 3300049581 Ga0501047_0012538 Ga0501047_0012538_1892_2881 329
277 3300049585 Ga0501069_0006545 Ga0501069_0006545_2044_3045 329
278 3300049586 Ga0501070_0003626 Ga0501070_0003626_10396_11397 329
279 3300049590 Ga0501074_0044829 Ga0501074_0044829_286_1287 329
280 3300049742 Ga0501080_0087630 Ga0501080_0087630_183_1184 329
281 3300053093 Ga0500651_0037281 Ga0500651_0037281_1314_2303 329
282 3300053118 Ga0500594_0023030 Ga0500594_0023030_485_1474 329
283 3300005334 Ga0068869_100072710 Ga0068869_1000727102 331
284 3300005337 Ga0070682_100052420 Ga0070682_1000524202 331
285 3300005338 Ga0068868_100046273 Ga0068868_1000462733 331
286 3300005339 Ga0070660_100009712 Ga0070660_1000097126 331
287 3300005345 Ga0070692_10028784 Ga0070692_100287842 331
288 3300005347 Ga0070668_100024302 Ga0070668_1000243023 331
289 3300005434 Ga0070709_10037222 Ga0070709_100372222 331
290 3300005435 Ga0070714_100007099 Ga0070714_1000070992 331
291 3300005436 Ga0070713_100002909 Ga0070713_1000029098 331
292 3300005437 Ga0070710_10007061 Ga0070710_100070613 331
293 3300005440 Ga0070705_100011838 Ga0070705_1000118384 331
294 3300005444 Ga0070694_100008734 Ga0070694_1000087345 331
295 3300005456 Ga0070678_100005181 Ga0070678_1000051817 331
296 3300005457 Ga0070662_100123973 Ga0070662_1001239732 331
297 3300005549 Ga0070704_100016928 Ga0070704_1000169283 331
298 3300005563 Ga0068855_100026980 Ga0068855_1000269806 331
299 3300005578 Ga0068854_100014109 Ga0068854_1000141094 331
300 3300005614 Ga0068856_100012844 Ga0068856_1000128444 331
301 3300005616 Ga0068852_100036384 Ga0068852_1000363842 331
302 3300005841 Ga0068863_100053500 Ga0068863_1000535003 331
303 3300005842 Ga0068858_100104473 Ga0068858_1001044732 331
304 3300006028 Ga0070717_10018485 Ga0070717_100184853 331
305 3300006852 Ga0075433_10005121 Ga0075433_100051216 331
306 3300006881 Ga0068865_100032145 Ga0068865_1000321454 331
307 3300007076 Ga0075435_100007021 Ga0075435_1000070212 331
308 3300025898 Ga0207692_10005862 Ga0207692_100058623 331
309 3300025900 Ga0207710_10018666 Ga0207710_100186662 331
310 3300025906 Ga0207699_10001943 Ga0207699_100019436 331
311 3300025914 Ga0207671_10021465 Ga0207671_100214652 331
312 3300025923 Ga0207681_10064469 Ga0207681_100644692 331
313 3300025924 Ga0207694_10012684 Ga0207694_100126845 331
314 3300025927 Ga0207687_10007969 Ga0207687_100079692 331
315 3300025928 Ga0207700_10005953 Ga0207700_100059536 331
316 3300025929 Ga0207664_10011839 Ga0207664_100118392 331
317 3300025933 Ga0207706_10073719 Ga0207706_100737193 331
318 3300025934 Ga0207686_10030431 Ga0207686_100304313 331
319 3300025941 Ga0207711_10241924 Ga0207711_102419242 331
320 3300025949 Ga0207667_10119586 Ga0207667_101195862 331
321 3300025961 Ga0207712_10004423 Ga0207712_100044235 331
322 3300025972 Ga0207668_10008893 Ga0207668_100088935 331
323 3300026023 Ga0207677_10063049 Ga0207677_100630492 331
324 3300026078 Ga0207702_10105569 Ga0207702_101055692 331
325 3300026118 Ga0207675_100039640 Ga0207675_1000396402 331
326 3300026121 Ga0207683_10009232 Ga0207683_100092322 331
327 3300026142 Ga0207698_10054927 Ga0207698_100549273 331
328 3300035242 Ga0373962_0003547 Ga0373962_0003547_1517_2512 331
329 3300001976 JGI24752J21851_1002148 JGI24752J21851_10021483 333
330 3300002459 JGI24751J29686_10001163 JGI24751J29686_100011633 333
331 3300005327 Ga0070658_10042503 Ga0070658_100425033 333
332 3300005328 Ga0070676_10024556 Ga0070676_100245562 333
333 3300005336 Ga0070680_100003841 Ga0070680_1000038413 333
334 3300005337 Ga0070682_100002208 Ga0070682_1000022082 333
335 3300005338 Ga0068868_100009852 Ga0068868_1000098524 333
336 3300005339 Ga0070660_100006399 Ga0070660_1000063995 333
337 3300005340 Ga0070689_100015704 Ga0070689_1000157044 333
338 3300005341 Ga0070691_10002949 Ga0070691_100029492 333
339 3300005343 Ga0070687_100089046 Ga0070687_1000890462 333
340 3300005344 Ga0070661_100022644 Ga0070661_1000226442 333
341 3300005345 Ga0070692_10001488 Ga0070692_100014885 333
342 3300005347 Ga0070668_100074191 Ga0070668_1000741912 333
343 3300005354 Ga0070675_100013299 Ga0070675_1000132993 333
344 3300005364 Ga0070673_100008420 Ga0070673_1000084203 333
345 3300005366 Ga0070659_100005968 Ga0070659_1000059685 333
346 3300005434 Ga0070709_10006045 Ga0070709_100060453 333
347 3300005435 Ga0070714_100031755 Ga0070714_1000317552 333
348 3300005436 Ga0070713_100004044 Ga0070713_1000040446 333
349 3300005455 Ga0070663_100023836 Ga0070663_1000238361 333
350 3300005458 Ga0070681_10023672 Ga0070681_100236725 333
351 3300005530 Ga0070679_100010266 Ga0070679_1000102665 333
352 3300005539 Ga0068853_100238271 Ga0068853_1002382712 333
353 3300005547 Ga0070693_100002658 Ga0070693_1000026585 333
354 3300005548 Ga0070665_100040764 Ga0070665_1000407642 333
355 3300005577 Ga0068857_100204340 Ga0068857_1002043402 333
356 3300005614 Ga0068856_100012979 Ga0068856_1000129793 333
357 3300005614 Ga0068856_100013286 Ga0068856_1000132867 333
358 3300005617 Ga0068859_100036772 Ga0068859_1000367722 333
359 3300005840 Ga0068870_10000206 Ga0068870_1000020612 333
360 3300005841 Ga0068863_100040827 Ga0068863_1000408274 333
361 3300005842 Ga0068858_100025174 Ga0068858_1000251745 333
362 3300005983 Ga0081540_1011090 Ga0081540_10110903 333
363 3300006175 Ga0070712_100091464 Ga0070712_1000914642 333
364 3300006237 Ga0097621_100007330 Ga0097621_1000073304 333
365 3300006358 Ga0068871_100008339 Ga0068871_1000083394 333
366 3300006847 Ga0075431_100306477 Ga0075431_1003064772 333
367 3300006852 Ga0075433_10006126 Ga0075433_100061266 333
368 3300006871 Ga0075434_100005408 Ga0075434_1000054089 333
369 3300006914 Ga0075436_100000490 Ga0075436_10000049014 333
370 3300006931 Ga0097620_100036773 Ga0097620_1000367732 333
371 3300007076 Ga0075435_100000491 Ga0075435_10000049116 333
372 3300009011 Ga0105251_10052775 Ga0105251_100527752 333
373 3300009093 Ga0105240_10087504 Ga0105240_100875043 333
374 3300009094 Ga0111539_10006134 Ga0111539_100061344 333
375 3300009098 Ga0105245_10010100 Ga0105245_100101005 333
376 3300009101 Ga0105247_10015340 Ga0105247_100153403 333
377 3300009174 Ga0105241_10006616 Ga0105241_100066165 333
378 3300009177 Ga0105248_10024030 Ga0105248_100240306 333
379 3300009545 Ga0105237_10026178 Ga0105237_100261783 333
380 3300009551 Ga0105238_10031540 Ga0105238_100315403 333
381 3300009553 Ga0105249_10255165 Ga0105249_102551652 333
382 3300010375 Ga0105239_10040701 Ga0105239_100407013 333
383 3300011119 Ga0105246_10001215 Ga0105246_100012159 333
384 3300013104 Ga0157370_10014083 Ga0157370_100140835 333
385 3300013105 Ga0157369_10018418 Ga0157369_100184184 333
386 3300013296 Ga0157374_10009748 Ga0157374_100097485 333
387 3300013307 Ga0157372_10011766 Ga0157372_100117664 333
388 3300013308 Ga0157375_10052610 Ga0157375_100526103 333
389 3300014325 Ga0163163_10238657 Ga0163163_102386572 333
390 3300014745 Ga0157377_10005230 Ga0157377_100052305 333
391 3300014968 Ga0157379_10049331 Ga0157379_100493313 333
392 3300020070 Ga0206356_11870205 Ga0206356_118702051 333
393 3300020081 Ga0206354_10109562 Ga0206354_101095622 333
394 3300020082 Ga0206353_10123281 Ga0206353_101232813 333
395 3300025321 Ga0207656_10006016 Ga0207656_100060163 333
396 3300025900 Ga0207710_10007632 Ga0207710_100076323 333
397 3300025901 Ga0207688_10002927 Ga0207688_100029273 333
398 3300025906 Ga0207699_10007023 Ga0207699_100070233 333
399 3300025907 Ga0207645_10020923 Ga0207645_100209233 333
400 3300025908 Ga0207643_10000816 Ga0207643_1000081616 333
401 3300025909 Ga0207705_10012126 Ga0207705_100121263 333
402 3300025911 Ga0207654_10005779 Ga0207654_100057793 333
403 3300025912 Ga0207707_10022368 Ga0207707_100223682 333
404 3300025915 Ga0207693_10129899 Ga0207693_101298992 333
405 3300025917 Ga0207660_10009296 Ga0207660_100092964 333
406 3300025919 Ga0207657_10008273 Ga0207657_100082734 333
407 3300025921 Ga0207652_10014129 Ga0207652_100141293 333
408 3300025924 Ga0207694_10011791 Ga0207694_100117914 333
409 3300025925 Ga0207650_10009680 Ga0207650_100096803 333
410 3300025926 Ga0207659_10002300 Ga0207659_100023008 333
411 3300025928 Ga0207700_10005422 Ga0207700_100054223 333
412 3300025929 Ga0207664_10134668 Ga0207664_101346682 333
413 3300025931 Ga0207644_10023479 Ga0207644_100234792 333
414 3300025932 Ga0207690_10013229 Ga0207690_100132292 333
415 3300025936 Ga0207670_10011678 Ga0207670_100116782 333
416 3300025938 Ga0207704_10242009 Ga0207704_102420092 333
417 3300025941 Ga0207711_10080052 Ga0207711_100800522 333
418 3300025942 Ga0207689_10033484 Ga0207689_100334843 333
419 3300025945 Ga0207679_10013112 Ga0207679_100131123 333
420 3300025972 Ga0207668_10231507 Ga0207668_102315072 333
421 3300026023 Ga0207677_10003273 Ga0207677_100032733 333
422 3300026041 Ga0207639_10095503 Ga0207639_100955032 333
423 3300026067 Ga0207678_10003464 Ga0207678_100034643 333
424 3300026078 Ga0207702_10002143 Ga0207702_100021439 333
425 3300026078 Ga0207702_10009643 Ga0207702_100096433 333
426 3300026088 Ga0207641_10015123 Ga0207641_100151234 333
427 3300026088 Ga0207641_10131180 Ga0207641_101311803 333
428 3300026095 Ga0207676_10002108 Ga0207676_100021089 333
429 3300026118 Ga0207675_100216779 Ga0207675_1002167792 333
430 3300026121 Ga0207683_10000446 Ga0207683_1000044622 333
431 3300026142 Ga0207698_10039974 Ga0207698_100399743 333
432 3300027907 Ga0207428_10002274 Ga0207428_100022749 333
433 3300035691 Ga0373931_0104375 Ga0373931_0104375_558_1559 333
434 3300038443 Ga0395901_0097377 Ga0395901_0097377_908_1909 333
435 3300047321 Ga0495676_0201655 Ga0495676_0201655_252_1253 333
436 3300048903 Ga0496100_0006848 Ga0496100_0006848_2032_3033 333
437 3300048904 Ga0496101_0044473 Ga0496101_0044473_816_1817 333
438 3300048905 Ga0496102_0015079 Ga0496102_0015079_5459_6460 333
439 3300048907 Ga0496104_0025215 Ga0496104_0025215_4267_5268 333
440 3300048908 Ga0496105_0002982 Ga0496105_0002982_4844_5845 333
441 3300048911 Ga0496108_0004925 Ga0496108_0004925_379_1380 333
442 3300048912 Ga0496109_0010642 Ga0496109_0010642_2920_3921 333
443 3300048913 Ga0496110_0003418 Ga0496110_0003418_3870_4871 333
444 3300048914 Ga0496111_0000654 Ga0496111_0000654_9632_10633 333
445 3300048915 Ga0496112_0250918 Ga0496112_0250918_213_1214 333
446 3300048916 Ga0496113_0002535 Ga0496113_0002535_6785_7786 333
447 3300050510 nmdc:mga06r32_218414_c1 nmdc:mga06r32_218414_c1_449_1450 333
448 3300050512 nmdc:mga0n895_12207_c1 nmdc:mga0n895_12207_c1_3650_4651 333
449 3300050513 nmdc:mga0rr50_1297_c1 nmdc:mga0rr50_1297_c1_3543_4544 333
450 3300050515 nmdc:mga0a205_15078_c1 nmdc:mga0a205_15078_c1_3771_4772 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

119

327

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8233 95 322
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8195 95 321
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7886 95 321
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7761 95 322
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7647 93 313
ID Description Score Start End Superfamily
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8878 93 320 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8766 91 320 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8746 95 322 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8745 95 322 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8726 93 320 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7X8Y7S7-F1-model_v4 ABC transporter permease 0.917 3 328 GO:0005886
GO:0071916
AF-A0A2E8YG86-F1-model_v4 ABC transporter permease 0.9096 4 327 GO:0005886
GO:0055085
AF-A0A5C4PQI6-F1-model_v4 ABC transporter permease 0.9052 2 328 GO:0005886
GO:0055085
AF-A0A1Q3T0R9-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9047 2 327 GO:0005886
GO:0055085
AF-W0INH2-F1-model_v4 deleted 0.9044 2 324

Feature Viewer

pLDDT pTM Quality
76.56 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map