F446513
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 450 | 265 | 446 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300001976|JGI24752J21851_1002148|JGI24752J21851_10021483 |
| Length | 333 |
| Sequence | VPYLLRRLGFFLLTLWAALTLNFIIPRFMPGSPLQALRDRTHNKLSPAALEQMLTSYGFKPDENVVVQYLDYLKNMVTGQWGISIGATLGEPVTRIVRQALPWTLGLVGVTTVLAFLLGSLIGVVSGWRRGSRLDSLLPPAFVVTSALPYFWVGLLLILVFSVWTGGLLPSDFNYDSGLQPAFTPAFVFSVFSHALLPAATILITSIGGWILTMRNNMITTLAEDYVRMGRAKGLSDRRIMTAYAARNAMLPNLSGFAMSLGFVIAGSILVEYVFNYPGLGYLLYNSVQNTDYPLMQALFMLFTVAVLVAVLVCDIAIAILDPRSRERDRSGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 2 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 3 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 155 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 156 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 158 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 159 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 160 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 161 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 165 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 173 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 197 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 260 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 261 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 262 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 263 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 264 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 265 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.44 |
| Metatranscriptomes | 0.67 |
| Isolates | 0.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.56 |
| Nodule | 0.22 |
| Rhizoplane | 7.11 |
| Rhizosphere | 87.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002148 | 3300001976 | Bacteria | 2633 |
| 2 | JGI24751J29686_10001163 | 3300002459 | Bacteria | 5628 |
| 3 | rootH1_10255697 | 3300003323 | Bacteria | 1795 |
| 4 | Ga0055540_1001492 | 3300003792 | Bacteria | 13904 |
| 5 | Ga0070658_10037938 | 3300005327 | Bacteria | 3885 |
| 6 | Ga0070658_10042503 | 3300005327 | Bacteria | 3671 |
| 7 | Ga0070658_10069026 | 3300005327 | Bacteria | 2891 |
| 8 | Ga0070676_10024556 | 3300005328 | Bacteria | 3397 |
| 9 | Ga0070683_100035866 | 3300005329 | Bacteria | 4536 |
| 10 | Ga0068869_100072710 | 3300005334 | Bacteria | 2548 |
| 11 | Ga0070680_100003841 | 3300005336 | Bacteria | 11228 |
| 12 | Ga0070680_100033274 | 3300005336 | Bacteria | 4154 |
| 13 | Ga0070682_100002208 | 3300005337 | Bacteria | 10787 |
| 14 | Ga0070682_100052420 | 3300005337 | Bacteria | 2553 |
| 15 | Ga0068868_100009852 | 3300005338 | Bacteria | 6899 |
| 16 | Ga0068868_100046273 | 3300005338 | Bacteria | 3406 |
| 17 | Ga0070660_100006399 | 3300005339 | Bacteria | 8164 |
| 18 | Ga0070660_100009712 | 3300005339 | Bacteria | 6780 |
| 19 | Ga0070660_100421598 | 3300005339 | Bacteria | 1105 |
| 20 | Ga0070689_100015704 | 3300005340 | Bacteria | 5528 |
| 21 | Ga0070691_10002949 | 3300005341 | Bacteria | 7627 |
| 22 | Ga0070687_100089046 | 3300005343 | Bacteria | 1703 |
| 23 | Ga0070661_100011885 | 3300005344 | Bacteria | 6075 |
| 24 | Ga0070661_100022644 | 3300005344 | Bacteria | 4499 |
| 25 | Ga0070692_10001488 | 3300005345 | Bacteria | 8550 |
| 26 | Ga0070692_10028784 | 3300005345 | Bacteria | 2764 |
| 27 | Ga0070692_10096115 | 3300005345 | Bacteria | 1618 |
| 28 | Ga0070668_100024302 | 3300005347 | Bacteria | 4589 |
| 29 | Ga0070668_100071498 | 3300005347 | Bacteria | 2703 |
| 30 | Ga0070668_100074191 | 3300005347 | Bacteria | 2654 |
| 31 | Ga0070675_100013299 | 3300005354 | Bacteria | 6467 |
| 32 | Ga0070673_100008420 | 3300005364 | Bacteria | 6858 |
| 33 | Ga0070659_100005968 | 3300005366 | Bacteria | 8782 |
| 34 | Ga0070667_100208533 | 3300005367 | Bacteria | 1736 |
| 35 | Ga0070709_10006045 | 3300005434 | Bacteria | 6583 |
| 36 | Ga0070709_10037222 | 3300005434 | Bacteria | 2970 |
| 37 | Ga0070714_100003195 | 3300005435 | Bacteria | 12185 |
| 38 | Ga0070714_100007099 | 3300005435 | Bacteria | 8686 |
| 39 | Ga0070714_100031755 | 3300005435 | Bacteria | 4409 |
| 40 | Ga0070714_100376286 | 3300005435 | Bacteria | 1338 |
| 41 | Ga0070713_100002909 | 3300005436 | Bacteria | 11210 |
| 42 | Ga0070713_100004044 | 3300005436 | Bacteria | 9769 |
| 43 | Ga0070713_100065266 | 3300005436 | Bacteria | 3057 |
| 44 | Ga0070710_10007061 | 3300005437 | Bacteria | 5422 |
| 45 | Ga0070705_100011838 | 3300005440 | Bacteria | 4416 |
| 46 | Ga0070694_100008734 | 3300005444 | Bacteria | 6205 |
| 47 | Ga0070663_100023836 | 3300005455 | Bacteria | 4108 |
| 48 | Ga0070663_100116043 | 3300005455 | Bacteria | 2017 |
| 49 | Ga0070678_100005181 | 3300005456 | Bacteria | 7497 |
| 50 | Ga0070662_100123973 | 3300005457 | Bacteria | 1983 |
| 51 | Ga0070681_10023672 | 3300005458 | Bacteria | 6180 |
| 52 | Ga0070706_100000802 | 3300005467 | Bacteria | 34929 |
| 53 | Ga0070706_100066693 | 3300005467 | Bacteria | 3329 |
| 54 | Ga0070707_100000261 | 3300005468 | Bacteria | 52696 |
| 55 | Ga0070698_100000396 | 3300005471 | Bacteria | 45923 |
| 56 | Ga0070699_100438905 | 3300005518 | Bacteria | 1183 |
| 57 | Ga0070679_100010266 | 3300005530 | Bacteria | 8877 |
| 58 | Ga0070679_100016122 | 3300005530 | Bacteria | 7199 |
| 59 | Ga0070679_100091820 | 3300005530 | Bacteria | 3024 |
| 60 | Ga0070697_100120654 | 3300005536 | Bacteria | 2193 |
| 61 | Ga0068853_100078072 | 3300005539 | Bacteria | 2893 |
| 62 | Ga0068853_100238271 | 3300005539 | Bacteria | 1667 |
| 63 | Ga0070693_100002658 | 3300005547 | Bacteria | 8229 |
| 64 | Ga0070665_100040764 | 3300005548 | Bacteria | 4667 |
| 65 | Ga0070665_100099194 | 3300005548 | Bacteria | 2917 |
| 66 | Ga0070665_100167585 | 3300005548 | Bacteria | 2198 |
| 67 | Ga0070704_100016928 | 3300005549 | Bacteria | 4622 |
| 68 | Ga0068855_100012152 | 3300005563 | Bacteria | 10404 |
| 69 | Ga0068855_100026980 | 3300005563 | Bacteria | 6873 |
| 70 | Ga0068855_100159724 | 3300005563 | Bacteria | 2559 |
| 71 | Ga0070664_100147907 | 3300005564 | Bacteria | 2072 |
| 72 | Ga0068857_100107661 | 3300005577 | Bacteria | 2504 |
| 73 | Ga0068857_100204340 | 3300005577 | Bacteria | 1801 |
| 74 | Ga0068854_100014109 | 3300005578 | Bacteria | 5259 |
| 75 | Ga0068856_100012844 | 3300005614 | Bacteria | 8104 |
| 76 | Ga0068856_100012979 | 3300005614 | Bacteria | 8067 |
| 77 | Ga0068856_100013286 | 3300005614 | Bacteria | 7975 |
| 78 | Ga0068852_100036384 | 3300005616 | Bacteria | 4118 |
| 79 | Ga0068859_100036772 | 3300005617 | Bacteria | 4915 |
| 80 | Ga0068859_100052159 | 3300005617 | Bacteria | 4112 |
| 81 | Ga0068864_100043428 | 3300005618 | Bacteria | 3849 |
| 82 | Ga0068870_10000206 | 3300005840 | Bacteria | 21149 |
| 83 | Ga0068863_100040827 | 3300005841 | Bacteria | 4411 |
| 84 | Ga0068863_100053500 | 3300005841 | Bacteria | 3827 |
| 85 | Ga0068858_100025174 | 3300005842 | Bacteria | 5537 |
| 86 | Ga0068858_100104473 | 3300005842 | Bacteria | 2643 |
| 87 | Ga0068860_100021390 | 3300005843 | Bacteria | 6263 |
| 88 | Ga0068862_100091562 | 3300005844 | Bacteria | 2649 |
| 89 | Ga0081455_10072274 | 3300005937 | Bacteria | 2856 |
| 90 | Ga0081540_1000144 | 3300005983 | Bacteria | 74266 |
| 91 | Ga0081540_1011090 | 3300005983 | Bacteria | 6050 |
| 92 | Ga0081540_1015946 | 3300005983 | Bacteria | 4733 |
| 93 | Ga0070717_10018485 | 3300006028 | Bacteria | 5442 |
| 94 | Ga0075432_10004466 | 3300006058 | Bacteria | 4772 |
| 95 | Ga0070712_100091464 | 3300006175 | Bacteria | 2229 |
| 96 | Ga0097621_100007330 | 3300006237 | Bacteria | 7883 |
| 97 | Ga0068871_100008339 | 3300006358 | Bacteria | 7450 |
| 98 | Ga0075431_100306477 | 3300006847 | Bacteria | 1604 |
| 99 | Ga0075433_10005121 | 3300006852 | Bacteria | 10283 |
| 100 | Ga0075433_10006126 | 3300006852 | Bacteria | 9472 |
| 101 | Ga0075433_10023998 | 3300006852 | Bacteria | 5141 |
| 102 | Ga0075434_100005408 | 3300006871 | Bacteria | 11620 |
| 103 | Ga0068865_100032145 | 3300006881 | Bacteria | 3504 |
| 104 | Ga0075436_100000490 | 3300006914 | Bacteria | 25561 |
| 105 | Ga0075436_100018469 | 3300006914 | Bacteria | 4774 |
| 106 | Ga0097620_100036773 | 3300006931 | Bacteria | 4915 |
| 107 | Ga0097620_100052159 | 3300006931 | Bacteria | 4112 |
| 108 | Ga0075435_100000491 | 3300007076 | Bacteria | 24044 |
| 109 | Ga0075435_100007021 | 3300007076 | Bacteria | 7992 |
| 110 | Ga0105251_10052775 | 3300009011 | Bacteria | 1935 |
| 111 | Ga0105240_10018132 | 3300009093 | Bacteria | 9463 |
| 112 | Ga0105240_10087504 | 3300009093 | Bacteria | 3815 |
| 113 | Ga0105240_10091504 | 3300009093 | Bacteria | 3716 |
| 114 | Ga0111539_10006134 | 3300009094 | Bacteria | 15519 |
| 115 | Ga0105245_10003362 | 3300009098 | Bacteria | 14342 |
| 116 | Ga0105245_10010100 | 3300009098 | Bacteria | 8224 |
| 117 | Ga0105247_10015340 | 3300009101 | Bacteria | 4590 |
| 118 | Ga0105247_10044035 | 3300009101 | Bacteria | 2736 |
| 119 | Ga0105243_10008646 | 3300009148 | Bacteria | 7810 |
| 120 | Ga0105241_10006616 | 3300009174 | Bacteria | 8539 |
| 121 | Ga0105241_10100872 | 3300009174 | Bacteria | 2294 |
| 122 | Ga0105242_10014477 | 3300009176 | Bacteria | 6111 |
| 123 | Ga0105248_10017820 | 3300009177 | Bacteria | 7837 |
| 124 | Ga0105248_10024030 | 3300009177 | Bacteria | 6774 |
| 125 | Ga0105248_10026953 | 3300009177 | Bacteria | 6391 |
| 126 | Ga0105248_10119344 | 3300009177 | Bacteria | 2975 |
| 127 | Ga0105237_10026178 | 3300009545 | Bacteria | 5962 |
| 128 | Ga0105237_10037830 | 3300009545 | Bacteria | 4875 |
| 129 | Ga0105238_10031540 | 3300009551 | Bacteria | 5396 |
| 130 | Ga0105238_10035704 | 3300009551 | Bacteria | 5052 |
| 131 | Ga0105249_10008439 | 3300009553 | Bacteria | 8974 |
| 132 | Ga0105249_10255165 | 3300009553 | Bacteria | 1740 |
| 133 | Ga0105239_10006708 | 3300010375 | Bacteria | 13298 |
| 134 | Ga0105239_10040701 | 3300010375 | Bacteria | 5092 |
| 135 | Ga0105246_10001215 | 3300011119 | Bacteria | 15095 |
| 136 | Ga0105246_10012092 | 3300011119 | Bacteria | 5378 |
| 137 | Ga0157370_10006967 | 3300013104 | Bacteria | 12345 |
| 138 | Ga0157370_10014083 | 3300013104 | Bacteria | 8204 |
| 139 | Ga0157370_10050187 | 3300013104 | Bacteria | 3989 |
| 140 | Ga0157370_10116625 | 3300013104 | Bacteria | 2494 |
| 141 | Ga0157369_10010186 | 3300013105 | Bacteria | 10726 |
| 142 | Ga0157369_10018390 | 3300013105 | Bacteria | 7836 |
| 143 | Ga0157369_10018418 | 3300013105 | Bacteria | 7830 |
| 144 | Ga0157369_10021816 | 3300013105 | Bacteria | 7161 |
| 145 | Ga0157374_10009748 | 3300013296 | Bacteria | 8246 |
| 146 | Ga0157374_10025934 | 3300013296 | Bacteria | 5269 |
| 147 | Ga0157374_10104891 | 3300013296 | Bacteria | 2714 |
| 148 | Ga0157378_10056487 | 3300013297 | Bacteria | 3498 |
| 149 | Ga0163162_10004860 | 3300013306 | Bacteria | 12967 |
| 150 | Ga0157372_10000043 | 3300013307 | Bacteria | 153958 |
| 151 | Ga0157372_10010920 | 3300013307 | Bacteria | 9665 |
| 152 | Ga0157372_10011766 | 3300013307 | Bacteria | 9319 |
| 153 | Ga0157372_10160972 | 3300013307 | Bacteria | 2594 |
| 154 | Ga0157372_10161785 | 3300013307 | Bacteria | 2587 |
| 155 | Ga0157372_10373130 | 3300013307 | Bacteria | 1662 |
| 156 | Ga0157372_10839131 | 3300013307 | Bacteria | 1067 |
| 157 | Ga0157375_10052610 | 3300013308 | Bacteria | 4004 |
| 158 | Ga0163163_10069610 | 3300014325 | Unclassified | 3503 |
| 159 | Ga0163163_10238657 | 3300014325 | Bacteria | 1867 |
| 160 | Ga0157377_10005230 | 3300014745 | Bacteria | 6076 |
| 161 | Ga0157377_10054214 | 3300014745 | Bacteria | 2269 |
| 162 | Ga0157379_10049331 | 3300014968 | Bacteria | 3758 |
| 163 | Ga0206356_11870205 | 3300020070 | Bacteria | 2489 |
| 164 | Ga0206354_10109562 | 3300020081 | Bacteria | 3494 |
| 165 | Ga0206353_10123281 | 3300020082 | Bacteria | 5671 |
| 166 | Ga0209051_1003334 | 3300025303 | Bacteria | 10614 |
| 167 | Ga0207656_10006016 | 3300025321 | Bacteria | 4338 |
| 168 | Ga0207692_10005862 | 3300025898 | Bacteria | 4952 |
| 169 | Ga0207692_10017179 | 3300025898 | Bacteria | 3222 |
| 170 | Ga0207710_10007632 | 3300025900 | Bacteria | 4576 |
| 171 | Ga0207710_10018666 | 3300025900 | Bacteria | 2952 |
| 172 | Ga0207688_10002927 | 3300025901 | Bacteria | 9280 |
| 173 | Ga0207699_10001943 | 3300025906 | Bacteria | 9746 |
| 174 | Ga0207699_10007023 | 3300025906 | Bacteria | 5485 |
| 175 | Ga0207645_10020923 | 3300025907 | Bacteria | 4274 |
| 176 | Ga0207643_10000816 | 3300025908 | Bacteria | 18940 |
| 177 | Ga0207705_10012126 | 3300025909 | Bacteria | 6230 |
| 178 | Ga0207705_10044155 | 3300025909 | Bacteria | 3203 |
| 179 | Ga0207684_10001022 | 3300025910 | Bacteria | 31388 |
| 180 | Ga0207684_10026265 | 3300025910 | Bacteria | 4965 |
| 181 | Ga0207654_10005779 | 3300025911 | Bacteria | 6246 |
| 182 | Ga0207707_10022368 | 3300025912 | Bacteria | 5527 |
| 183 | Ga0207707_10113307 | 3300025912 | Bacteria | 2370 |
| 184 | Ga0207695_10033487 | 3300025913 | Bacteria | 5602 |
| 185 | Ga0207695_10184222 | 3300025913 | Bacteria | 2008 |
| 186 | Ga0207671_10021465 | 3300025914 | Bacteria | 4900 |
| 187 | Ga0207693_10129899 | 3300025915 | Bacteria | 1980 |
| 188 | Ga0207660_10009296 | 3300025917 | Bacteria | 6364 |
| 189 | Ga0207660_10056960 | 3300025917 | Bacteria | 2798 |
| 190 | Ga0207657_10008273 | 3300025919 | Bacteria | 10588 |
| 191 | Ga0207657_10112624 | 3300025919 | Bacteria | 2245 |
| 192 | Ga0207657_10242929 | 3300025919 | Bacteria | 1437 |
| 193 | Ga0207652_10014129 | 3300025921 | Bacteria | 6464 |
| 194 | Ga0207652_10029837 | 3300025921 | Bacteria | 4564 |
| 195 | Ga0207652_10037427 | 3300025921 | Bacteria | 4107 |
| 196 | Ga0207646_10000277 | 3300025922 | Bacteria | 70138 |
| 197 | Ga0207646_10026984 | 3300025922 | Bacteria | 5236 |
| 198 | Ga0207681_10064469 | 3300025923 | Bacteria | 2530 |
| 199 | Ga0207694_10011791 | 3300025924 | Bacteria | 6594 |
| 200 | Ga0207694_10012684 | 3300025924 | Bacteria | 6349 |
| 201 | Ga0207650_10009680 | 3300025925 | Bacteria | 6588 |
| 202 | Ga0207659_10002300 | 3300025926 | Bacteria | 11379 |
| 203 | Ga0207687_10007969 | 3300025927 | Bacteria | 6935 |
| 204 | Ga0207700_10005422 | 3300025928 | Bacteria | 7630 |
| 205 | Ga0207700_10005953 | 3300025928 | Bacteria | 7338 |
| 206 | Ga0207700_10070833 | 3300025928 | Bacteria | 2682 |
| 207 | Ga0207664_10004421 | 3300025929 | Bacteria | 9516 |
| 208 | Ga0207664_10011839 | 3300025929 | Bacteria | 6221 |
| 209 | Ga0207664_10134668 | 3300025929 | Bacteria | 2084 |
| 210 | Ga0207644_10023479 | 3300025931 | Bacteria | 4224 |
| 211 | Ga0207690_10013229 | 3300025932 | Bacteria | 4954 |
| 212 | Ga0207690_10312252 | 3300025932 | Bacteria | 1233 |
| 213 | Ga0207706_10073719 | 3300025933 | Bacteria | 3002 |
| 214 | Ga0207686_10030431 | 3300025934 | Bacteria | 3196 |
| 215 | Ga0207670_10011678 | 3300025936 | Bacteria | 5110 |
| 216 | Ga0207704_10242009 | 3300025938 | Bacteria | 1349 |
| 217 | Ga0207691_10260903 | 3300025940 | Bacteria | 1494 |
| 218 | Ga0207711_10019355 | 3300025941 | Bacteria | 5668 |
| 219 | Ga0207711_10038327 | 3300025941 | Bacteria | 4075 |
| 220 | Ga0207711_10080052 | 3300025941 | Bacteria | 2853 |
| 221 | Ga0207711_10241924 | 3300025941 | Bacteria | 1655 |
| 222 | Ga0207689_10033484 | 3300025942 | Bacteria | 4270 |
| 223 | Ga0207661_10013774 | 3300025944 | Bacteria | 5907 |
| 224 | Ga0207661_10050437 | 3300025944 | Bacteria | 3316 |
| 225 | Ga0207661_10114802 | 3300025944 | Bacteria | 2284 |
| 226 | Ga0207679_10013112 | 3300025945 | Bacteria | 5427 |
| 227 | Ga0207667_10033476 | 3300025949 | Bacteria | 5524 |
| 228 | Ga0207667_10039699 | 3300025949 | Bacteria | 5015 |
| 229 | Ga0207667_10107642 | 3300025949 | Bacteria | 2876 |
| 230 | Ga0207667_10119586 | 3300025949 | Bacteria | 2715 |
| 231 | Ga0207712_10004423 | 3300025961 | Bacteria | 8880 |
| 232 | Ga0207668_10008893 | 3300025972 | Bacteria | 6007 |
| 233 | Ga0207668_10231507 | 3300025972 | Bacteria | 1490 |
| 234 | Ga0207677_10003273 | 3300026023 | Bacteria | 8556 |
| 235 | Ga0207677_10063049 | 3300026023 | Bacteria | 2575 |
| 236 | Ga0207703_10022551 | 3300026035 | Bacteria | 4940 |
| 237 | Ga0207703_10212263 | 3300026035 | Bacteria | 1726 |
| 238 | Ga0207639_10095503 | 3300026041 | Bacteria | 2389 |
| 239 | Ga0207678_10003464 | 3300026067 | Bacteria | 14200 |
| 240 | Ga0207702_10002143 | 3300026078 | Bacteria | 18963 |
| 241 | Ga0207702_10009643 | 3300026078 | Bacteria | 8106 |
| 242 | Ga0207702_10105569 | 3300026078 | Bacteria | 2495 |
| 243 | Ga0207702_10121041 | 3300026078 | Bacteria | 2343 |
| 244 | Ga0207641_10015123 | 3300026088 | Bacteria | 6323 |
| 245 | Ga0207641_10131180 | 3300026088 | Bacteria | 2251 |
| 246 | Ga0207676_10002108 | 3300026095 | Bacteria | 14407 |
| 247 | Ga0207674_10046962 | 3300026116 | Bacteria | 4430 |
| 248 | Ga0207674_10258805 | 3300026116 | Bacteria | 1687 |
| 249 | Ga0207675_100039640 | 3300026118 | Bacteria | 4396 |
| 250 | Ga0207675_100216779 | 3300026118 | Bacteria | 1843 |
| 251 | Ga0207683_10000446 | 3300026121 | Bacteria | 38241 |
| 252 | Ga0207683_10009232 | 3300026121 | Bacteria | 8403 |
| 253 | Ga0207698_10039974 | 3300026142 | Bacteria | 3479 |
| 254 | Ga0207698_10054927 | 3300026142 | Bacteria | 3066 |
| 255 | Ga0207428_10002274 | 3300027907 | Bacteria | 19270 |
| 256 | Ga0268266_10032252 | 3300028379 | Bacteria | 4452 |
| 257 | Ga0268265_10098994 | 3300028380 | Bacteria | 2350 |
| 258 | Ga0307517_10063281 | 3300028786 | Bacteria | 3462 |
| 259 | Ga0307515_10040599 | 3300028794 | Bacteria | 7352 |
| 260 | Ga0265338_10035284 | 3300028800 | Bacteria | 4812 |
| 261 | Ga0265338_10110432 | 3300028800 | Bacteria | 2216 |
| 262 | Ga0307512_10012187 | 3300030522 | Bacteria | 8128 |
| 263 | Ga0307512_10012723 | 3300030522 | Bacteria | 7926 |
| 264 | Ga0307512_10058316 | 3300030522 | Bacteria | 3009 |
| 265 | Ga0265340_10050863 | 3300031247 | Bacteria | 2008 |
| 266 | Ga0307513_10004058 | 3300031456 | Bacteria | 19623 |
| 267 | Ga0307509_10014108 | 3300031507 | Bacteria | 9423 |
| 268 | Ga0265313_10028112 | 3300031595 | Bacteria | 2929 |
| 269 | Ga0307508_10003645 | 3300031616 | Bacteria | 15439 |
| 270 | Ga0307508_10007971 | 3300031616 | Bacteria | 9823 |
| 271 | Ga0307508_10247560 | 3300031616 | Bacteria | 1379 |
| 272 | Ga0265342_10045570 | 3300031712 | Bacteria | 2639 |
| 273 | Ga0307516_10006521 | 3300031730 | Bacteria | 13664 |
| 274 | Ga0373959_0015339 | 3300034820 | Bacteria | 1406 |
| 275 | Ga0373934_0000085 | 3300035086 | Bacteria | 32802 |
| 276 | Ga0373940_0011781 | 3300035088 | Bacteria | 2084 |
| 277 | Ga0373949_0014584 | 3300035090 | Bacteria | 1751 |
| 278 | Ga0373923_0015959 | 3300035111 | Bacteria | 2843 |
| 279 | Ga0373953_0014714 | 3300035117 | Bacteria | 2820 |
| 280 | Ga0373956_0000101 | 3300035119 | Bacteria | 29430 |
| 281 | Ga0373957_0000234 | 3300035120 | Bacteria | 13854 |
| 282 | Ga0373960_0010713 | 3300035121 | Bacteria | 2245 |
| 283 | Ga0373955_0000756 | 3300035172 | Bacteria | 13890 |
| 284 | Ga0373942_0002084 | 3300035207 | Bacteria | 4970 |
| 285 | Ga0373962_0003547 | 3300035242 | Bacteria | 3749 |
| 286 | Ga0373931_0003486 | 3300035691 | Bacteria | 7075 |
| 287 | Ga0373931_0104375 | 3300035691 | Bacteria | 1599 |
| 288 | Ga0373935_0047414 | 3300035692 | Bacteria | 2717 |
| 289 | Ga0373933_0000001 | 3300035724 | Bacteria | 228234 |
| 290 | Ga0373937_0000033 | 3300036401 | Bacteria | 120102 |
| 291 | Ga0373925_0002092 | 3300037068 | Bacteria | 16399 |
| 292 | Ga0395899_0060226 | 3300037312 | Bacteria | 2797 |
| 293 | Ga0395900_0004418 | 3300037418 | Bacteria | 14911 |
| 294 | Ga0395900_0041472 | 3300037418 | Bacteria | 4745 |
| 295 | Ga0395898_0070897 | 3300037466 | Bacteria | 3368 |
| 296 | Ga0395898_0079252 | 3300037466 | Bacteria | 3169 |
| 297 | Ga0436364_0147188 | 3300037853 | Bacteria | 17063 |
| 298 | Ga0436364_1292946 | 3300037853 | Bacteria | 2045 |
| 299 | Ga0395901_0012561 | 3300038443 | Bacteria | 8594 |
| 300 | Ga0395901_0097377 | 3300038443 | Bacteria | 3084 |
| 301 | Ga0395901_0208288 | 3300038443 | Bacteria | 2047 |
| 302 | Ga0436365_1221295 | 3300039437 | Bacteria | 6969 |
| 303 | Ga0466972_0063275 | 3300044658 | Bacteria | 1772 |
| 304 | Ga0466965_0013835 | 3300044683 | Bacteria | 3811 |
| 305 | Ga0466965_0166840 | 3300044683 | Bacteria | 1156 |
| 306 | Ga0466966_0005133 | 3300044684 | Bacteria | 8603 |
| 307 | Ga0466966_0009028 | 3300044684 | Bacteria | 6606 |
| 308 | Ga0466966_0143212 | 3300044684 | Bacteria | 1460 |
| 309 | Ga0466966_0170050 | 3300044684 | Bacteria | 1325 |
| 310 | Ga0466961_0003109 | 3300044693 | Bacteria | 10334 |
| 311 | Ga0466961_0040395 | 3300044693 | Bacteria | 2991 |
| 312 | Ga0466961_0131422 | 3300044693 | Bacteria | 1569 |
| 313 | Ga0466963_0021965 | 3300044694 | Bacteria | 4034 |
| 314 | Ga0466963_0043138 | 3300044694 | Bacteria | 2964 |
| 315 | Ga0466963_0046944 | 3300044694 | Bacteria | 2849 |
| 316 | Ga0466963_0067627 | 3300044694 | Bacteria | 2398 |
| 317 | Ga0466963_0070328 | 3300044694 | Bacteria | 2354 |
| 318 | Ga0466963_0073161 | 3300044694 | Bacteria | 2310 |
| 319 | Ga0466963_0092577 | 3300044694 | Bacteria | 2060 |
| 320 | Ga0466963_0100125 | 3300044694 | Unclassified | 1983 |
| 321 | Ga0466963_0162389 | 3300044694 | Bacteria | 1555 |
| 322 | Ga0466963_0164682 | 3300044694 | Bacteria | 1544 |
| 323 | Ga0466964_0008753 | 3300044706 | Bacteria | 3804 |
| 324 | Ga0466971_0000661 | 3300044719 | Bacteria | 13719 |
| 325 | Ga0466971_0023100 | 3300044719 | Bacteria | 2771 |
| 326 | Ga0466971_0037737 | 3300044719 | Bacteria | 2166 |
| 327 | Ga0466971_0067955 | 3300044719 | Bacteria | 1616 |
| 328 | Ga0466957_0050149 | 3300044842 | Bacteria | 2539 |
| 329 | Ga0466957_0063332 | 3300044842 | Bacteria | 2273 |
| 330 | Ga0466957_0311628 | 3300044842 | Bacteria | 1060 |
| 331 | Ga0466960_0068780 | 3300044901 | Bacteria | 1758 |
| 332 | Ga0466960_0095784 | 3300044901 | Bacteria | 1520 |
| 333 | Ga0466959_0001596 | 3300045049 | Bacteria | 13982 |
| 334 | Ga0466959_0120161 | 3300045049 | Bacteria | 1869 |
| 335 | Ga0466959_0200097 | 3300045049 | Bacteria | 1391 |
| 336 | Ga0466958_0026875 | 3300045836 | Bacteria | 3402 |
| 337 | Ga0466958_0042347 | 3300045836 | Bacteria | 2742 |
| 338 | Ga0466958_0085327 | 3300045836 | Bacteria | 1948 |
| 339 | Ga0466958_0103000 | 3300045836 | Bacteria | 1777 |
| 340 | Ga0466958_0137146 | 3300045836 | Unclassified | 1539 |
| 341 | Ga0466958_0173177 | 3300045836 | Bacteria | 1367 |
| 342 | Ga0466967_0000744 | 3300045976 | Bacteria | 16732 |
| 343 | Ga0466967_0000876 | 3300045976 | Bacteria | 16017 |
| 344 | Ga0466967_0006476 | 3300045976 | Bacteria | 8294 |
| 345 | Ga0466967_0012542 | 3300045976 | Bacteria | 6489 |
| 346 | Ga0466967_0216118 | 3300045976 | Bacteria | 1820 |
| 347 | Ga0466967_0301488 | 3300045976 | Bacteria | 1542 |
| 348 | Ga0495592_0000002 | 3300046454 | Bacteria | 209491 |
| 349 | Ga0495592_0014493 | 3300046454 | Bacteria | 5983 |
| 350 | Ga0495603_0018253 | 3300046455 | Bacteria | 4243 |
| 351 | Ga0495638_0049867 | 3300046460 | Bacteria | 2616 |
| 352 | Ga0495651_0000002 | 3300046462 | Bacteria | 209492 |
| 353 | Ga0495653_0002193 | 3300046463 | Bacteria | 15456 |
| 354 | Ga0495653_0014002 | 3300046463 | Bacteria | 6540 |
| 355 | Ga0495664_0031484 | 3300046477 | Bacteria | 3110 |
| 356 | Ga0495585_0012766 | 3300046492 | Bacteria | 4942 |
| 357 | Ga0495608_0000027 | 3300046511 | Bacteria | 152979 |
| 358 | Ga0495618_0015074 | 3300046514 | Bacteria | 4715 |
| 359 | Ga0495620_0023734 | 3300046515 | Bacteria | 2927 |
| 360 | Ga0495628_0002351 | 3300046516 | Bacteria | 17082 |
| 361 | Ga0495628_0225620 | 3300046516 | Bacteria | 1405 |
| 362 | Ga0495652_0004197 | 3300046529 | Bacteria | 13870 |
| 363 | Ga0495652_0008945 | 3300046529 | Bacteria | 9113 |
| 364 | Ga0495587_0000588 | 3300046536 | Bacteria | 24923 |
| 365 | Ga0495645_0053534 | 3300046543 | Bacteria | 2933 |
| 366 | Ga0495667_0001897 | 3300046559 | Bacteria | 13870 |
| 367 | Ga0495611_0016973 | 3300046648 | Bacteria | 3112 |
| 368 | Ga0495635_0001507 | 3300046663 | Bacteria | 15611 |
| 369 | Ga0495657_0001117 | 3300046675 | Bacteria | 23500 |
| 370 | Ga0495599_0000006 | 3300046678 | Bacteria | 283487 |
| 371 | Ga0495623_0001890 | 3300046679 | Bacteria | 14069 |
| 372 | Ga0495623_0096111 | 3300046679 | Bacteria | 1811 |
| 373 | Ga0495646_0004006 | 3300046680 | Bacteria | 9225 |
| 374 | Ga0495646_0010666 | 3300046680 | Bacteria | 5837 |
| 375 | Ga0495589_0013698 | 3300046794 | Bacteria | 4181 |
| 376 | Ga0495589_0017900 | 3300046794 | Bacteria | 3634 |
| 377 | Ga0495600_0000601 | 3300046809 | Bacteria | 18587 |
| 378 | Ga0495600_0034124 | 3300046809 | Bacteria | 3303 |
| 379 | Ga0495581_0070569 | 3300047315 | Bacteria | 2021 |
| 380 | Ga0495604_0002777 | 3300047317 | Bacteria | 14044 |
| 381 | Ga0495676_0201655 | 3300047321 | Bacteria | 1382 |
| 382 | Ga0495680_0004160 | 3300047322 | Bacteria | 13908 |
| 383 | Ga0495675_0001558 | 3300047444 | Bacteria | 13841 |
| 384 | Ga0495686_0024203 | 3300047472 | Bacteria | 3993 |
| 385 | Ga0495602_0004579 | 3300048088 | Bacteria | 14425 |
| 386 | Ga0496100_0006848 | 3300048903 | Bacteria | 6244 |
| 387 | Ga0496101_0044473 | 3300048904 | Bacteria | 3178 |
| 388 | Ga0496102_0000319 | 3300048905 | Bacteria | 60314 |
| 389 | Ga0496102_0015079 | 3300048905 | Bacteria | 6728 |
| 390 | Ga0496103_0038447 | 3300048906 | Bacteria | 2936 |
| 391 | Ga0496104_0007131 | 3300048907 | Bacteria | 9853 |
| 392 | Ga0496104_0025215 | 3300048907 | Bacteria | 5480 |
| 393 | Ga0496104_0282141 | 3300048907 | Bacteria | 1574 |
| 394 | Ga0496105_0002982 | 3300048908 | Bacteria | 12442 |
| 395 | Ga0496105_0039210 | 3300048908 | Bacteria | 3904 |
| 396 | Ga0496107_0233427 | 3300048910 | Bacteria | 1369 |
| 397 | Ga0496108_0004925 | 3300048911 | Bacteria | 10785 |
| 398 | Ga0496108_0013116 | 3300048911 | Bacteria | 6756 |
| 399 | Ga0496108_0298518 | 3300048911 | Bacteria | 1403 |
| 400 | Ga0496108_0387163 | 3300048911 | Bacteria | 1221 |
| 401 | Ga0496109_0010642 | 3300048912 | Bacteria | 7867 |
| 402 | Ga0496109_0016368 | 3300048912 | Bacteria | 6482 |
| 403 | Ga0496109_0092376 | 3300048912 | Bacteria | 2799 |
| 404 | Ga0496109_0185160 | 3300048912 | Bacteria | 1957 |
| 405 | Ga0496109_0190492 | 3300048912 | Bacteria | 1927 |
| 406 | Ga0496110_0003418 | 3300048913 | Bacteria | 12144 |
| 407 | Ga0496110_0025030 | 3300048913 | Bacteria | 5096 |
| 408 | Ga0496110_0036368 | 3300048913 | Bacteria | 4275 |
| 409 | Ga0496111_0000654 | 3300048914 | Bacteria | 18257 |
| 410 | Ga0496111_0111465 | 3300048914 | Bacteria | 2015 |
| 411 | Ga0496112_0020453 | 3300048915 | Bacteria | 6274 |
| 412 | Ga0496112_0092069 | 3300048915 | Bacteria | 3001 |
| 413 | Ga0496112_0250918 | 3300048915 | Bacteria | 1720 |
| 414 | Ga0496113_0002535 | 3300048916 | Bacteria | 10647 |
| 415 | Ga0496113_0004740 | 3300048916 | Bacteria | 8395 |
| 416 | Ga0496113_0120811 | 3300048916 | Bacteria | 2048 |
| 417 | Ga0496115_0061702 | 3300048918 | Bacteria | 3023 |
| 418 | Ga0496119_0050878 | 3300048922 | Bacteria | 2550 |
| 419 | Ga0501047_0012538 | 3300049581 | Bacteria | 8027 |
| 420 | Ga0501069_0006545 | 3300049585 | Bacteria | 6093 |
| 421 | Ga0501070_0003626 | 3300049586 | Bacteria | 13335 |
| 422 | Ga0501073_0244926 | 3300049589 | Bacteria | 1238 |
| 423 | Ga0501074_0044829 | 3300049590 | Bacteria | 3200 |
| 424 | Ga0501080_0087630 | 3300049742 | Bacteria | 2892 |
| 425 | nmdc:mga05p37_65865_c1 | 3300050507 | Bacteria | 4457 |
| 426 | nmdc:mga06r32_218414_c1 | 3300050510 | Bacteria | 1894 |
| 427 | nmdc:mga0n895_12207_c1 | 3300050512 | Bacteria | 7697 |
| 428 | nmdc:mga0n895_21550_c1 | 3300050512 | Bacteria | 6030 |
| 429 | nmdc:mga0n895_43097_c1 | 3300050512 | Bacteria | 4396 |
| 430 | nmdc:mga0n895_60975_c1 | 3300050512 | Bacteria | 3723 |
| 431 | nmdc:mga0rr50_1297_c1 | 3300050513 | Bacteria | 13631 |
| 432 | nmdc:mga0rr50_5589_c1 | 3300050513 | Bacteria | 7520 |
| 433 | nmdc:mga08x19_26276_c1 | 3300050514 | Bacteria | 3632 |
| 434 | nmdc:mga0a205_15078_c1 | 3300050515 | Bacteria | 7217 |
| 435 | nmdc:mga0a205_8696_c1 | 3300050515 | Bacteria | 9246 |
| 436 | nmdc:mga0a205_9554_c1 | 3300050515 | Bacteria | 8875 |
| 437 | Ga0495601_0127514 | 3300053077 | Bacteria | 1656 |
| 438 | Ga0495601_0161900 | 3300053077 | Bacteria | 1462 |
| 439 | Ga0495612_0003851 | 3300053078 | Bacteria | 6228 |
| 440 | Ga0500644_0049332 | 3300053088 | Bacteria | 1436 |
| 441 | Ga0500651_0037281 | 3300053093 | Bacteria | 3063 |
| 442 | Ga0500594_0023030 | 3300053118 | Bacteria | 1575 |
| 443 | Ga0500652_102479 | 3300053131 | Bacteria | 1196 |
| 444 | Ga0500600_0033733 | 3300053149 | Bacteria | 2992 |
| 445 | Ga0466962_0001104 | 3300061719 | Bacteria | 12420 |
| 446 | Ga0466962_0010306 | 3300061719 | Bacteria | 4490 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047472 | Ga0495686_0024203 | Ga0495686_0024203_605_1582 | 268 |
| 2 | 3300003792 | Ga0055540_1001492 | Ga0055540_10014928 | 284 |
| 3 | 3300025303 | Ga0209051_1003334 | Ga0209051_10033347 | 284 |
| 4 | 3300046463 | Ga0495653_0014002 | Ga0495653_0014002_2360_3262 | 288 |
| 5 | 3300005539 | Ga0068853_100078072 | Ga0068853_1000780723 | 291 |
| 6 | 3300044684 | Ga0466966_0143212 | Ga0466966_0143212_26_916 | 296 |
| 7 | 3300048905 | Ga0496102_0000319 | Ga0496102_0000319_56482_57471 | 297 |
| 8 | 3300048906 | Ga0496103_0038447 | Ga0496103_0038447_499_1488 | 297 |
| 9 | 3300046543 | Ga0495645_0053534 | Ga0495645_0053534_21_923 | 300 |
| 10 | 3300053088 | Ga0500644_0049332 | Ga0500644_0049332_20_925 | 301 |
| 11 | 3300053131 | Ga0500652_102479 | Ga0500652_102479_270_1175 | 301 |
| 12 | 3300005345 | Ga0070692_10096115 | Ga0070692_100961151 | 302 |
| 13 | 3300048912 | Ga0496109_0185160 | Ga0496109_0185160_363_1355 | 303 |
| 14 | 3300005336 | Ga0070680_100033274 | Ga0070680_1000332743 | 304 |
| 15 | 3300005344 | Ga0070661_100011885 | Ga0070661_1000118853 | 304 |
| 16 | 3300013104 | Ga0157370_10050187 | Ga0157370_100501872 | 304 |
| 17 | 3300013105 | Ga0157369_10021816 | Ga0157369_100218164 | 304 |
| 18 | 3300025912 | Ga0207707_10113307 | Ga0207707_101133072 | 304 |
| 19 | 3300025917 | Ga0207660_10056960 | Ga0207660_100569602 | 304 |
| 20 | 3300025932 | Ga0207690_10312252 | Ga0207690_103122522 | 304 |
| 21 | 3300025944 | Ga0207661_10013774 | Ga0207661_100137742 | 304 |
| 22 | 3300026116 | Ga0207674_10046962 | Ga0207674_100469624 | 304 |
| 23 | 3300048915 | Ga0496112_0092069 | Ga0496112_0092069_1050_2042 | 304 |
| 24 | 3300013296 | Ga0157374_10104891 | Ga0157374_101048912 | 306 |
| 25 | 3300035207 | Ga0373942_0002084 | Ga0373942_0002084_3317_4312 | 307 |
| 26 | 3300005435 | Ga0070714_100376286 | Ga0070714_1003762862 | 309 |
| 27 | 3300013307 | Ga0157372_10373130 | Ga0157372_103731301 | 310 |
| 28 | 3300045976 | Ga0466967_0012542 | Ga0466967_0012542_2458_3435 | 310 |
| 29 | 3300005518 | Ga0070699_100438905 | Ga0070699_1004389051 | 313 |
| 30 | 3300039437 | Ga0436365_1221295 | Ga0436365_1221295_5516_6505 | 313 |
| 31 | 3300045976 | Ga0466967_0216118 | Ga0466967_0216118_506_1495 | 314 |
| 32 | 3300031616 | Ga0307508_10247560 | Ga0307508_102475601 | 315 |
| 33 | 3300048915 | Ga0496112_0020453 | Ga0496112_0020453_1541_2530 | 315 |
| 34 | 3300053149 | Ga0500600_0033733 | Ga0500600_0033733_874_1821 | 315 |
| 35 | 3300035086 | Ga0373934_0000085 | Ga0373934_0000085_12259_13242 | 316 |
| 36 | 3300035111 | Ga0373923_0015959 | Ga0373923_0015959_1736_2719 | 316 |
| 37 | 3300035117 | Ga0373953_0014714 | Ga0373953_0014714_1696_2679 | 316 |
| 38 | 3300035119 | Ga0373956_0000101 | Ga0373956_0000101_12824_13807 | 316 |
| 39 | 3300035120 | Ga0373957_0000234 | Ga0373957_0000234_153_1136 | 316 |
| 40 | 3300035172 | Ga0373955_0000756 | Ga0373955_0000756_145_1128 | 316 |
| 41 | 3300035724 | Ga0373933_0000001 | Ga0373933_0000001_12734_13717 | 316 |
| 42 | 3300036401 | Ga0373937_0000033 | Ga0373937_0000033_106357_107340 | 316 |
| 43 | 3300037853 | Ga0436364_0147188 | Ga0436364_0147188_6455_7441 | 316 |
| 44 | 3300044694 | Ga0466963_0092577 | Ga0466963_0092577_963_1946 | 316 |
| 45 | 3300046454 | Ga0495592_0000002 | Ga0495592_0000002_12763_13746 | 316 |
| 46 | 3300046462 | Ga0495651_0000002 | Ga0495651_0000002_195747_196730 | 316 |
| 47 | 3300046463 | Ga0495653_0002193 | Ga0495653_0002193_155_1138 | 316 |
| 48 | 3300046511 | Ga0495608_0000027 | Ga0495608_0000027_12763_13746 | 316 |
| 49 | 3300046516 | Ga0495628_0002351 | Ga0495628_0002351_142_1125 | 316 |
| 50 | 3300046529 | Ga0495652_0004197 | Ga0495652_0004197_12732_13715 | 316 |
| 51 | 3300046536 | Ga0495587_0000588 | Ga0495587_0000588_146_1129 | 316 |
| 52 | 3300046559 | Ga0495667_0001897 | Ga0495667_0001897_12763_13746 | 316 |
| 53 | 3300046675 | Ga0495657_0001117 | Ga0495657_0001117_178_1161 | 316 |
| 54 | 3300046678 | Ga0495599_0000006 | Ga0495599_0000006_13182_14165 | 316 |
| 55 | 3300046679 | Ga0495623_0001890 | Ga0495623_0001890_12908_13891 | 316 |
| 56 | 3300046680 | Ga0495646_0004006 | Ga0495646_0004006_8089_9072 | 316 |
| 57 | 3300046809 | Ga0495600_0000601 | Ga0495600_0000601_8404_9387 | 316 |
| 58 | 3300047317 | Ga0495604_0002777 | Ga0495604_0002777_12908_13891 | 316 |
| 59 | 3300047322 | Ga0495680_0004160 | Ga0495680_0004160_163_1146 | 316 |
| 60 | 3300047444 | Ga0495675_0001558 | Ga0495675_0001558_12710_13693 | 316 |
| 61 | 3300048088 | Ga0495602_0004579 | Ga0495602_0004579_13182_14165 | 316 |
| 62 | 3300053077 | Ga0495601_0127514 | Ga0495601_0127514_119_1102 | 316 |
| 63 | 3300003323 | rootH1_10255697 | rootH1_102556972 | 317 |
| 64 | 3300005435 | Ga0070714_100003195 | Ga0070714_1000031954 | 317 |
| 65 | 3300025929 | Ga0207664_10004421 | Ga0207664_100044214 | 317 |
| 66 | 3300005564 | Ga0070664_100147907 | Ga0070664_1001479072 | 318 |
| 67 | 3300047315 | Ga0495581_0070569 | Ga0495581_0070569_613_1569 | 318 |
| 68 | 3300049589 | Ga0501073_0244926 | Ga0501073_0244926_109_1065 | 318 |
| 69 | 3300044684 | Ga0466966_0005133 | Ga0466966_0005133_5679_6638 | 319 |
| 70 | 3300044693 | Ga0466961_0003109 | Ga0466961_0003109_5672_6631 | 319 |
| 71 | 3300044719 | Ga0466971_0000661 | Ga0466971_0000661_2771_3730 | 319 |
| 72 | 3300045049 | Ga0466959_0001596 | Ga0466959_0001596_6649_7608 | 319 |
| 73 | 3300046454 | Ga0495592_0014493 | Ga0495592_0014493_1182_2141 | 319 |
| 74 | 3300046477 | Ga0495664_0031484 | Ga0495664_0031484_1159_2118 | 319 |
| 75 | 3300046529 | Ga0495652_0008945 | Ga0495652_0008945_4332_5291 | 319 |
| 76 | 3300046663 | Ga0495635_0001507 | Ga0495635_0001507_5289_6248 | 319 |
| 77 | 3300046679 | Ga0495623_0096111 | Ga0495623_0096111_640_1599 | 319 |
| 78 | 3300046680 | Ga0495646_0010666 | Ga0495646_0010666_3216_4175 | 319 |
| 79 | 3300046809 | Ga0495600_0034124 | Ga0495600_0034124_796_1755 | 319 |
| 80 | 3300053077 | Ga0495601_0161900 | Ga0495601_0161900_15_974 | 319 |
| 81 | 3300053078 | Ga0495612_0003851 | Ga0495612_0003851_2091_3050 | 319 |
| 82 | 3300061719 | Ga0466962_0001104 | Ga0466962_0001104_854_1813 | 319 |
| 83 | 3300025940 | Ga0207691_10260903 | Ga0207691_102609031 | 321 |
| 84 | 3300005530 | Ga0070679_100091820 | Ga0070679_1000918203 | 322 |
| 85 | 3300005563 | Ga0068855_100012152 | Ga0068855_1000121523 | 322 |
| 86 | 3300009093 | Ga0105240_10018132 | Ga0105240_100181325 | 322 |
| 87 | 3300009174 | Ga0105241_10100872 | Ga0105241_101008722 | 322 |
| 88 | 3300013104 | Ga0157370_10006967 | Ga0157370_100069673 | 322 |
| 89 | 3300013105 | Ga0157369_10010186 | Ga0157369_100101865 | 322 |
| 90 | 3300013307 | Ga0157372_10160972 | Ga0157372_101609722 | 322 |
| 91 | 3300013307 | Ga0157372_10161785 | Ga0157372_101617853 | 322 |
| 92 | 3300025913 | Ga0207695_10033487 | Ga0207695_100334873 | 322 |
| 93 | 3300025919 | Ga0207657_10112624 | Ga0207657_101126242 | 322 |
| 94 | 3300025921 | Ga0207652_10037427 | Ga0207652_100374272 | 322 |
| 95 | 3300025949 | Ga0207667_10039699 | Ga0207667_100396994 | 322 |
| 96 | 3300035692 | Ga0373935_0047414 | Ga0373935_0047414_1155_2123 | 322 |
| 97 | 3300037312 | Ga0395899_0060226 | Ga0395899_0060226_1514_2515 | 322 |
| 98 | 3300037418 | Ga0395900_0041472 | Ga0395900_0041472_2506_3507 | 322 |
| 99 | 3300037466 | Ga0395898_0070897 | Ga0395898_0070897_299_1300 | 322 |
| 100 | 3300038443 | Ga0395901_0208288 | Ga0395901_0208288_837_1838 | 322 |
| 101 | 3300045976 | Ga0466967_0006476 | Ga0466967_0006476_2108_3097 | 324 |
| 102 | 3300046455 | Ga0495603_0018253 | Ga0495603_0018253_54_1043 | 324 |
| 103 | 3300046460 | Ga0495638_0049867 | Ga0495638_0049867_747_1736 | 324 |
| 104 | 3300046492 | Ga0495585_0012766 | Ga0495585_0012766_3448_4437 | 324 |
| 105 | 3300046514 | Ga0495618_0015074 | Ga0495618_0015074_1894_2868 | 324 |
| 106 | 3300046515 | Ga0495620_0023734 | Ga0495620_0023734_97_1086 | 324 |
| 107 | 3300046516 | Ga0495628_0225620 | Ga0495628_0225620_62_1036 | 324 |
| 108 | 3300046648 | Ga0495611_0016973 | Ga0495611_0016973_1614_2603 | 324 |
| 109 | 3300046794 | Ga0495589_0013698 | Ga0495589_0013698_3063_4052 | 324 |
| 110 | 3300046794 | Ga0495589_0017900 | Ga0495589_0017900_130_1119 | 324 |
| 111 | 3300037466 | Ga0395898_0079252 | Ga0395898_0079252_1834_2811 | 325 |
| 112 | iso_pu_bacteria | 2751185782 | 2753264077 | 325 |
| 113 | iso_pu_bacteria | 2862574272 | 2862583507 | 325 |
| 114 | iso_pu_bacteria | 2902792274 | 2902797586 | 325 |
| 115 | iso_pu_bacteria | 8057568493 | 8057572551 | 325 |
| 116 | 3300044683 | Ga0466965_0013835 | Ga0466965_0013835_2160_3140 | 326 |
| 117 | 3300044693 | Ga0466961_0131422 | Ga0466961_0131422_441_1421 | 326 |
| 118 | 3300044694 | Ga0466963_0021965 | Ga0466963_0021965_204_1184 | 326 |
| 119 | 3300044706 | Ga0466964_0008753 | Ga0466964_0008753_537_1517 | 326 |
| 120 | 3300044719 | Ga0466971_0023100 | Ga0466971_0023100_1761_2741 | 326 |
| 121 | 3300048910 | Ga0496107_0233427 | Ga0496107_0233427_284_1264 | 326 |
| 122 | 3300061719 | Ga0466962_0010306 | Ga0466962_0010306_536_1516 | 326 |
| 123 | 3300005467 | Ga0070706_100000802 | Ga0070706_10000080224 | 327 |
| 124 | 3300005467 | Ga0070706_100066693 | Ga0070706_1000666932 | 327 |
| 125 | 3300005468 | Ga0070707_100000261 | Ga0070707_10000026127 | 327 |
| 126 | 3300005471 | Ga0070698_100000396 | Ga0070698_10000039615 | 327 |
| 127 | 3300005536 | Ga0070697_100120654 | Ga0070697_1001206541 | 327 |
| 128 | 3300005983 | Ga0081540_1000144 | Ga0081540_100014428 | 327 |
| 129 | 3300006058 | Ga0075432_10004466 | Ga0075432_100044664 | 327 |
| 130 | 3300006852 | Ga0075433_10023998 | Ga0075433_100239983 | 327 |
| 131 | 3300006914 | Ga0075436_100018469 | Ga0075436_1000184693 | 327 |
| 132 | 3300025910 | Ga0207684_10001022 | Ga0207684_1000102215 | 327 |
| 133 | 3300025910 | Ga0207684_10026265 | Ga0207684_100262651 | 327 |
| 134 | 3300025922 | Ga0207646_10000277 | Ga0207646_1000027755 | 327 |
| 135 | 3300025922 | Ga0207646_10026984 | Ga0207646_100269844 | 327 |
| 136 | 3300037068 | Ga0373925_0002092 | Ga0373925_0002092_1770_2753 | 327 |
| 137 | 3300037853 | Ga0436364_1292946 | Ga0436364_1292946_1024_2007 | 327 |
| 138 | 3300038443 | Ga0395901_0012561 | Ga0395901_0012561_7433_8416 | 327 |
| 139 | 3300044694 | Ga0466963_0100125 | Ga0466963_0100125_132_1115 | 327 |
| 140 | 3300044842 | Ga0466957_0063332 | Ga0466957_0063332_696_1679 | 327 |
| 141 | 3300045836 | Ga0466958_0137146 | Ga0466958_0137146_112_1095 | 327 |
| 142 | 3300050507 | nmdc:mga05p37_65865_c1 | nmdc:mga05p37_65865_c1_1521_2504 | 327 |
| 143 | 3300050512 | nmdc:mga0n895_43097_c1 | nmdc:mga0n895_43097_c1_2106_3089 | 327 |
| 144 | 3300050512 | nmdc:mga0n895_60975_c1 | nmdc:mga0n895_60975_c1_679_1662 | 327 |
| 145 | 3300050513 | nmdc:mga0rr50_5589_c1 | nmdc:mga0rr50_5589_c1_4532_5515 | 327 |
| 146 | 3300050514 | nmdc:mga08x19_26276_c1 | nmdc:mga08x19_26276_c1_1599_2582 | 327 |
| 147 | 3300050515 | nmdc:mga0a205_8696_c1 | nmdc:mga0a205_8696_c1_4432_5415 | 327 |
| 148 | 3300005327 | Ga0070658_10069026 | Ga0070658_100690262 | 328 |
| 149 | 3300005329 | Ga0070683_100035866 | Ga0070683_1000358665 | 328 |
| 150 | 3300009098 | Ga0105245_10003362 | Ga0105245_100033629 | 328 |
| 151 | 3300009101 | Ga0105247_10044035 | Ga0105247_100440352 | 328 |
| 152 | 3300009148 | Ga0105243_10008646 | Ga0105243_100086462 | 328 |
| 153 | 3300009176 | Ga0105242_10014477 | Ga0105242_100144772 | 328 |
| 154 | 3300009177 | Ga0105248_10017820 | Ga0105248_100178207 | 328 |
| 155 | 3300009545 | Ga0105237_10037830 | Ga0105237_100378302 | 328 |
| 156 | 3300009551 | Ga0105238_10035704 | Ga0105238_100357045 | 328 |
| 157 | 3300009553 | Ga0105249_10008439 | Ga0105249_100084397 | 328 |
| 158 | 3300010375 | Ga0105239_10006708 | Ga0105239_100067089 | 328 |
| 159 | 3300011119 | Ga0105246_10012092 | Ga0105246_100120923 | 328 |
| 160 | 3300013104 | Ga0157370_10116625 | Ga0157370_101166253 | 328 |
| 161 | 3300013105 | Ga0157369_10018390 | Ga0157369_100183903 | 328 |
| 162 | 3300013296 | Ga0157374_10025934 | Ga0157374_100259343 | 328 |
| 163 | 3300013306 | Ga0163162_10004860 | Ga0163162_100048604 | 328 |
| 164 | 3300013307 | Ga0157372_10010920 | Ga0157372_100109207 | 328 |
| 165 | 3300025944 | Ga0207661_10114802 | Ga0207661_101148023 | 328 |
| 166 | 3300031616 | Ga0307508_10007971 | Ga0307508_100079715 | 328 |
| 167 | 3300034820 | Ga0373959_0015339 | Ga0373959_0015339_102_1088 | 328 |
| 168 | 3300035088 | Ga0373940_0011781 | Ga0373940_0011781_717_1703 | 328 |
| 169 | 3300035090 | Ga0373949_0014584 | Ga0373949_0014584_471_1457 | 328 |
| 170 | 3300035121 | Ga0373960_0010713 | Ga0373960_0010713_1059_2045 | 328 |
| 171 | 3300035691 | Ga0373931_0003486 | Ga0373931_0003486_633_1619 | 328 |
| 172 | 3300037418 | Ga0395900_0004418 | Ga0395900_0004418_581_1567 | 328 |
| 173 | 3300044683 | Ga0466965_0166840 | Ga0466965_0166840_140_1126 | 328 |
| 174 | 3300044694 | Ga0466963_0073161 | Ga0466963_0073161_1295_2281 | 328 |
| 175 | 3300044694 | Ga0466963_0164682 | Ga0466963_0164682_474_1460 | 328 |
| 176 | 3300044901 | Ga0466960_0068780 | Ga0466960_0068780_333_1319 | 328 |
| 177 | 3300044901 | Ga0466960_0095784 | Ga0466960_0095784_95_1081 | 328 |
| 178 | 3300045836 | Ga0466958_0173177 | Ga0466958_0173177_365_1351 | 328 |
| 179 | 3300045976 | Ga0466967_0301488 | Ga0466967_0301488_207_1193 | 328 |
| 180 | 3300048911 | Ga0496108_0298518 | Ga0496108_0298518_126_1112 | 328 |
| 181 | 3300048911 | Ga0496108_0387163 | Ga0496108_0387163_208_1194 | 328 |
| 182 | 3300048912 | Ga0496109_0190492 | Ga0496109_0190492_334_1320 | 328 |
| 183 | 3300048913 | Ga0496110_0036368 | Ga0496110_0036368_136_1122 | 328 |
| 184 | 3300048918 | Ga0496115_0061702 | Ga0496115_0061702_1374_2360 | 328 |
| 185 | 3300050512 | nmdc:mga0n895_21550_c1 | nmdc:mga0n895_21550_c1_3246_4232 | 328 |
| 186 | 3300050515 | nmdc:mga0a205_9554_c1 | nmdc:mga0a205_9554_c1_4184_5170 | 328 |
| 187 | 3300005327 | Ga0070658_10037938 | Ga0070658_100379381 | 329 |
| 188 | 3300005339 | Ga0070660_100421598 | Ga0070660_1004215981 | 329 |
| 189 | 3300005347 | Ga0070668_100071498 | Ga0070668_1000714982 | 329 |
| 190 | 3300005367 | Ga0070667_100208533 | Ga0070667_1002085332 | 329 |
| 191 | 3300005436 | Ga0070713_100065266 | Ga0070713_1000652662 | 329 |
| 192 | 3300005455 | Ga0070663_100116043 | Ga0070663_1001160432 | 329 |
| 193 | 3300005530 | Ga0070679_100016122 | Ga0070679_1000161225 | 329 |
| 194 | 3300005548 | Ga0070665_100099194 | Ga0070665_1000991943 | 329 |
| 195 | 3300005548 | Ga0070665_100167585 | Ga0070665_1001675852 | 329 |
| 196 | 3300005563 | Ga0068855_100159724 | Ga0068855_1001597242 | 329 |
| 197 | 3300005577 | Ga0068857_100107661 | Ga0068857_1001076612 | 329 |
| 198 | 3300005617 | Ga0068859_100052159 | Ga0068859_1000521593 | 329 |
| 199 | 3300005618 | Ga0068864_100043428 | Ga0068864_1000434284 | 329 |
| 200 | 3300005843 | Ga0068860_100021390 | Ga0068860_1000213906 | 329 |
| 201 | 3300005844 | Ga0068862_100091562 | Ga0068862_1000915622 | 329 |
| 202 | 3300005937 | Ga0081455_10072274 | Ga0081455_100722742 | 329 |
| 203 | 3300005983 | Ga0081540_1015946 | Ga0081540_10159464 | 329 |
| 204 | 3300006931 | Ga0097620_100052159 | Ga0097620_1000521593 | 329 |
| 205 | 3300009093 | Ga0105240_10091504 | Ga0105240_100915042 | 329 |
| 206 | 3300009177 | Ga0105248_10026953 | Ga0105248_100269536 | 329 |
| 207 | 3300009177 | Ga0105248_10119344 | Ga0105248_101193442 | 329 |
| 208 | 3300013297 | Ga0157378_10056487 | Ga0157378_100564872 | 329 |
| 209 | 3300013307 | Ga0157372_10000043 | Ga0157372_10000043122 | 329 |
| 210 | 3300013307 | Ga0157372_10839131 | Ga0157372_108391311 | 329 |
| 211 | 3300014325 | Ga0163163_10069610 | Ga0163163_100696102 | 329 |
| 212 | 3300014745 | Ga0157377_10054214 | Ga0157377_100542143 | 329 |
| 213 | 3300025898 | Ga0207692_10017179 | Ga0207692_100171792 | 329 |
| 214 | 3300025909 | Ga0207705_10044155 | Ga0207705_100441554 | 329 |
| 215 | 3300025913 | Ga0207695_10184222 | Ga0207695_101842222 | 329 |
| 216 | 3300025919 | Ga0207657_10242929 | Ga0207657_102429292 | 329 |
| 217 | 3300025921 | Ga0207652_10029837 | Ga0207652_100298372 | 329 |
| 218 | 3300025928 | Ga0207700_10070833 | Ga0207700_100708332 | 329 |
| 219 | 3300025941 | Ga0207711_10019355 | Ga0207711_100193555 | 329 |
| 220 | 3300025941 | Ga0207711_10038327 | Ga0207711_100383273 | 329 |
| 221 | 3300025944 | Ga0207661_10050437 | Ga0207661_100504373 | 329 |
| 222 | 3300025949 | Ga0207667_10033476 | Ga0207667_100334764 | 329 |
| 223 | 3300025949 | Ga0207667_10107642 | Ga0207667_101076422 | 329 |
| 224 | 3300026035 | Ga0207703_10022551 | Ga0207703_100225513 | 329 |
| 225 | 3300026035 | Ga0207703_10212263 | Ga0207703_102122632 | 329 |
| 226 | 3300026078 | Ga0207702_10121041 | Ga0207702_101210412 | 329 |
| 227 | 3300026116 | Ga0207674_10258805 | Ga0207674_102588051 | 329 |
| 228 | 3300028379 | Ga0268266_10032252 | Ga0268266_100322522 | 329 |
| 229 | 3300028380 | Ga0268265_10098994 | Ga0268265_100989942 | 329 |
| 230 | 3300028786 | Ga0307517_10063281 | Ga0307517_100632813 | 329 |
| 231 | 3300028794 | Ga0307515_10040599 | Ga0307515_100405996 | 329 |
| 232 | 3300028800 | Ga0265338_10035284 | Ga0265338_100352844 | 329 |
| 233 | 3300028800 | Ga0265338_10110432 | Ga0265338_101104322 | 329 |
| 234 | 3300030522 | Ga0307512_10012187 | Ga0307512_100121873 | 329 |
| 235 | 3300030522 | Ga0307512_10012723 | Ga0307512_100127233 | 329 |
| 236 | 3300030522 | Ga0307512_10058316 | Ga0307512_100583162 | 329 |
| 237 | 3300031247 | Ga0265340_10050863 | Ga0265340_100508632 | 329 |
| 238 | 3300031456 | Ga0307513_10004058 | Ga0307513_100040587 | 329 |
| 239 | 3300031507 | Ga0307509_10014108 | Ga0307509_100141087 | 329 |
| 240 | 3300031595 | Ga0265313_10028112 | Ga0265313_100281122 | 329 |
| 241 | 3300031616 | Ga0307508_10003645 | Ga0307508_100036456 | 329 |
| 242 | 3300031712 | Ga0265342_10045570 | Ga0265342_100455702 | 329 |
| 243 | 3300031730 | Ga0307516_10006521 | Ga0307516_100065212 | 329 |
| 244 | 3300044658 | Ga0466972_0063275 | Ga0466972_0063275_513_1502 | 329 |
| 245 | 3300044684 | Ga0466966_0009028 | Ga0466966_0009028_1246_2247 | 329 |
| 246 | 3300044684 | Ga0466966_0170050 | Ga0466966_0170050_38_1027 | 329 |
| 247 | 3300044693 | Ga0466961_0040395 | Ga0466961_0040395_495_1496 | 329 |
| 248 | 3300044694 | Ga0466963_0043138 | Ga0466963_0043138_1847_2842 | 329 |
| 249 | 3300044694 | Ga0466963_0046944 | Ga0466963_0046944_1780_2769 | 329 |
| 250 | 3300044694 | Ga0466963_0067627 | Ga0466963_0067627_617_1606 | 329 |
| 251 | 3300044694 | Ga0466963_0070328 | Ga0466963_0070328_1057_2046 | 329 |
| 252 | 3300044694 | Ga0466963_0162389 | Ga0466963_0162389_394_1392 | 329 |
| 253 | 3300044719 | Ga0466971_0037737 | Ga0466971_0037737_991_1986 | 329 |
| 254 | 3300044719 | Ga0466971_0067955 | Ga0466971_0067955_583_1572 | 329 |
| 255 | 3300044842 | Ga0466957_0050149 | Ga0466957_0050149_562_1551 | 329 |
| 256 | 3300044842 | Ga0466957_0311628 | Ga0466957_0311628_11_1000 | 329 |
| 257 | 3300045049 | Ga0466959_0120161 | Ga0466959_0120161_645_1646 | 329 |
| 258 | 3300045049 | Ga0466959_0200097 | Ga0466959_0200097_379_1368 | 329 |
| 259 | 3300045836 | Ga0466958_0026875 | Ga0466958_0026875_425_1420 | 329 |
| 260 | 3300045836 | Ga0466958_0042347 | Ga0466958_0042347_56_1045 | 329 |
| 261 | 3300045836 | Ga0466958_0085327 | Ga0466958_0085327_936_1925 | 329 |
| 262 | 3300045836 | Ga0466958_0103000 | Ga0466958_0103000_111_1100 | 329 |
| 263 | 3300045976 | Ga0466967_0000744 | Ga0466967_0000744_11565_12563 | 329 |
| 264 | 3300045976 | Ga0466967_0000876 | Ga0466967_0000876_9106_10095 | 329 |
| 265 | 3300048907 | Ga0496104_0007131 | Ga0496104_0007131_8325_9314 | 329 |
| 266 | 3300048907 | Ga0496104_0282141 | Ga0496104_0282141_117_1106 | 329 |
| 267 | 3300048908 | Ga0496105_0039210 | Ga0496105_0039210_611_1600 | 329 |
| 268 | 3300048911 | Ga0496108_0013116 | Ga0496108_0013116_3844_4833 | 329 |
| 269 | 3300048912 | Ga0496109_0016368 | Ga0496109_0016368_4214_5203 | 329 |
| 270 | 3300048912 | Ga0496109_0092376 | Ga0496109_0092376_977_1966 | 329 |
| 271 | 3300048913 | Ga0496110_0025030 | Ga0496110_0025030_572_1561 | 329 |
| 272 | 3300048914 | Ga0496111_0111465 | Ga0496111_0111465_756_1745 | 329 |
| 273 | 3300048916 | Ga0496113_0004740 | Ga0496113_0004740_6018_7007 | 329 |
| 274 | 3300048916 | Ga0496113_0120811 | Ga0496113_0120811_288_1277 | 329 |
| 275 | 3300048922 | Ga0496119_0050878 | Ga0496119_0050878_1458_2447 | 329 |
| 276 | 3300049581 | Ga0501047_0012538 | Ga0501047_0012538_1892_2881 | 329 |
| 277 | 3300049585 | Ga0501069_0006545 | Ga0501069_0006545_2044_3045 | 329 |
| 278 | 3300049586 | Ga0501070_0003626 | Ga0501070_0003626_10396_11397 | 329 |
| 279 | 3300049590 | Ga0501074_0044829 | Ga0501074_0044829_286_1287 | 329 |
| 280 | 3300049742 | Ga0501080_0087630 | Ga0501080_0087630_183_1184 | 329 |
| 281 | 3300053093 | Ga0500651_0037281 | Ga0500651_0037281_1314_2303 | 329 |
| 282 | 3300053118 | Ga0500594_0023030 | Ga0500594_0023030_485_1474 | 329 |
| 283 | 3300005334 | Ga0068869_100072710 | Ga0068869_1000727102 | 331 |
| 284 | 3300005337 | Ga0070682_100052420 | Ga0070682_1000524202 | 331 |
| 285 | 3300005338 | Ga0068868_100046273 | Ga0068868_1000462733 | 331 |
| 286 | 3300005339 | Ga0070660_100009712 | Ga0070660_1000097126 | 331 |
| 287 | 3300005345 | Ga0070692_10028784 | Ga0070692_100287842 | 331 |
| 288 | 3300005347 | Ga0070668_100024302 | Ga0070668_1000243023 | 331 |
| 289 | 3300005434 | Ga0070709_10037222 | Ga0070709_100372222 | 331 |
| 290 | 3300005435 | Ga0070714_100007099 | Ga0070714_1000070992 | 331 |
| 291 | 3300005436 | Ga0070713_100002909 | Ga0070713_1000029098 | 331 |
| 292 | 3300005437 | Ga0070710_10007061 | Ga0070710_100070613 | 331 |
| 293 | 3300005440 | Ga0070705_100011838 | Ga0070705_1000118384 | 331 |
| 294 | 3300005444 | Ga0070694_100008734 | Ga0070694_1000087345 | 331 |
| 295 | 3300005456 | Ga0070678_100005181 | Ga0070678_1000051817 | 331 |
| 296 | 3300005457 | Ga0070662_100123973 | Ga0070662_1001239732 | 331 |
| 297 | 3300005549 | Ga0070704_100016928 | Ga0070704_1000169283 | 331 |
| 298 | 3300005563 | Ga0068855_100026980 | Ga0068855_1000269806 | 331 |
| 299 | 3300005578 | Ga0068854_100014109 | Ga0068854_1000141094 | 331 |
| 300 | 3300005614 | Ga0068856_100012844 | Ga0068856_1000128444 | 331 |
| 301 | 3300005616 | Ga0068852_100036384 | Ga0068852_1000363842 | 331 |
| 302 | 3300005841 | Ga0068863_100053500 | Ga0068863_1000535003 | 331 |
| 303 | 3300005842 | Ga0068858_100104473 | Ga0068858_1001044732 | 331 |
| 304 | 3300006028 | Ga0070717_10018485 | Ga0070717_100184853 | 331 |
| 305 | 3300006852 | Ga0075433_10005121 | Ga0075433_100051216 | 331 |
| 306 | 3300006881 | Ga0068865_100032145 | Ga0068865_1000321454 | 331 |
| 307 | 3300007076 | Ga0075435_100007021 | Ga0075435_1000070212 | 331 |
| 308 | 3300025898 | Ga0207692_10005862 | Ga0207692_100058623 | 331 |
| 309 | 3300025900 | Ga0207710_10018666 | Ga0207710_100186662 | 331 |
| 310 | 3300025906 | Ga0207699_10001943 | Ga0207699_100019436 | 331 |
| 311 | 3300025914 | Ga0207671_10021465 | Ga0207671_100214652 | 331 |
| 312 | 3300025923 | Ga0207681_10064469 | Ga0207681_100644692 | 331 |
| 313 | 3300025924 | Ga0207694_10012684 | Ga0207694_100126845 | 331 |
| 314 | 3300025927 | Ga0207687_10007969 | Ga0207687_100079692 | 331 |
| 315 | 3300025928 | Ga0207700_10005953 | Ga0207700_100059536 | 331 |
| 316 | 3300025929 | Ga0207664_10011839 | Ga0207664_100118392 | 331 |
| 317 | 3300025933 | Ga0207706_10073719 | Ga0207706_100737193 | 331 |
| 318 | 3300025934 | Ga0207686_10030431 | Ga0207686_100304313 | 331 |
| 319 | 3300025941 | Ga0207711_10241924 | Ga0207711_102419242 | 331 |
| 320 | 3300025949 | Ga0207667_10119586 | Ga0207667_101195862 | 331 |
| 321 | 3300025961 | Ga0207712_10004423 | Ga0207712_100044235 | 331 |
| 322 | 3300025972 | Ga0207668_10008893 | Ga0207668_100088935 | 331 |
| 323 | 3300026023 | Ga0207677_10063049 | Ga0207677_100630492 | 331 |
| 324 | 3300026078 | Ga0207702_10105569 | Ga0207702_101055692 | 331 |
| 325 | 3300026118 | Ga0207675_100039640 | Ga0207675_1000396402 | 331 |
| 326 | 3300026121 | Ga0207683_10009232 | Ga0207683_100092322 | 331 |
| 327 | 3300026142 | Ga0207698_10054927 | Ga0207698_100549273 | 331 |
| 328 | 3300035242 | Ga0373962_0003547 | Ga0373962_0003547_1517_2512 | 331 |
| 329 | 3300001976 | JGI24752J21851_1002148 | JGI24752J21851_10021483 | 333 |
| 330 | 3300002459 | JGI24751J29686_10001163 | JGI24751J29686_100011633 | 333 |
| 331 | 3300005327 | Ga0070658_10042503 | Ga0070658_100425033 | 333 |
| 332 | 3300005328 | Ga0070676_10024556 | Ga0070676_100245562 | 333 |
| 333 | 3300005336 | Ga0070680_100003841 | Ga0070680_1000038413 | 333 |
| 334 | 3300005337 | Ga0070682_100002208 | Ga0070682_1000022082 | 333 |
| 335 | 3300005338 | Ga0068868_100009852 | Ga0068868_1000098524 | 333 |
| 336 | 3300005339 | Ga0070660_100006399 | Ga0070660_1000063995 | 333 |
| 337 | 3300005340 | Ga0070689_100015704 | Ga0070689_1000157044 | 333 |
| 338 | 3300005341 | Ga0070691_10002949 | Ga0070691_100029492 | 333 |
| 339 | 3300005343 | Ga0070687_100089046 | Ga0070687_1000890462 | 333 |
| 340 | 3300005344 | Ga0070661_100022644 | Ga0070661_1000226442 | 333 |
| 341 | 3300005345 | Ga0070692_10001488 | Ga0070692_100014885 | 333 |
| 342 | 3300005347 | Ga0070668_100074191 | Ga0070668_1000741912 | 333 |
| 343 | 3300005354 | Ga0070675_100013299 | Ga0070675_1000132993 | 333 |
| 344 | 3300005364 | Ga0070673_100008420 | Ga0070673_1000084203 | 333 |
| 345 | 3300005366 | Ga0070659_100005968 | Ga0070659_1000059685 | 333 |
| 346 | 3300005434 | Ga0070709_10006045 | Ga0070709_100060453 | 333 |
| 347 | 3300005435 | Ga0070714_100031755 | Ga0070714_1000317552 | 333 |
| 348 | 3300005436 | Ga0070713_100004044 | Ga0070713_1000040446 | 333 |
| 349 | 3300005455 | Ga0070663_100023836 | Ga0070663_1000238361 | 333 |
| 350 | 3300005458 | Ga0070681_10023672 | Ga0070681_100236725 | 333 |
| 351 | 3300005530 | Ga0070679_100010266 | Ga0070679_1000102665 | 333 |
| 352 | 3300005539 | Ga0068853_100238271 | Ga0068853_1002382712 | 333 |
| 353 | 3300005547 | Ga0070693_100002658 | Ga0070693_1000026585 | 333 |
| 354 | 3300005548 | Ga0070665_100040764 | Ga0070665_1000407642 | 333 |
| 355 | 3300005577 | Ga0068857_100204340 | Ga0068857_1002043402 | 333 |
| 356 | 3300005614 | Ga0068856_100012979 | Ga0068856_1000129793 | 333 |
| 357 | 3300005614 | Ga0068856_100013286 | Ga0068856_1000132867 | 333 |
| 358 | 3300005617 | Ga0068859_100036772 | Ga0068859_1000367722 | 333 |
| 359 | 3300005840 | Ga0068870_10000206 | Ga0068870_1000020612 | 333 |
| 360 | 3300005841 | Ga0068863_100040827 | Ga0068863_1000408274 | 333 |
| 361 | 3300005842 | Ga0068858_100025174 | Ga0068858_1000251745 | 333 |
| 362 | 3300005983 | Ga0081540_1011090 | Ga0081540_10110903 | 333 |
| 363 | 3300006175 | Ga0070712_100091464 | Ga0070712_1000914642 | 333 |
| 364 | 3300006237 | Ga0097621_100007330 | Ga0097621_1000073304 | 333 |
| 365 | 3300006358 | Ga0068871_100008339 | Ga0068871_1000083394 | 333 |
| 366 | 3300006847 | Ga0075431_100306477 | Ga0075431_1003064772 | 333 |
| 367 | 3300006852 | Ga0075433_10006126 | Ga0075433_100061266 | 333 |
| 368 | 3300006871 | Ga0075434_100005408 | Ga0075434_1000054089 | 333 |
| 369 | 3300006914 | Ga0075436_100000490 | Ga0075436_10000049014 | 333 |
| 370 | 3300006931 | Ga0097620_100036773 | Ga0097620_1000367732 | 333 |
| 371 | 3300007076 | Ga0075435_100000491 | Ga0075435_10000049116 | 333 |
| 372 | 3300009011 | Ga0105251_10052775 | Ga0105251_100527752 | 333 |
| 373 | 3300009093 | Ga0105240_10087504 | Ga0105240_100875043 | 333 |
| 374 | 3300009094 | Ga0111539_10006134 | Ga0111539_100061344 | 333 |
| 375 | 3300009098 | Ga0105245_10010100 | Ga0105245_100101005 | 333 |
| 376 | 3300009101 | Ga0105247_10015340 | Ga0105247_100153403 | 333 |
| 377 | 3300009174 | Ga0105241_10006616 | Ga0105241_100066165 | 333 |
| 378 | 3300009177 | Ga0105248_10024030 | Ga0105248_100240306 | 333 |
| 379 | 3300009545 | Ga0105237_10026178 | Ga0105237_100261783 | 333 |
| 380 | 3300009551 | Ga0105238_10031540 | Ga0105238_100315403 | 333 |
| 381 | 3300009553 | Ga0105249_10255165 | Ga0105249_102551652 | 333 |
| 382 | 3300010375 | Ga0105239_10040701 | Ga0105239_100407013 | 333 |
| 383 | 3300011119 | Ga0105246_10001215 | Ga0105246_100012159 | 333 |
| 384 | 3300013104 | Ga0157370_10014083 | Ga0157370_100140835 | 333 |
| 385 | 3300013105 | Ga0157369_10018418 | Ga0157369_100184184 | 333 |
| 386 | 3300013296 | Ga0157374_10009748 | Ga0157374_100097485 | 333 |
| 387 | 3300013307 | Ga0157372_10011766 | Ga0157372_100117664 | 333 |
| 388 | 3300013308 | Ga0157375_10052610 | Ga0157375_100526103 | 333 |
| 389 | 3300014325 | Ga0163163_10238657 | Ga0163163_102386572 | 333 |
| 390 | 3300014745 | Ga0157377_10005230 | Ga0157377_100052305 | 333 |
| 391 | 3300014968 | Ga0157379_10049331 | Ga0157379_100493313 | 333 |
| 392 | 3300020070 | Ga0206356_11870205 | Ga0206356_118702051 | 333 |
| 393 | 3300020081 | Ga0206354_10109562 | Ga0206354_101095622 | 333 |
| 394 | 3300020082 | Ga0206353_10123281 | Ga0206353_101232813 | 333 |
| 395 | 3300025321 | Ga0207656_10006016 | Ga0207656_100060163 | 333 |
| 396 | 3300025900 | Ga0207710_10007632 | Ga0207710_100076323 | 333 |
| 397 | 3300025901 | Ga0207688_10002927 | Ga0207688_100029273 | 333 |
| 398 | 3300025906 | Ga0207699_10007023 | Ga0207699_100070233 | 333 |
| 399 | 3300025907 | Ga0207645_10020923 | Ga0207645_100209233 | 333 |
| 400 | 3300025908 | Ga0207643_10000816 | Ga0207643_1000081616 | 333 |
| 401 | 3300025909 | Ga0207705_10012126 | Ga0207705_100121263 | 333 |
| 402 | 3300025911 | Ga0207654_10005779 | Ga0207654_100057793 | 333 |
| 403 | 3300025912 | Ga0207707_10022368 | Ga0207707_100223682 | 333 |
| 404 | 3300025915 | Ga0207693_10129899 | Ga0207693_101298992 | 333 |
| 405 | 3300025917 | Ga0207660_10009296 | Ga0207660_100092964 | 333 |
| 406 | 3300025919 | Ga0207657_10008273 | Ga0207657_100082734 | 333 |
| 407 | 3300025921 | Ga0207652_10014129 | Ga0207652_100141293 | 333 |
| 408 | 3300025924 | Ga0207694_10011791 | Ga0207694_100117914 | 333 |
| 409 | 3300025925 | Ga0207650_10009680 | Ga0207650_100096803 | 333 |
| 410 | 3300025926 | Ga0207659_10002300 | Ga0207659_100023008 | 333 |
| 411 | 3300025928 | Ga0207700_10005422 | Ga0207700_100054223 | 333 |
| 412 | 3300025929 | Ga0207664_10134668 | Ga0207664_101346682 | 333 |
| 413 | 3300025931 | Ga0207644_10023479 | Ga0207644_100234792 | 333 |
| 414 | 3300025932 | Ga0207690_10013229 | Ga0207690_100132292 | 333 |
| 415 | 3300025936 | Ga0207670_10011678 | Ga0207670_100116782 | 333 |
| 416 | 3300025938 | Ga0207704_10242009 | Ga0207704_102420092 | 333 |
| 417 | 3300025941 | Ga0207711_10080052 | Ga0207711_100800522 | 333 |
| 418 | 3300025942 | Ga0207689_10033484 | Ga0207689_100334843 | 333 |
| 419 | 3300025945 | Ga0207679_10013112 | Ga0207679_100131123 | 333 |
| 420 | 3300025972 | Ga0207668_10231507 | Ga0207668_102315072 | 333 |
| 421 | 3300026023 | Ga0207677_10003273 | Ga0207677_100032733 | 333 |
| 422 | 3300026041 | Ga0207639_10095503 | Ga0207639_100955032 | 333 |
| 423 | 3300026067 | Ga0207678_10003464 | Ga0207678_100034643 | 333 |
| 424 | 3300026078 | Ga0207702_10002143 | Ga0207702_100021439 | 333 |
| 425 | 3300026078 | Ga0207702_10009643 | Ga0207702_100096433 | 333 |
| 426 | 3300026088 | Ga0207641_10015123 | Ga0207641_100151234 | 333 |
| 427 | 3300026088 | Ga0207641_10131180 | Ga0207641_101311803 | 333 |
| 428 | 3300026095 | Ga0207676_10002108 | Ga0207676_100021089 | 333 |
| 429 | 3300026118 | Ga0207675_100216779 | Ga0207675_1002167792 | 333 |
| 430 | 3300026121 | Ga0207683_10000446 | Ga0207683_1000044622 | 333 |
| 431 | 3300026142 | Ga0207698_10039974 | Ga0207698_100399743 | 333 |
| 432 | 3300027907 | Ga0207428_10002274 | Ga0207428_100022749 | 333 |
| 433 | 3300035691 | Ga0373931_0104375 | Ga0373931_0104375_558_1559 | 333 |
| 434 | 3300038443 | Ga0395901_0097377 | Ga0395901_0097377_908_1909 | 333 |
| 435 | 3300047321 | Ga0495676_0201655 | Ga0495676_0201655_252_1253 | 333 |
| 436 | 3300048903 | Ga0496100_0006848 | Ga0496100_0006848_2032_3033 | 333 |
| 437 | 3300048904 | Ga0496101_0044473 | Ga0496101_0044473_816_1817 | 333 |
| 438 | 3300048905 | Ga0496102_0015079 | Ga0496102_0015079_5459_6460 | 333 |
| 439 | 3300048907 | Ga0496104_0025215 | Ga0496104_0025215_4267_5268 | 333 |
| 440 | 3300048908 | Ga0496105_0002982 | Ga0496105_0002982_4844_5845 | 333 |
| 441 | 3300048911 | Ga0496108_0004925 | Ga0496108_0004925_379_1380 | 333 |
| 442 | 3300048912 | Ga0496109_0010642 | Ga0496109_0010642_2920_3921 | 333 |
| 443 | 3300048913 | Ga0496110_0003418 | Ga0496110_0003418_3870_4871 | 333 |
| 444 | 3300048914 | Ga0496111_0000654 | Ga0496111_0000654_9632_10633 | 333 |
| 445 | 3300048915 | Ga0496112_0250918 | Ga0496112_0250918_213_1214 | 333 |
| 446 | 3300048916 | Ga0496113_0002535 | Ga0496113_0002535_6785_7786 | 333 |
| 447 | 3300050510 | nmdc:mga06r32_218414_c1 | nmdc:mga06r32_218414_c1_449_1450 | 333 |
| 448 | 3300050512 | nmdc:mga0n895_12207_c1 | nmdc:mga0n895_12207_c1_3650_4651 | 333 |
| 449 | 3300050513 | nmdc:mga0rr50_1297_c1 | nmdc:mga0rr50_1297_c1_3543_4544 | 333 |
| 450 | 3300050515 | nmdc:mga0a205_15078_c1 | nmdc:mga0a205_15078_c1_3771_4772 | 333 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
119
327
0.99
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.8233 | 95 | 322 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.8195 | 95 | 321 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7886 | 95 | 321 |
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.7761 | 95 | 322 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7647 | 93 | 313 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFH2_84_300_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8878 | 93 | 320 | 1.10.3720.10 |
| af_Q2FZR7_83_297_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8766 | 91 | 320 | 1.10.3720.10 |
| af_P75798_87_300_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8746 | 95 | 322 | 1.10.3720.10 |
| af_P33591_90_303_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8745 | 95 | 322 | 1.10.3720.10 |
| af_P0AFH2_84_300_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8726 | 93 | 320 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X8Y7S7-F1-model_v4 | ABC transporter permease | 0.917 | 3 | 328 |
GO:0005886
GO:0071916 |
| AF-A0A2E8YG86-F1-model_v4 | ABC transporter permease | 0.9096 | 4 | 327 |
GO:0005886
GO:0055085 |
| AF-A0A5C4PQI6-F1-model_v4 | ABC transporter permease | 0.9052 | 2 | 328 |
GO:0005886
GO:0055085 |
| AF-A0A1Q3T0R9-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.9047 | 2 | 327 |
GO:0005886
GO:0055085 |
| AF-W0INH2-F1-model_v4 | deleted | 0.9044 | 2 | 324 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar