F446519

General Info

Members Datasets Scaffolds Average Seq Length
450 281 403 387

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10020588|rootH1_100205889
Length 346
Sequence MRPAIERLQGSLIREIANAGMGRADVLAFWFGESDEVTPELVRRAAIESLERGETFYSQNLGLPELREALAGYTSALHPAVDAGRVVVTSGGVNGLMDGAWTLDMDRLLAAVTPRTRMLVLNAPNNPTGWTLTRAEQQRILDHCRATGTWLLADEVYERLYFAPTANACAPSFQDIAAPGDRLVVAHSFSKSFLMTGWRLGWLVVPATLTDALGKLIEFNTSCTSVFTQRAALAALAHRDEITPRIVAHLQACRDTLVPLLAELPGVQVAVPRGGMYAFFRLDGFDDSLEVARRLVIEAGLGLAPGAAFAPEAAGWLRWCFAARDAGRLVEGVRRLRAWLAVNAAR

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221609 Acidovorax sp. Root217 Isolate Unclassified
7 2643221611 Acidovorax sp. Root219 Isolate Unclassified
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2738541277 Variovorax sp. GV051 Isolate Unclassified
13 2738541307 Variovorax sp. GV008 Isolate Unclassified
14 2738543012 Acidovorax sp. CF301 Isolate Unclassified
15 2738543013 Variovorax sp. BT01 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2816332133 Acidovorax radicis 2721A Isolate Unclassified
18 2818991446 Variovorax sp. 1180 Isolate Unclassified
19 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
20 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
21 2842677519 Variovorax sp. R-72495 Isolate Unclassified
22 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
23 2842733646 Variovorax sp. R-72446 Isolate Unclassified
24 2842747753 Variovorax sp. R-72060 Isolate Unclassified
25 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
26 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
27 2885198086 Variovorax sp. 679 Isolate Unclassified
28 2885211737 Variovorax sp. 553 Isolate Unclassified
29 2899924645 Variovorax sp. 369 Isolate Unclassified
30 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
31 2904456579 Variovorax sp. 2002 Isolate Unclassified
32 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
33 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
34 2928037797 Variovorax sp. 1126 Isolate Unclassified
35 2928044640 Variovorax sp. 1128 Isolate Unclassified
36 2928051484 Variovorax sp. 1133 Isolate Unclassified
37 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
38 2928070936 Variovorax gossypii 1167 Isolate Unclassified
39 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
40 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
41 2929520902 Variovorax beijingensis 502 Isolate Unclassified
42 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
43 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
44 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
45 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
46 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
47 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
48 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
49 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
50 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
51 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
52 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
53 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
54 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
55 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
58 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
59 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
60 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
61 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
62 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
63 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
64 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
65 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
66 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
67 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
68 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
69 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
70 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
75 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
76 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
176 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
197 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
198 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
199 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
200 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
203 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
204 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
205 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
206 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
207 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
208 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
263 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
266 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
267 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
268 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
269 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
270 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
275 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
276 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
277 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
278 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
281 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.56
Metatranscriptomes 0
Isolates 10.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 39.11
Nodule 0.89
Rhizoplane 2.44
Rhizosphere 43.33
Stem 0
Stem Tuber 0
Unclassified 14.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000051 3300002704 Bacteria 76772
2 JGI25156J39149_1000041 3300002705 Bacteria 106358
3 JGI25156J39149_1000196 3300002705 Bacteria 42272
4 JGI25154J39366_1000344 3300002738 Bacteria 26657
5 JGI25154J39366_1003154 3300002738 Bacteria 3658
6 JGI25157J39369_1000059 3300002741 Bacteria 106388
7 JGI25157J39369_1000091 3300002741 Bacteria 76837
8 JGI25152J39213_1013004 3300002773 Bacteria 1754
9 JGI25150J39212_1002497 3300002774 Bacteria 4555
10 JGI25159J45721_1001524 3300002987 Bacteria 9494
11 JGI25151J46595_10003323 3300003187 Bacteria 8921
12 JGI25151J46595_10006717 3300003187 Bacteria 5734
13 JGI25151J46595_10018814 3300003187 Bacteria 2953
14 rootH1_10021081 3300003316 Bacteria 6034
15 rootH1_10020588 3300003323 Bacteria 10393
16 JGI25160J50197_1000590 3300003354 Bacteria 20331
17 JGI25161J50226_1000035 3300003374 Bacteria 133666
18 JGI25161J50226_1003258 3300003374 Bacteria 3783
19 JGI25161J50226_1003988 3300003374 Bacteria 3203
20 Ga0055539_1000339 3300003752 Bacteria 21768
21 Ga0055533_1000197 3300003756 Bacteria 49410
22 Ga0055535_1000088 3300003761 Bacteria 102543
23 Ga0055535_1000442 3300003761 Bacteria 38340
24 Ga0055535_1000863 3300003761 Bacteria 21397
25 Ga0055542_1000052 3300003762 Bacteria 173583
26 Ga0055529_1000192 3300003763 Bacteria 83714
27 Ga0055526_1012147 3300003771 Bacteria 3789
28 Ga0055526_1016762 3300003771 Bacteria 2844
29 Ga0055537_1000735 3300003773 Bacteria 16784
30 Ga0055537_1006808 3300003773 Bacteria 2844
31 Ga0055524_1010153 3300003775 Bacteria 3769
32 Ga0055524_1015004 3300003775 Bacteria 2844
33 Ga0055536_1006032 3300003781 Bacteria 5751
34 Ga0055536_1011644 3300003781 Bacteria 3348
35 Ga0055534_1000042 3300003784 Bacteria 99433
36 Ga0055534_1000775 3300003784 Bacteria 15034
37 Ga0055528_1014886 3300003790 Bacteria 2844
38 Ga0055530_10002628 3300003791 Bacteria 11273
39 Ga0055530_10007195 3300003791 Bacteria 4750
40 Ga0055540_1002240 3300003792 Bacteria 10470
41 Ga0055540_1003645 3300003792 Bacteria 7335
42 Ga0055540_1005016 3300003792 Bacteria 5751
43 Ga0055540_1008652 3300003792 Bacteria 3637
44 Ga0055531_10001768 3300003794 Bacteria 15383
45 Ga0055531_10003980 3300003794 Bacteria 9165
46 Ga0055531_10013356 3300003794 Bacteria 3790
47 Ga0055543_1000829 3300004625 Bacteria 15064
48 Ga0055543_1005492 3300004625 Bacteria 3222
49 Ga0065165_1013032 3300005262 Bacteria 3334
50 Ga0065165_1014888 3300005262 Bacteria 2996
51 Ga0070676_10146601 3300005328 Bacteria 1507
52 Ga0070690_100006369 3300005330 Bacteria 6692
53 Ga0070680_100280668 3300005336 Bacteria 1411
54 Ga0068868_100107656 3300005338 Bacteria 2262
55 Ga0070660_100060296 3300005339 Bacteria 2944
56 Ga0070669_100018672 3300005353 Bacteria 4956
57 Ga0070675_100295435 3300005354 Bacteria 1426
58 Ga0070674_100130691 3300005356 Bacteria 1871
59 Ga0070673_100005079 3300005364 Bacteria 8396
60 Ga0070673_100241732 3300005364 Bacteria 1570
61 Ga0070659_100053815 3300005366 Bacteria 3169
62 Ga0070659_100073454 3300005366 Bacteria 2722
63 Ga0070662_100018984 3300005457 Bacteria 4660
64 Ga0070679_100032687 3300005530 Bacteria 5148
65 Ga0070665_100105623 3300005548 Bacteria 2818
66 Ga0070665_100309192 3300005548 Bacteria 1584
67 Ga0068855_100028696 3300005563 Bacteria 6658
68 Ga0068855_100130449 3300005563 Bacteria 2871
69 Ga0068857_100000902 3300005577 Bacteria 22439
70 Ga0068857_100071758 3300005577 Bacteria 3086
71 Ga0068856_100004506 3300005614 Bacteria 13850
72 Ga0068856_100122087 3300005614 Bacteria 2607
73 Ga0068852_100267855 3300005616 Bacteria 1643
74 Ga0068861_100006476 3300005719 Bacteria 7978
75 Ga0068863_100043308 3300005841 Bacteria 4274
76 Ga0068862_100038670 3300005844 Bacteria 4048
77 Ga0075365_10006403 3300006038 Bacteria 6479
78 Ga0075365_10007387 3300006038 Bacteria 6147
79 Ga0075365_10027379 3300006038 Bacteria 3627
80 Ga0075363_100054950 3300006048 Bacteria 2132
81 Ga0075362_10007750 3300006177 Bacteria 4079
82 Ga0075362_10014238 3300006177 Bacteria 3205
83 Ga0075362_10093875 3300006177 Bacteria 1395
84 Ga0075367_10029383 3300006178 Bacteria 3143
85 Ga0075366_10004734 3300006195 Bacteria 7331
86 Ga0075366_10025008 3300006195 Bacteria 3485
87 Ga0075366_10027615 3300006195 Bacteria 3330
88 Ga0075366_10065539 3300006195 Bacteria 2160
89 Ga0075366_10069902 3300006195 Bacteria 2090
90 Ga0075366_10091787 3300006195 Bacteria 1819
91 Ga0075370_10001737 3300006353 Bacteria 9699
92 Ga0075370_10002370 3300006353 Bacteria 8720
93 Ga0075370_10003267 3300006353 Bacteria 7685
94 Ga0075370_10006764 3300006353 Bacteria 5792
95 Ga0075370_10007450 3300006353 Bacteria 5575
96 Ga0068871_100076413 3300006358 Bacteria 2766
97 Ga0099826_10005614 3300006948 Bacteria 9022
98 Ga0105244_10002931 3300009036 Bacteria 12591
99 Ga0105240_10015282 3300009093 Bacteria 10447
100 Ga0105240_10046785 3300009093 Bacteria 5479
101 Ga0105245_10164458 3300009098 Bacteria 2108
102 Ga0105243_10007759 3300009148 Bacteria 8253
103 Ga0105243_10008148 3300009148 Bacteria 8047
104 Ga0105242_10007949 3300009176 Bacteria 8169
105 Ga0105248_10179135 3300009177 Bacteria 2389
106 Ga0105237_10147707 3300009545 Bacteria 2346
107 Ga0105237_10212475 3300009545 Bacteria 1934
108 Ga0105237_10346229 3300009545 Bacteria 1490
109 Ga0105246_10040500 3300011119 Bacteria 3145
110 Ga0157370_10104318 3300013104 Bacteria 2654
111 Ga0157369_10201222 3300013105 Bacteria 2090
112 Ga0163162_10076069 3300013306 Bacteria 3419
113 Ga0163162_10392220 3300013306 Bacteria 1521
114 Ga0182008_10004027 3300014497 Bacteria 8678
115 Ga0182006_1004411 3300015261 Bacteria 6951
116 Ga0182007_10016309 3300015262 Bacteria 2743
117 Ga0182005_1013466 3300015265 Bacteria 2300
118 Ga0183362_10003 3300015683 Bacteria 977584
119 Ga0163161_10016616 3300017792 Bacteria 5139
120 Ga0209435_100062 3300025206 Bacteria 77288
121 Ga0209674_100231 3300025226 Bacteria 49462
122 Ga0209672_102271 3300025228 Bacteria 4944
123 Ga0209672_104727 3300025228 Bacteria 2471
124 Ga0209147_100433 3300025229 Bacteria 26866
125 Ga0209563_100061 3300025230 Bacteria 274295
126 Ga0207427_101444 3300025231 Bacteria 8568
127 Ga0209258_100009 3300025242 Bacteria 996276
128 Ga0209258_100025 3300025242 Bacteria 534777
129 Ga0209258_101203 3300025242 Bacteria 10244
130 Ga0207425_1001093 3300025245 Bacteria 12310
131 Ga0207425_1007176 3300025245 Bacteria 2970
132 Ga0209646_1000001 3300025246 Bacteria 3092932
133 Ga0209646_1000112 3300025246 Bacteria 153075
134 Ga0209026_1000038 3300025250 Bacteria 281227
135 Ga0209026_1000224 3300025250 Bacteria 77298
136 Ga0209677_100195 3300025253 Bacteria 49462
137 Ga0209677_101631 3300025253 Bacteria 9458
138 Ga0209148_1000007 3300025254 Bacteria 1592273
139 Ga0209148_1002541 3300025254 Bacteria 6088
140 Ga0209759_1000013 3300025256 Bacteria 399300
141 Ga0209759_1000031 3300025256 Bacteria 281227
142 Ga0209759_1001341 3300025256 Bacteria 14355
143 Ga0209759_1003770 3300025256 Bacteria 5913
144 Ga0209129_1000083 3300025258 Bacteria 183270
145 Ga0209129_1003485 3300025258 Bacteria 6799
146 Ga0209565_1000083 3300025263 Bacteria 154007
147 Ga0209565_1000642 3300025263 Bacteria 22654
148 Ga0209565_1001252 3300025263 Bacteria 11858
149 Ga0209455_1000112 3300025272 Bacteria 186237
150 Ga0209673_1000089 3300025273 Bacteria 202240
151 Ga0209673_1000323 3300025273 Bacteria 87588
152 Ga0209673_1001307 3300025273 Bacteria 25210
153 Ga0209130_1000042 3300025284 Bacteria 257581
154 Ga0209130_1001189 3300025284 Bacteria 18564
155 Ga0209130_1002583 3300025284 Bacteria 8811
156 Ga0209675_1000081 3300025291 Bacteria 154007
157 Ga0209675_1000605 3300025291 Bacteria 25733
158 Ga0209675_1003458 3300025291 Bacteria 7490
159 Ga0209675_1011278 3300025291 Bacteria 2975
160 Ga0209676_1000004 3300025292 Bacteria 1138360
161 Ga0209676_1001501 3300025292 Bacteria 21334
162 Ga0209676_1001902 3300025292 Bacteria 17002
163 Ga0209676_1005497 3300025292 Bacteria 6596
164 Ga0209676_1015724 3300025292 Bacteria 2771
165 Ga0209025_1000133 3300025294 Bacteria 195885
166 Ga0209025_1000155 3300025294 Bacteria 169116
167 Ga0209025_1001314 3300025294 Bacteria 33818
168 Ga0209025_1004870 3300025294 Bacteria 11318
169 Ga0209025_1009560 3300025294 Bacteria 6732
170 Ga0209025_1019664 3300025294 Bacteria 3742
171 Ga0209025_1024823 3300025294 Bacteria 3079
172 Ga0209025_1070981 3300025294 Bacteria 1237
173 Ga0209564_1000323 3300025295 Bacteria 93122
174 Ga0209564_1000332 3300025295 Bacteria 91674
175 Ga0209758_1000132 3300025297 Bacteria 183273
176 Ga0209758_1004959 3300025297 Bacteria 10660
177 Ga0209758_1007028 3300025297 Bacteria 7819
178 Ga0209050_1000002 3300025298 Bacteria 1792849
179 Ga0209050_1001770 3300025298 Bacteria 21335
180 Ga0209050_1012600 3300025298 Bacteria 3857
181 Ga0209050_1033956 3300025298 Bacteria 1536
182 Ga0209256_1000375 3300025299 Bacteria 71601
183 Ga0209256_1000385 3300025299 Bacteria 70163
184 Ga0207426_1000097 3300025302 Bacteria 265930
185 Ga0207426_1000323 3300025302 Bacteria 91662
186 Ga0207426_1000584 3300025302 Bacteria 48547
187 Ga0209051_1000002 3300025303 Bacteria 1631846
188 Ga0209051_1000749 3300025303 Bacteria 34903
189 Ga0209051_1000792 3300025303 Bacteria 33275
190 Ga0209051_1003466 3300025303 Bacteria 10327
191 Ga0209051_1005133 3300025303 Bacteria 7770
192 Ga0209051_1007547 3300025303 Bacteria 5926
193 Ga0209051_1011722 3300025303 Bacteria 4304
194 Ga0209051_1013289 3300025303 Bacteria 3927
195 Ga0209257_1000002 3300025304 Bacteria 1767052
196 Ga0209257_1000361 3300025304 Bacteria 92239
197 Ga0209257_1000396 3300025304 Bacteria 86000
198 Ga0209257_1019966 3300025304 Bacteria 2497
199 Ga0209257_1021142 3300025304 Bacteria 2375
200 Ga0207655_1001053 3300025728 Bacteria 27547
201 Ga0207695_10017761 3300025913 Bacteria 8256
202 Ga0207695_10073312 3300025913 Bacteria 3489
203 Ga0207695_10192397 3300025913 Bacteria 1957
204 Ga0207671_10023046 3300025914 Bacteria 4699
205 Ga0207671_10100366 3300025914 Bacteria 2191
206 Ga0207657_10016411 3300025919 Bacteria 7144
207 Ga0207657_10030291 3300025919 Bacteria 4912
208 Ga0207649_10173086 3300025920 Bacteria 1505
209 Ga0207652_10213259 3300025921 Bacteria 1739
210 Ga0207681_10017065 3300025923 Bacteria 4555
211 Ga0207690_10033821 3300025932 Bacteria 3290
212 Ga0207690_10053254 3300025932 Bacteria 2714
213 Ga0207706_10049181 3300025933 Bacteria 3727
214 Ga0207706_10064461 3300025933 Bacteria 3226
215 Ga0207709_10001284 3300025935 Bacteria 17904
216 Ga0207709_10001306 3300025935 Bacteria 17744
217 Ga0207709_10019210 3300025935 Bacteria 3837
218 Ga0207691_10135360 3300025940 Bacteria 2173
219 Ga0207711_10054305 3300025941 Bacteria 3438
220 Ga0207689_10150632 3300025942 Bacteria 1917
221 Ga0207667_10006725 3300025949 Bacteria 13887
222 Ga0207667_10188835 3300025949 Bacteria 2114
223 Ga0207651_10038088 3300025960 Bacteria 3156
224 Ga0207668_10224750 3300025972 Bacteria 1510
225 Ga0207677_10024235 3300026023 Bacteria 3766
226 Ga0207677_10045218 3300026023 Bacteria 2939
227 Ga0207639_10269576 3300026041 Bacteria 1493
228 Ga0207702_10003446 3300026078 Bacteria 14446
229 Ga0207674_10299378 3300026116 Bacteria 1557
230 Ga0207683_10004058 3300026121 Bacteria 12652
231 Ga0209282_1003274 3300027666 Bacteria 9597
232 Ga0209282_1113100 3300027666 Bacteria 1373
233 Ga0268266_10272996 3300028379 Bacteria 1570
234 Ga0268265_10017018 3300028380 Bacteria 5007
235 Ga0307515_10000195 3300028794 Bacteria 148138
236 Ga0314311_1131734 3300030733 Bacteria 5812
237 Ga0316178_1055661 3300030735 Bacteria 9641
238 Ga0316183_1036534 3300030742 Bacteria 10077
239 Ga0265332_10006117 3300031238 Bacteria 5496
240 Ga0265327_10001163 3300031251 Bacteria 35739
241 Ga0265327_10035813 3300031251 Bacteria 2738
242 Ga0307408_100012339 3300031548 Bacteria 5659
243 Ga0307408_100015768 3300031548 Bacteria 5035
244 Ga0307408_100044972 3300031548 Bacteria 3150
245 Ga0307408_100174492 3300031548 Bacteria 1719
246 Ga0265314_10001258 3300031711 Bacteria 28871
247 Ga0307516_10002952 3300031730 Bacteria 22263
248 Ga0307405_10016895 3300031731 Bacteria 3991
249 Ga0307405_10018815 3300031731 Bacteria 3819
250 Ga0307412_10004182 3300031911 Bacteria 8046
251 Ga0307412_10017954 3300031911 Bacteria 4244
252 Ga0307412_10074234 3300031911 Bacteria 2329
253 Ga0307414_10076079 3300032004 Bacteria 2438
254 Ga0307414_10371928 3300032004 Bacteria 1233
255 Ga0307411_10029530 3300032005 Bacteria 3349
256 Ga0395899_0021057 3300037312 Bacteria 4945
257 Ga0395899_0159367 3300037312 Bacteria 1595
258 Ga0395900_0011346 3300037418 Bacteria 9116
259 Ga0395900_0091044 3300037418 Bacteria 3134
260 Ga0395900_0147774 3300037418 Bacteria 2403
261 Ga0395898_0018034 3300037466 Bacteria 7201
262 Ga0395898_0055656 3300037466 Bacteria 3858
263 Ga0395898_0175131 3300037466 Bacteria 2050
264 Ga0395905_0000125 3300037471 Bacteria 126341
265 Ga0395905_0002940 3300037471 Bacteria 18526
266 Ga0395905_0013637 3300037471 Bacteria 7786
267 Ga0395905_0066007 3300037471 Bacteria 3388
268 Ga0395905_0103374 3300037471 Bacteria 2674
269 Ga0395901_0009037 3300038443 Bacteria 10087
270 Ga0395901_0040847 3300038443 Bacteria 4805
271 Ga0395901_0043223 3300038443 Bacteria 4674
272 Ga0439436_0001207 3300041404 Bacteria 7357
273 Ga0439436_0004496 3300041404 Bacteria 4275
274 Ga0439439_0003501 3300041406 Bacteria 3467
275 Ga0439466_0018217 3300041411 Bacteria 2521
276 Ga0439466_0028834 3300041411 Bacteria 1913
277 Ga0439465_0001354 3300041413 Bacteria 7884
278 Ga0439465_0010342 3300041413 Bacteria 2934
279 Ga0451793_1147341 3300041452 Bacteria 2240
280 Ga0439431_0000735 3300041997 Bacteria 7079
281 Ga0439431_0022875 3300041997 Bacteria 1509
282 Ga0439431_0024314 3300041997 Bacteria 1473
283 Ga0439433_0000346 3300041999 Bacteria 8195
284 Ga0439442_010529 3300042002 Bacteria 1876
285 Ga0439445_0013058 3300042004 Bacteria 2006
286 Ga0439432_000644 3300042006 Bacteria 13066
287 Ga0439449_0000752 3300042007 Bacteria 12455
288 Ga0439449_0002024 3300042007 Bacteria 7979
289 Ga0439449_0002886 3300042007 Bacteria 6686
290 Ga0439449_0003127 3300042007 Bacteria 6439
291 Ga0439452_019822 3300042010 Bacteria 1772
292 Ga0439457_009018 3300042014 Bacteria 2333
293 Ga0439457_009310 3300042014 Bacteria 2291
294 Ga0439462_0004486 3300042015 Bacteria 3409
295 Ga0450911_000104 3300042115 Bacteria 34662
296 Ga0450891_002269 3300042129 Bacteria 1944
297 Ga0450906_000342 3300042145 Bacteria 9495
298 Ga0439446_0010388 3300042156 Bacteria 2505
299 Ga0451577_0111971 3300042876 Bacteria 2442
300 Ga0453683_0001050 3300044673 Bacteria 25682
301 Ga0466966_0013826 3300044684 Bacteria 5341
302 Ga0466961_0021639 3300044693 Bacteria 4137
303 Ga0466961_0062076 3300044693 Bacteria 2375
304 Ga0453684_0206523 3300044712 Bacteria 2286
305 Ga0451576_0048896 3300045051 Bacteria 4439
306 Ga0466967_0153554 3300045976 Bacteria 2154
307 Ga0495627_025031 3300046453 Bacteria 1939
308 Ga0495638_0031889 3300046460 Bacteria 3383
309 Ga0495650_0005734 3300046471 Bacteria 7933
310 Ga0495583_0004855 3300046506 Bacteria 9395
311 Ga0495610_0016141 3300046512 Bacteria 4314
312 Ga0495616_0003541 3300046513 Bacteria 9977
313 Ga0495631_0005661 3300046518 Bacteria 6518
314 Ga0495637_0001633 3300046520 Bacteria 12985
315 Ga0495652_0107587 3300046529 Bacteria 2250
316 Ga0495621_0053333 3300046539 Bacteria 1451
317 Ga0495656_0000128 3300046615 Bacteria 28618
318 Ga0495668_0025060 3300046616 Bacteria 3391
319 Ga0495668_0025270 3300046616 Bacteria 3376
320 Ga0495625_0001775 3300046660 Bacteria 24896
321 Ga0495625_0023799 3300046660 Bacteria 4674
322 Ga0495625_0070415 3300046660 Bacteria 2455
323 Ga0495588_0046851 3300046674 Bacteria 2218
324 Ga0495658_0089672 3300046683 Bacteria 1819
325 Ga0495669_0048772 3300046684 Bacteria 1895
326 Ga0495671_0017760 3300046692 Bacteria 3784
327 Ga0495649_0000941 3300046694 Bacteria 22970
328 Ga0495589_0025718 3300046794 Bacteria 2985
329 Ga0495600_0145898 3300046809 Bacteria 1534
330 Ga0495676_0002146 3300047321 Bacteria 17446
331 Ga0495686_0017434 3300047472 Bacteria 4838
332 Ga0496101_0039190 3300048904 Bacteria 3368
333 Ga0496102_0018281 3300048905 Bacteria 6158
334 Ga0496104_0081266 3300048907 Bacteria 3090
335 Ga0496105_0074382 3300048908 Bacteria 2806
336 Ga0496106_0074437 3300048909 Bacteria 2600
337 Ga0496108_0171157 3300048911 Bacteria 1879
338 Ga0496109_0260612 3300048912 Bacteria 1633
339 Ga0496117_0071452 3300048920 Bacteria 2325
340 Ga0496118_0010770 3300048921 Bacteria 9013
341 Ga0496122_0002216 3300048925 Bacteria 28363
342 Ga0496122_0084227 3300048925 Bacteria 2200
343 Ga0496123_0000057 3300048926 Bacteria 228608
344 Ga0496124_0019421 3300048927 Bacteria 6324
345 Ga0496124_0033600 3300048927 Bacteria 4511
346 Ga0496124_0103444 3300048927 Bacteria 2303
347 Ga0496124_0103541 3300048927 Bacteria 2302
348 Ga0496125_0009493 3300048928 Bacteria 9987
349 Ga0496125_0013204 3300048928 Bacteria 8136
350 Ga0496125_0016510 3300048928 Bacteria 7085
351 Ga0496125_0027736 3300048928 Bacteria 5126
352 Ga0496126_0055557 3300048929 Bacteria 3582
353 Ga0496126_0114368 3300048929 Bacteria 2348
354 Ga0501047_0077044 3300049581 Bacteria 3208
355 Ga0501262_000077 3300049759 Bacteria 12024
356 Ga0501035_0059805 3300049822 Bacteria 3393
357 Ga0501035_0304906 3300049822 Bacteria 1341
358 Ga0501044_0056259 3300049823 Bacteria 4038
359 nmdc:mga03683_13652_c1 3300050489 Bacteria 2994
360 nmdc:mga03n38_13729_c1 3300050490 Bacteria 3085
361 nmdc:mga03n38_45264_c1 3300050490 Bacteria 1937
362 nmdc:mga00v17_205081_c1 3300050491 Bacteria 1275
363 nmdc:mga00v17_93082_c1 3300050491 Bacteria 1895
364 nmdc:mga0yw44_11971_c1 3300050492 Bacteria 4503
365 nmdc:mga0yw44_8069_c1 3300050492 Bacteria 5224
366 nmdc:mga0k408_136380_c1 3300050493 Bacteria 1458
367 nmdc:mga0k408_16554_c1 3300050493 Bacteria 4092
368 nmdc:mga0k408_31217_c1 3300050493 Bacteria 3041
369 nmdc:mga0k408_57656_c1 3300050493 Bacteria 2255
370 nmdc:mga0k408_9766_c1 3300050493 Bacteria 5181
371 nmdc:mga07m45_26052_c1 3300050496 Bacteria 3212
372 nmdc:mga07m45_2927_c1 3300050496 Bacteria 8104
373 nmdc:mga07m45_4895_c1 3300050496 Bacteria 6596
374 nmdc:mga07m45_9304_c1 3300050496 Bacteria 5091
375 Ga0500610_0021530 3300053079 Bacteria 3165
376 Ga0500610_0045827 3300053079 Bacteria 2269
377 Ga0500635_0000118 3300053080 Bacteria 46504
378 Ga0500635_0029055 3300053080 Bacteria 1771
379 Ga0500651_0000637 3300053093 Bacteria 17435
380 Ga0500562_004156 3300053108 Bacteria 3652
381 Ga0500571_004453 3300053110 Bacteria 7361
382 Ga0500593_001809 3300053117 Bacteria 7683
383 Ga0500593_004609 3300053117 Bacteria 5363
384 Ga0500607_004904 3300053121 Bacteria 8949
385 Ga0500607_029842 3300053121 Bacteria 3010
386 Ga0500608_009959 3300053122 Bacteria 4061
387 Ga0500618_004521 3300053125 Bacteria 4409
388 Ga0500655_000509 3300053133 Bacteria 7848
389 Ga0500658_0000871 3300053134 Bacteria 12392
390 Ga0500658_0001437 3300053134 Bacteria 9551
391 Ga0500559_0002519 3300053136 Bacteria 9412
392 Ga0500559_0005008 3300053136 Bacteria 6149
393 Ga0500559_0012182 3300053136 Bacteria 3660
394 Ga0500574_000058 3300053141 Bacteria 12816
395 Ga0500627_0009456 3300053158 Bacteria 3510
396 Ga0500634_0034930 3300053161 Bacteria 2739
397 Ga0500638_016629 3300053162 Bacteria 3400
398 Ga0500636_0026577 3300053177 Bacteria 3419
399 Ga0500645_002692 3300053730 Bacteria 7728
400 Ga0500645_003744 3300053730 Bacteria 6062
401 Ga0500661_005454 3300055283 Bacteria 2376
402 Ga0500661_011000 3300055283 Bacteria 1642
403 Ga0590075_018869 3300059424 Bacteria 1709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10025008 Ga0075366_100250083 329
2 3300050493 nmdc:mga0k408_31217_c1 nmdc:mga0k408_31217_c1_54_1214 329
3 3300003316 rootH1_10021081 rootH1_100210812 331
4 3300003323 rootH1_10020588 rootH1_100205889 334
5 3300003752 Ga0055539_1000339 Ga0055539_10003395 339
6 3300003756 Ga0055533_1000197 Ga0055533_100019731 339
7 3300025226 Ga0209674_100231 Ga0209674_10023118 339
8 3300025230 Ga0209563_100061 Ga0209563_100061246 339
9 3300025253 Ga0209677_100195 Ga0209677_10019518 339
10 3300005330 Ga0070690_100006369 Ga0070690_1000063696 341
11 3300005719 Ga0068861_100006476 Ga0068861_1000064764 341
12 3300002705 JGI25156J39149_1000041 JGI25156J39149_100004144 365
13 3300002738 JGI25154J39366_1003154 JGI25154J39366_10031542 365
14 3300002741 JGI25157J39369_1000059 JGI25157J39369_100005974 365
15 3300005577 Ga0068857_100000902 Ga0068857_10000090217 365
16 3300005614 Ga0068856_100004506 Ga0068856_1000045064 365
17 3300025246 Ga0209646_1000112 Ga0209646_100011244 365
18 3300025250 Ga0209026_1000038 Ga0209026_1000038265 365
19 3300025253 Ga0209677_101631 Ga0209677_1016316 365
20 3300025256 Ga0209759_1000031 Ga0209759_1000031265 365
21 3300025949 Ga0207667_10188835 Ga0207667_101888352 365
22 3300026078 Ga0207702_10003446 Ga0207702_1000344610 365
23 3300046684 Ga0495669_0048772 Ga0495669_0048772_11_1111 366
24 3300009093 Ga0105240_10046785 Ga0105240_100467853 369
25 3300025913 Ga0207695_10192397 Ga0207695_101923971 369
26 3300037312 Ga0395899_0159367 Ga0395899_0159367_281_1432 372
27 3300037418 Ga0395900_0011346 Ga0395900_0011346_7862_9013 372
28 3300037466 Ga0395898_0055656 Ga0395898_0055656_2078_3229 372
29 3300037471 Ga0395905_0002940 Ga0395905_0002940_2063_3214 372
30 3300037471 Ga0395905_0066007 Ga0395905_0066007_2057_3208 372
31 3300044693 Ga0466961_0062076 Ga0466961_0062076_1129_2280 372
32 3300049822 Ga0501035_0304906 Ga0501035_0304906_61_1212 372
33 3300006177 Ga0075362_10093875 Ga0075362_100938752 373
34 3300006195 Ga0075366_10004734 Ga0075366_100047343 373
35 3300006195 Ga0075366_10065539 Ga0075366_100655393 373
36 3300006353 Ga0075370_10001737 Ga0075370_100017373 373
37 3300009176 Ga0105242_10007949 Ga0105242_100079498 373
38 3300025294 Ga0209025_1070981 Ga0209025_10709811 373
39 3300044673 Ga0453683_0001050 Ga0453683_0001050_3949_5103 373
40 3300045051 Ga0451576_0048896 Ga0451576_0048896_3214_4368 373
41 3300045976 Ga0466967_0153554 Ga0466967_0153554_477_1631 373
42 3300049822 Ga0501035_0059805 Ga0501035_0059805_1953_3107 373
43 3300049823 Ga0501044_0056259 Ga0501044_0056259_84_1238 373
44 3300050490 nmdc:mga03n38_13729_c1 nmdc:mga03n38_13729_c1_907_2061 373
45 3300050493 nmdc:mga0k408_57656_c1 nmdc:mga0k408_57656_c1_601_1758 373
46 3300050493 nmdc:mga0k408_9766_c1 nmdc:mga0k408_9766_c1_324_1478 373
47 3300050496 nmdc:mga07m45_9304_c1 nmdc:mga07m45_9304_c1_1890_3044 373
48 iso_pu_bacteria 2842718218 2842719089 373
49 iso_pu_bacteria 2974320154 2974324272 373
50 3300003773 Ga0055537_1000735 Ga0055537_10007353 374
51 3300003784 Ga0055534_1000042 Ga0055534_100004212 374
52 3300003792 Ga0055540_1008652 Ga0055540_10086522 374
53 3300003794 Ga0055531_10003980 Ga0055531_100039803 374
54 3300005328 Ga0070676_10146601 Ga0070676_101466012 374
55 3300005338 Ga0068868_100107656 Ga0068868_1001076563 374
56 3300005354 Ga0070675_100295435 Ga0070675_1002954351 374
57 3300005356 Ga0070674_100130691 Ga0070674_1001306911 374
58 3300005364 Ga0070673_100241732 Ga0070673_1002417321 374
59 3300006038 Ga0075365_10007387 Ga0075365_100073874 374
60 3300006353 Ga0075370_10006764 Ga0075370_100067641 374
61 3300006948 Ga0099826_10005614 Ga0099826_100056148 374
62 3300015683 Ga0183362_10003 Ga0183362_10003208 374
63 3300025263 Ga0209565_1000083 Ga0209565_100008313 374
64 3300025273 Ga0209673_1000323 Ga0209673_100032310 374
65 3300025291 Ga0209675_1000081 Ga0209675_100008113 374
66 3300025303 Ga0209051_1000792 Ga0209051_100079219 374
67 3300025304 Ga0209257_1000396 Ga0209257_100039624 374
68 3300026023 Ga0207677_10024235 Ga0207677_100242353 374
69 3300027666 Ga0209282_1003274 Ga0209282_10032743 374
70 3300027666 Ga0209282_1113100 Ga0209282_11131001 374
71 3300028794 Ga0307515_10000195 Ga0307515_10000195109 374
72 3300030733 Ga0314311_1131734 Ga0314311_11317345 374
73 3300030735 Ga0316178_1055661 Ga0316178_10556616 374
74 3300030742 Ga0316183_1036534 Ga0316183_10365342 374
75 3300031911 Ga0307412_10074234 Ga0307412_100742342 374
76 3300032004 Ga0307414_10076079 Ga0307414_100760792 374
77 3300032004 Ga0307414_10371928 Ga0307414_103719281 374
78 3300032005 Ga0307411_10029530 Ga0307411_100295303 374
79 3300037471 Ga0395905_0103374 Ga0395905_0103374_969_2126 374
80 3300041411 Ga0439466_0018217 Ga0439466_0018217_1035_2192 374
81 3300041413 Ga0439465_0010342 Ga0439465_0010342_944_2101 374
82 3300041997 Ga0439431_0000735 Ga0439431_0000735_105_1262 374
83 3300041997 Ga0439431_0024314 Ga0439431_0024314_78_1235 374
84 3300042007 Ga0439449_0003127 Ga0439449_0003127_470_1627 374
85 3300042014 Ga0439457_009310 Ga0439457_009310_760_1917 374
86 3300042145 Ga0450906_000342 Ga0450906_000342_2242_3399 374
87 3300042876 Ga0451577_0111971 Ga0451577_0111971_322_1479 374
88 3300044712 Ga0453684_0206523 Ga0453684_0206523_234_1391 374
89 3300046660 Ga0495625_0001775 Ga0495625_0001775_9613_10770 374
90 3300048928 Ga0496125_0013204 Ga0496125_0013204_2699_3856 374
91 3300048929 Ga0496126_0055557 Ga0496126_0055557_1501_2658 374
92 3300049759 Ga0501262_000077 Ga0501262_000077_7425_8582 374
93 3300050491 nmdc:mga00v17_93082_c1 nmdc:mga00v17_93082_c1_361_1518 374
94 3300050492 nmdc:mga0yw44_11971_c1 nmdc:mga0yw44_11971_c1_493_1650 374
95 3300050496 nmdc:mga07m45_2927_c1 nmdc:mga07m45_2927_c1_6738_7895 374
96 3300053125 Ga0500618_004521 Ga0500618_004521_3020_4177 374
97 iso_pu_bacteria 2842677519 2842681802 374
98 iso_pu_bacteria 2885192300 2885196092 374
99 iso_pu_bacteria 2919462493 2919463955 374
100 iso_pu_bacteria 2945945610 2945946765 374
101 3300002773 JGI25152J39213_1013004 JGI25152J39213_10130042 375
102 3300002774 JGI25150J39212_1002497 JGI25150J39212_10024974 375
103 3300003187 JGI25151J46595_10003323 JGI25151J46595_100033237 375
104 3300003374 JGI25161J50226_1003258 JGI25161J50226_10032582 375
105 3300003374 JGI25161J50226_1003988 JGI25161J50226_10039882 375
106 3300003761 Ga0055535_1000442 Ga0055535_100044218 375
107 3300003761 Ga0055535_1000863 Ga0055535_100086319 375
108 3300003762 Ga0055542_1000052 Ga0055542_1000052134 375
109 3300003771 Ga0055526_1012147 Ga0055526_10121473 375
110 3300003771 Ga0055526_1016762 Ga0055526_10167622 375
111 3300003773 Ga0055537_1006808 Ga0055537_10068082 375
112 3300003775 Ga0055524_1010153 Ga0055524_10101533 375
113 3300003775 Ga0055524_1015004 Ga0055524_10150042 375
114 3300003781 Ga0055536_1006032 Ga0055536_10060322 375
115 3300003781 Ga0055536_1011644 Ga0055536_10116442 375
116 3300003790 Ga0055528_1014886 Ga0055528_10148862 375
117 3300003791 Ga0055530_10002628 Ga0055530_100026284 375
118 3300003791 Ga0055530_10007195 Ga0055530_100071955 375
119 3300003792 Ga0055540_1002240 Ga0055540_10022403 375
120 3300003792 Ga0055540_1003645 Ga0055540_10036457 375
121 3300003792 Ga0055540_1005016 Ga0055540_10050162 375
122 3300003794 Ga0055531_10001768 Ga0055531_100017687 375
123 3300003794 Ga0055531_10013356 Ga0055531_100133562 375
124 3300004625 Ga0055543_1005492 Ga0055543_10054922 375
125 3300005262 Ga0065165_1013032 Ga0065165_10130322 375
126 3300005262 Ga0065165_1014888 Ga0065165_10148882 375
127 3300005339 Ga0070660_100060296 Ga0070660_1000602962 375
128 3300005364 Ga0070673_100005079 Ga0070673_1000050793 375
129 3300005366 Ga0070659_100053815 Ga0070659_1000538152 375
130 3300005366 Ga0070659_100073454 Ga0070659_1000734542 375
131 3300005457 Ga0070662_100018984 Ga0070662_1000189843 375
132 3300005548 Ga0070665_100309192 Ga0070665_1003091922 375
133 3300005563 Ga0068855_100130449 Ga0068855_1001304495 375
134 3300005577 Ga0068857_100071758 Ga0068857_1000717581 375
135 3300005614 Ga0068856_100122087 Ga0068856_1001220873 375
136 3300005616 Ga0068852_100267855 Ga0068852_1002678551 375
137 3300005841 Ga0068863_100043308 Ga0068863_1000433083 375
138 3300005844 Ga0068862_100038670 Ga0068862_1000386702 375
139 3300006038 Ga0075365_10027379 Ga0075365_100273794 375
140 3300006177 Ga0075362_10014238 Ga0075362_100142382 375
141 3300006195 Ga0075366_10069902 Ga0075366_100699022 375
142 3300006353 Ga0075370_10003267 Ga0075370_100032673 375
143 3300006353 Ga0075370_10007450 Ga0075370_100074502 375
144 3300006358 Ga0068871_100076413 Ga0068871_1000764132 375
145 3300009036 Ga0105244_10002931 Ga0105244_100029316 375
146 3300009098 Ga0105245_10164458 Ga0105245_101644582 375
147 3300009148 Ga0105243_10007759 Ga0105243_100077598 375
148 3300009148 Ga0105243_10008148 Ga0105243_100081485 375
149 3300009177 Ga0105248_10179135 Ga0105248_101791353 375
150 3300009545 Ga0105237_10212475 Ga0105237_102124752 375
151 3300009545 Ga0105237_10346229 Ga0105237_103462291 375
152 3300011119 Ga0105246_10040500 Ga0105246_100405002 375
153 3300013104 Ga0157370_10104318 Ga0157370_101043182 375
154 3300013105 Ga0157369_10201222 Ga0157369_102012221 375
155 3300013306 Ga0163162_10076069 Ga0163162_100760692 375
156 3300015261 Ga0182006_1004411 Ga0182006_10044111 375
157 3300015262 Ga0182007_10016309 Ga0182007_100163092 375
158 3300015265 Ga0182005_1013466 Ga0182005_10134662 375
159 3300017792 Ga0163161_10016616 Ga0163161_100166162 375
160 3300025228 Ga0209672_102271 Ga0209672_1022713 375
161 3300025229 Ga0209147_100433 Ga0209147_10043322 375
162 3300025242 Ga0209258_100009 Ga0209258_10000931 375
163 3300025245 Ga0207425_1001093 Ga0207425_10010936 375
164 3300025254 Ga0209148_1000007 Ga0209148_100000731 375
165 3300025256 Ga0209759_1003770 Ga0209759_10037703 375
166 3300025258 Ga0209129_1000083 Ga0209129_1000083131 375
167 3300025258 Ga0209129_1003485 Ga0209129_10034856 375
168 3300025263 Ga0209565_1000642 Ga0209565_10006423 375
169 3300025273 Ga0209673_1000089 Ga0209673_1000089153 375
170 3300025273 Ga0209673_1001307 Ga0209673_100130713 375
171 3300025284 Ga0209130_1001189 Ga0209130_100118915 375
172 3300025284 Ga0209130_1002583 Ga0209130_10025832 375
173 3300025291 Ga0209675_1003458 Ga0209675_10034583 375
174 3300025292 Ga0209676_1000004 Ga0209676_1000004478 375
175 3300025292 Ga0209676_1001501 Ga0209676_100150113 375
176 3300025292 Ga0209676_1001902 Ga0209676_10019023 375
177 3300025292 Ga0209676_1015724 Ga0209676_10157242 375
178 3300025294 Ga0209025_1000155 Ga0209025_1000155151 375
179 3300025294 Ga0209025_1001314 Ga0209025_10013147 375
180 3300025294 Ga0209025_1004870 Ga0209025_10048704 375
181 3300025294 Ga0209025_1019664 Ga0209025_10196642 375
182 3300025295 Ga0209564_1000323 Ga0209564_100032330 375
183 3300025295 Ga0209564_1000332 Ga0209564_100033229 375
184 3300025297 Ga0209758_1000132 Ga0209758_1000132131 375
185 3300025297 Ga0209758_1004959 Ga0209758_10049593 375
186 3300025298 Ga0209050_1000002 Ga0209050_1000002988 375
187 3300025298 Ga0209050_1001770 Ga0209050_100177013 375
188 3300025298 Ga0209050_1012600 Ga0209050_10126003 375
189 3300025299 Ga0209256_1000375 Ga0209256_10003757 375
190 3300025299 Ga0209256_1000385 Ga0209256_10003856 375
191 3300025302 Ga0207426_1000323 Ga0207426_100032359 375
192 3300025302 Ga0207426_1000584 Ga0207426_10005847 375
193 3300025303 Ga0209051_1000002 Ga0209051_1000002757 375
194 3300025303 Ga0209051_1000749 Ga0209051_10007498 375
195 3300025303 Ga0209051_1003466 Ga0209051_10034663 375
196 3300025303 Ga0209051_1005133 Ga0209051_10051333 375
197 3300025303 Ga0209051_1013289 Ga0209051_10132893 375
198 3300025304 Ga0209257_1000002 Ga0209257_1000002898 375
199 3300025304 Ga0209257_1000361 Ga0209257_100036182 375
200 3300025728 Ga0207655_1001053 Ga0207655_100105315 375
201 3300025914 Ga0207671_10023046 Ga0207671_100230464 375
202 3300025919 Ga0207657_10030291 Ga0207657_100302911 375
203 3300025920 Ga0207649_10173086 Ga0207649_101730861 375
204 3300025932 Ga0207690_10033821 Ga0207690_100338213 375
205 3300025932 Ga0207690_10053254 Ga0207690_100532542 375
206 3300025933 Ga0207706_10049181 Ga0207706_100491813 375
207 3300025933 Ga0207706_10064461 Ga0207706_100644612 375
208 3300025935 Ga0207709_10001284 Ga0207709_1000128413 375
209 3300025935 Ga0207709_10001306 Ga0207709_100013067 375
210 3300025935 Ga0207709_10019210 Ga0207709_100192104 375
211 3300025941 Ga0207711_10054305 Ga0207711_100543052 375
212 3300025949 Ga0207667_10006725 Ga0207667_1000672512 375
213 3300025960 Ga0207651_10038088 Ga0207651_100380882 375
214 3300026023 Ga0207677_10045218 Ga0207677_100452181 375
215 3300026041 Ga0207639_10269576 Ga0207639_102695761 375
216 3300026116 Ga0207674_10299378 Ga0207674_102993782 375
217 3300026121 Ga0207683_10004058 Ga0207683_100040587 375
218 3300028379 Ga0268266_10272996 Ga0268266_102729962 375
219 3300028380 Ga0268265_10017018 Ga0268265_100170184 375
220 3300031238 Ga0265332_10006117 Ga0265332_100061172 375
221 3300031548 Ga0307408_100015768 Ga0307408_1000157683 375
222 3300031711 Ga0265314_10001258 Ga0265314_1000125814 375
223 3300031731 Ga0307405_10018815 Ga0307405_100188153 375
224 3300031911 Ga0307412_10004182 Ga0307412_100041822 375
225 3300037418 Ga0395900_0147774 Ga0395900_0147774_453_1613 375
226 3300037471 Ga0395905_0000125 Ga0395905_0000125_116343_117503 375
227 3300042007 Ga0439449_0002024 Ga0439449_0002024_1743_2903 375
228 3300042015 Ga0439462_0004486 Ga0439462_0004486_1497_2657 375
229 3300042129 Ga0450891_002269 Ga0450891_002269_618_1778 375
230 3300044684 Ga0466966_0013826 Ga0466966_0013826_3264_4424 375
231 3300044693 Ga0466961_0021639 Ga0466961_0021639_21_1181 375
232 3300046453 Ga0495627_025031 Ga0495627_025031_423_1592 375
233 3300046460 Ga0495638_0031889 Ga0495638_0031889_1581_2753 375
234 3300046471 Ga0495650_0005734 Ga0495650_0005734_3923_5083 375
235 3300046512 Ga0495610_0016141 Ga0495610_0016141_319_1491 375
236 3300046513 Ga0495616_0003541 Ga0495616_0003541_3079_4251 375
237 3300046518 Ga0495631_0005661 Ga0495631_0005661_1951_3123 375
238 3300046520 Ga0495637_0001633 Ga0495637_0001633_4789_5961 375
239 3300046539 Ga0495621_0053333 Ga0495621_0053333_256_1428 375
240 3300046616 Ga0495668_0025270 Ga0495668_0025270_1328_2500 375
241 3300046660 Ga0495625_0070415 Ga0495625_0070415_1049_2221 375
242 3300046674 Ga0495588_0046851 Ga0495588_0046851_228_1400 375
243 3300046683 Ga0495658_0089672 Ga0495658_0089672_494_1666 375
244 3300046692 Ga0495671_0017760 Ga0495671_0017760_1583_2755 375
245 3300046809 Ga0495600_0145898 Ga0495600_0145898_123_1283 375
246 3300047321 Ga0495676_0002146 Ga0495676_0002146_10469_11641 375
247 3300048904 Ga0496101_0039190 Ga0496101_0039190_986_2146 375
248 3300048905 Ga0496102_0018281 Ga0496102_0018281_2126_3286 375
249 3300048907 Ga0496104_0081266 Ga0496104_0081266_728_1888 375
250 3300048908 Ga0496105_0074382 Ga0496105_0074382_166_1326 375
251 3300048909 Ga0496106_0074437 Ga0496106_0074437_142_1302 375
252 3300048912 Ga0496109_0260612 Ga0496109_0260612_131_1291 375
253 3300048920 Ga0496117_0071452 Ga0496117_0071452_998_2167 375
254 3300048921 Ga0496118_0010770 Ga0496118_0010770_1936_3096 375
255 3300048925 Ga0496122_0084227 Ga0496122_0084227_620_1789 375
256 3300048927 Ga0496124_0019421 Ga0496124_0019421_4238_5410 375
257 3300048927 Ga0496124_0033600 Ga0496124_0033600_3277_4437 375
258 3300048928 Ga0496125_0016510 Ga0496125_0016510_2561_3721 375
259 3300048928 Ga0496125_0027736 Ga0496125_0027736_2482_3654 375
260 3300048929 Ga0496126_0114368 Ga0496126_0114368_541_1713 375
261 3300049581 Ga0501047_0077044 Ga0501047_0077044_1849_3009 375
262 3300050491 nmdc:mga00v17_205081_c1 nmdc:mga00v17_205081_c1_10_1146 375
263 3300050496 nmdc:mga07m45_26052_c1 nmdc:mga07m45_26052_c1_1430_2602 375
264 3300050496 nmdc:mga07m45_4895_c1 nmdc:mga07m45_4895_c1_4046_5218 375
265 3300053079 Ga0500610_0021530 Ga0500610_0021530_538_1710 375
266 3300053079 Ga0500610_0045827 Ga0500610_0045827_467_1639 375
267 3300053093 Ga0500651_0000637 Ga0500651_0000637_5944_7116 375
268 3300053108 Ga0500562_004156 Ga0500562_004156_1933_3105 375
269 3300053110 Ga0500571_004453 Ga0500571_004453_1931_3103 375
270 3300053117 Ga0500593_001809 Ga0500593_001809_3158_4330 375
271 3300053121 Ga0500607_004904 Ga0500607_004904_5968_7140 375
272 3300053121 Ga0500607_029842 Ga0500607_029842_565_1737 375
273 3300053122 Ga0500608_009959 Ga0500608_009959_1419_2582 375
274 3300053133 Ga0500655_000509 Ga0500655_000509_3205_4377 375
275 3300053134 Ga0500658_0000871 Ga0500658_0000871_10115_11287 375
276 3300053134 Ga0500658_0001437 Ga0500658_0001437_1110_2282 375
277 3300053136 Ga0500559_0005008 Ga0500559_0005008_965_2149 375
278 3300053136 Ga0500559_0012182 Ga0500559_0012182_779_1951 375
279 3300053141 Ga0500574_000058 Ga0500574_000058_7172_8344 375
280 3300053158 Ga0500627_0009456 Ga0500627_0009456_1033_2205 375
281 3300053161 Ga0500634_0034930 Ga0500634_0034930_1389_2561 375
282 3300053162 Ga0500638_016629 Ga0500638_016629_1772_2944 375
283 3300053177 Ga0500636_0026577 Ga0500636_0026577_1576_2748 375
284 3300059424 Ga0590075_018869 Ga0590075_018869_402_1571 375
285 iso_pu_bacteria 2513020051 2513231722 375
286 iso_pu_bacteria 2599185214 2599622913 375
287 iso_pu_bacteria 2599185226 2599671392 375
288 iso_pu_bacteria 2599185227 2599679571 375
289 iso_pu_bacteria 2599185229 2599691587 375
290 iso_pu_bacteria 2643221628 2644162736 375
291 iso_pu_bacteria 2643221658 2644325042 375
292 iso_pu_bacteria 2643221672 2644400230 375
293 iso_pu_bacteria 2643221683 2644467593 375
294 iso_pu_bacteria 2738541307 2738884953 375
295 iso_pu_bacteria 2818991446 2819602292 375
296 iso_pu_bacteria 2831265667 2831265744 375
297 iso_pu_bacteria 2838054893 2838056459 375
298 iso_pu_bacteria 2881101125 2881101611 375
299 iso_pu_bacteria 2899924645 2899930571 375
300 iso_pu_bacteria 2904449895 2904456361 375
301 iso_pu_bacteria 2904456579 2904462870 375
302 iso_pu_bacteria 2928037797 2928039685 375
303 iso_pu_bacteria 2928044640 2928044710 375
304 iso_pu_bacteria 2928051484 2928052510 375
305 iso_pu_bacteria 2928064002 2928064827 375
306 iso_pu_bacteria 2928070936 2928074703 375
307 iso_pu_bacteria 2928084124 2928087160 375
308 iso_pu_bacteria 2929520902 2929524379 375
309 iso_pu_bacteria 2945909444 2945910903 375
310 iso_pu_bacteria 2945972063 2945976478 375
311 iso_pu_bacteria 2945984333 2945986859 375
312 iso_pu_bacteria 2954767861 2954771504 375
313 3300003187 JGI25151J46595_10006717 JGI25151J46595_100067175 376
314 3300003761 Ga0055535_1000088 Ga0055535_100008866 376
315 3300003763 Ga0055529_1000192 Ga0055529_100019214 376
316 3300003784 Ga0055534_1000775 Ga0055534_10007753 376
317 3300005353 Ga0070669_100018672 Ga0070669_1000186722 376
318 3300005548 Ga0070665_100105623 Ga0070665_1001056232 376
319 3300009545 Ga0105237_10147707 Ga0105237_101477072 376
320 3300013306 Ga0163162_10392220 Ga0163162_103922201 376
321 3300014497 Ga0182008_10004027 Ga0182008_100040273 376
322 3300025228 Ga0209672_104727 Ga0209672_1047272 376
323 3300025231 Ga0207427_101444 Ga0207427_1014445 376
324 3300025242 Ga0209258_100025 Ga0209258_100025445 376
325 3300025242 Ga0209258_101203 Ga0209258_1012038 376
326 3300025254 Ga0209148_1002541 Ga0209148_10025413 376
327 3300025256 Ga0209759_1001341 Ga0209759_10013414 376
328 3300025272 Ga0209455_1000112 Ga0209455_1000112122 376
329 3300025291 Ga0209675_1000605 Ga0209675_100060510 376
330 3300025292 Ga0209676_1005497 Ga0209676_10054973 376
331 3300025294 Ga0209025_1000133 Ga0209025_1000133174 376
332 3300025303 Ga0209051_1007547 Ga0209051_10075471 376
333 3300025303 Ga0209051_1011722 Ga0209051_10117223 376
334 3300025304 Ga0209257_1019966 Ga0209257_10199663 376
335 3300025913 Ga0207695_10017761 Ga0207695_100177612 376
336 3300025914 Ga0207671_10100366 Ga0207671_101003662 376
337 3300025923 Ga0207681_10017065 Ga0207681_100170652 376
338 3300025942 Ga0207689_10150632 Ga0207689_101506322 376
339 3300031251 Ga0265327_10001163 Ga0265327_1000116333 376
340 3300031730 Ga0307516_10002952 Ga0307516_1000295217 376
341 3300037466 Ga0395898_0175131 Ga0395898_0175131_242_1408 376
342 3300038443 Ga0395901_0009037 Ga0395901_0009037_59_1225 376
343 3300038443 Ga0395901_0040847 Ga0395901_0040847_2113_3276 376
344 3300042115 Ga0450911_000104 Ga0450911_000104_7310_8473 376
345 3300046506 Ga0495583_0004855 Ga0495583_0004855_7412_8593 376
346 3300046529 Ga0495652_0107587 Ga0495652_0107587_771_1952 376
347 3300046616 Ga0495668_0025060 Ga0495668_0025060_54_1235 376
348 3300046660 Ga0495625_0023799 Ga0495625_0023799_2826_4007 376
349 3300046694 Ga0495649_0000941 Ga0495649_0000941_21081_22262 376
350 3300046794 Ga0495589_0025718 Ga0495589_0025718_663_1844 376
351 3300047472 Ga0495686_0017434 Ga0495686_0017434_3654_4817 376
352 3300048911 Ga0496108_0171157 Ga0496108_0171157_207_1385 376
353 3300048925 Ga0496122_0002216 Ga0496122_0002216_11344_12507 376
354 3300048926 Ga0496123_0000057 Ga0496123_0000057_220658_221821 376
355 3300048927 Ga0496124_0103444 Ga0496124_0103444_907_2070 376
356 3300048927 Ga0496124_0103541 Ga0496124_0103541_172_1344 376
357 3300048928 Ga0496125_0009493 Ga0496125_0009493_6108_7271 376
358 3300053080 Ga0500635_0000118 Ga0500635_0000118_31692_32858 376
359 3300053080 Ga0500635_0029055 Ga0500635_0029055_235_1413 376
360 3300053136 Ga0500559_0002519 Ga0500559_0002519_828_2006 376
361 3300055283 Ga0500661_011000 Ga0500661_011000_113_1294 376
362 iso_pu_bacteria 2643221609 2644059192 376
363 iso_pu_bacteria 2643221611 2644075766 376
364 iso_pu_bacteria 2738541277 2738718767 376
365 iso_pu_bacteria 2738543012 2739240685 376
366 iso_pu_bacteria 2738543013 2739252313 376
367 iso_pu_bacteria 2738543019 2739280785 376
368 iso_pu_bacteria 2816332133 2816472238 376
369 iso_pu_bacteria 2842733646 2842736178 376
370 iso_pu_bacteria 2842747753 2842748084 376
371 iso_pu_bacteria 2885198086 2885203328 376
372 iso_pu_bacteria 2885211737 2885217322 376
373 iso_pu_bacteria 2904541872 2904546927 376
374 iso_pu_bacteria 2929160207 2929164399 376
375 3300006048 Ga0075363_100054950 Ga0075363_1000549502 377
376 3300006177 Ga0075362_10007750 Ga0075362_100077502 377
377 3300006195 Ga0075366_10027615 Ga0075366_100276153 377
378 3300006353 Ga0075370_10002370 Ga0075370_100023703 377
379 3300025940 Ga0207691_10135360 Ga0207691_101353603 377
380 3300025972 Ga0207668_10224750 Ga0207668_102247502 377
381 3300031548 Ga0307408_100044972 Ga0307408_1000449723 377
382 3300031548 Ga0307408_100174492 Ga0307408_1001744922 377
383 3300031731 Ga0307405_10016895 Ga0307405_100168952 377
384 3300031911 Ga0307412_10017954 Ga0307412_100179543 377
385 3300037312 Ga0395899_0021057 Ga0395899_0021057_2167_3342 377
386 3300037418 Ga0395900_0091044 Ga0395900_0091044_329_1504 377
387 3300037466 Ga0395898_0018034 Ga0395898_0018034_269_1444 377
388 3300037471 Ga0395905_0013637 Ga0395905_0013637_3345_4520 377
389 3300038443 Ga0395901_0043223 Ga0395901_0043223_3139_4314 377
390 3300041404 Ga0439436_0004496 Ga0439436_0004496_2299_3465 377
391 3300041406 Ga0439439_0003501 Ga0439439_0003501_1967_3133 377
392 3300041997 Ga0439431_0022875 Ga0439431_0022875_317_1483 377
393 3300042002 Ga0439442_010529 Ga0439442_010529_659_1825 377
394 3300042004 Ga0439445_0013058 Ga0439445_0013058_46_1212 377
395 3300042007 Ga0439449_0000752 Ga0439449_0000752_10343_11509 377
396 3300042010 Ga0439452_019822 Ga0439452_019822_596_1762 377
397 3300046615 Ga0495656_0000128 Ga0495656_0000128_1816_2982 377
398 3300050489 nmdc:mga03683_13652_c1 nmdc:mga03683_13652_c1_1373_2539 377
399 3300050490 nmdc:mga03n38_45264_c1 nmdc:mga03n38_45264_c1_187_1353 377
400 3300050493 nmdc:mga0k408_16554_c1 nmdc:mga0k408_16554_c1_1505_2671 377
401 3300006038 Ga0075365_10006403 Ga0075365_100064034 378
402 3300031251 Ga0265327_10035813 Ga0265327_100358132 378
403 3300050492 nmdc:mga0yw44_8069_c1 nmdc:mga0yw44_8069_c1_736_1920 378
404 3300005336 Ga0070680_100280668 Ga0070680_1002806681 379
405 3300005530 Ga0070679_100032687 Ga0070679_1000326873 379
406 3300005563 Ga0068855_100028696 Ga0068855_1000286964 379
407 3300006178 Ga0075367_10029383 Ga0075367_100293832 379
408 3300006195 Ga0075366_10091787 Ga0075366_100917872 379
409 3300009093 Ga0105240_10015282 Ga0105240_100152828 379
410 3300025913 Ga0207695_10073312 Ga0207695_100733123 379
411 3300025919 Ga0207657_10016411 Ga0207657_100164113 379
412 3300025921 Ga0207652_10213259 Ga0207652_102132591 379
413 3300041404 Ga0439436_0001207 Ga0439436_0001207_5189_6448 379
414 3300041411 Ga0439466_0028834 Ga0439466_0028834_277_1536 379
415 3300041413 Ga0439465_0001354 Ga0439465_0001354_809_2068 379
416 3300041999 Ga0439433_0000346 Ga0439433_0000346_1055_2314 379
417 3300042006 Ga0439432_000644 Ga0439432_000644_2794_4053 379
418 3300042007 Ga0439449_0002886 Ga0439449_0002886_2876_4135 379
419 3300042014 Ga0439457_009018 Ga0439457_009018_510_1769 379
420 3300042156 Ga0439446_0010388 Ga0439446_0010388_363_1622 379
421 3300050493 nmdc:mga0k408_136380_c1 nmdc:mga0k408_136380_c1_222_1403 379
422 3300002987 JGI25159J45721_1001524 JGI25159J45721_100152410 382
423 3300003354 JGI25160J50197_1000590 JGI25160J50197_100059012 382
424 3300003374 JGI25161J50226_1000035 JGI25161J50226_100003512 382
425 3300004625 Ga0055543_1000829 Ga0055543_100082915 382
426 3300025284 Ga0209130_1000042 Ga0209130_1000042254 382
427 3300025302 Ga0207426_1000097 Ga0207426_1000097260 382
428 3300003187 JGI25151J46595_10018814 JGI25151J46595_100188142 384
429 3300025245 Ga0207425_1007176 Ga0207425_10071762 384
430 3300025263 Ga0209565_1001252 Ga0209565_10012526 384
431 3300025291 Ga0209675_1011278 Ga0209675_10112783 384
432 3300025294 Ga0209025_1024823 Ga0209025_10248232 384
433 3300025297 Ga0209758_1007028 Ga0209758_10070287 384
434 3300025298 Ga0209050_1033956 Ga0209050_10339562 384
435 3300025304 Ga0209257_1021142 Ga0209257_10211422 384
436 3300041452 Ga0451793_1147341 Ga0451793_1147341_910_2097 384
437 3300053117 Ga0500593_004609 Ga0500593_004609_1678_2865 384
438 3300053730 Ga0500645_002692 Ga0500645_002692_6071_7225 384
439 3300053730 Ga0500645_003744 Ga0500645_003744_368_1555 384
440 3300055283 Ga0500661_005454 Ga0500661_005454_771_1958 384
441 3300025294 Ga0209025_1009560 Ga0209025_10095602 386
442 3300031548 Ga0307408_100012339 Ga0307408_1000123393 386
443 3300002704 JGI25155J39150_1000051 JGI25155J39150_100005170 394
444 3300002705 JGI25156J39149_1000196 JGI25156J39149_100019612 394
445 3300002738 JGI25154J39366_1000344 JGI25154J39366_100034412 394
446 3300002741 JGI25157J39369_1000091 JGI25157J39369_100009170 394
447 3300025206 Ga0209435_100062 Ga0209435_10006212 394
448 3300025246 Ga0209646_1000001 Ga0209646_1000001301 394
449 3300025250 Ga0209026_1000224 Ga0209026_100022412 394
450 3300025256 Ga0209759_1000013 Ga0209759_1000013301 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

96

336

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u08-assembly1.cif.gz_A crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9273 2 380
1v2d-assembly1.cif.gz_A-2 crystal structure of t.th hb8 glutamine aminotransferase 0.9273 2 381
1u08-assembly1.cif.gz_B crystal structure and reactivity of ybdl from escherichia coli identify a methionine aminotransferase function. 0.9204 1 380
2o0r-assembly1.cif.gz_B the three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis 0.9098 2 379
8fft-assembly1.cif.gz_B structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine 0.9036 21 378
ID Description Score Start End Superfamily
1v2eB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9509 28 272 3.40.640.10
1v2eB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.939 28 272 3.40.640.10
2o0rA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9337 28 272 3.40.640.10
af_A0A1D6I5Q5_168_402_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9285 30 270 3.40.640.10
2o0rA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9226 28 272 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A4D4JWV6-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9518 2 384 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A536UVI6-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9367 162 383 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A3A0EV82-F1-model_v4 Aminotransferase 0.9319 1 381 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A258DCB4-F1-model_v4 Aminotransferase 0.9314 21 272 GO:0005737
GO:0009058
GO:0016212
GO:0030170
AF-A0A2D7JJC8-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9313 3 379 GO:0004069
GO:0006520
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
88.13 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map