F446526

General Info

Members Datasets Scaffolds Average Seq Length
450 219 447 326

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10074193|Ga0070658_100741932
Length 328
Sequence MERTNFIDLIKVFCRSGHGGAGSRHFLRNKLTAFGGPDGGXXXRGAHIILRGNKNLWTLLHLRYYKNILAENGENGSKNNCTGRDGKDIYIEVPLGTIATVEETGERIEILEDGEEKILLKGGRGGLGNSHFATPTNQAPERAQPGEPGTETFVSLELKVLADVGLVGFPNAGKSTLLSVITAAKPKIADYAFTTLTPQLGMVEYRDHKSFCVADLPGIIEGAAEGKGLGHRFLRHIERNPVLLFVIPSDSNDHDEEFKVLQNELKKYNPELLDKKFVLAISKSDMLDDELKKAIEKELPKNVPHIFISSLTNKGLVELKDMLWNALN

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
208 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0
Rhizoplane 0.22
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10008081 3300002077 Bacteria 2173
2 rootH2_10006480 3300003320 Bacteria 5678
3 rootH2_10043903 3300003320 Bacteria 12034
4 Ga0065712_10096188 3300005290 Bacteria 2191
5 Ga0065715_10009069 3300005293 Bacteria 4668
6 Ga0065707_10176754 3300005295 Bacteria 1445
7 Ga0070658_10074193 3300005327 Bacteria 2790
8 Ga0070676_10010090 3300005328 Bacteria 5116
9 Ga0070676_10042967 3300005328 Bacteria 2626
10 Ga0070676_10051936 3300005328 Bacteria 2408
11 Ga0070676_10097090 3300005328 Unclassified 1815
12 Ga0070683_100007723 3300005329 Bacteria 9105
13 Ga0070683_100013225 3300005329 Bacteria 7190
14 Ga0070690_100012248 3300005330 Bacteria 5044
15 Ga0070690_100161504 3300005330 Bacteria 1535
16 Ga0070670_100008241 3300005331 Bacteria 8876
17 Ga0070670_100025299 3300005331 Bacteria 5108
18 Ga0070670_100070140 3300005331 Bacteria 3009
19 Ga0070670_100113634 3300005331 Bacteria 2334
20 Ga0070670_100250668 3300005331 Bacteria 1542
21 Ga0070670_100279134 3300005331 Bacteria 1459
22 Ga0070677_10011541 3300005333 Bacteria 3050
23 Ga0068869_100001936 3300005334 Bacteria 12416
24 Ga0068869_100004161 3300005334 Bacteria 8973
25 Ga0068869_100015920 3300005334 Bacteria 5059
26 Ga0068869_100030113 3300005334 Bacteria 3807
27 Ga0068869_100111652 3300005334 Bacteria 2080
28 Ga0070666_10024700 3300005335 Bacteria 3917
29 Ga0068868_100008858 3300005338 Bacteria 7210
30 Ga0068868_100045912 3300005338 Bacteria 3419
31 Ga0068868_100137690 3300005338 Bacteria 2002
32 Ga0070689_100052763 3300005340 Bacteria 3145
33 Ga0070689_100110204 3300005340 Bacteria 2188
34 Ga0070691_10018640 3300005341 Bacteria 3200
35 Ga0070661_100000394 3300005344 Bacteria 33858
36 Ga0070661_100003541 3300005344 Bacteria 10758
37 Ga0070661_100040753 3300005344 Bacteria 3389
38 Ga0070661_100126963 3300005344 Bacteria 1914
39 Ga0070668_100031849 3300005347 Bacteria 4013
40 Ga0070668_100048551 3300005347 Bacteria 3265
41 Ga0070669_100050475 3300005353 Bacteria 3039
42 Ga0070669_100061303 3300005353 Bacteria 2763
43 Ga0070669_100143048 3300005353 Bacteria 1846
44 Ga0070669_100344766 3300005353 Bacteria 1208
45 Ga0070675_100009539 3300005354 Bacteria 7550
46 Ga0070675_100019461 3300005354 Bacteria 5412
47 Ga0070675_100022347 3300005354 Bacteria 5053
48 Ga0070675_100109665 3300005354 Bacteria 2333
49 Ga0070675_100150032 3300005354 Bacteria 1998
50 Ga0070671_100047266 3300005355 Bacteria 3579
51 Ga0070671_100059115 3300005355 Bacteria 3190
52 Ga0070671_100137665 3300005355 Bacteria 2059
53 Ga0070674_100118326 3300005356 Unclassified 1958
54 Ga0070674_100214728 3300005356 Bacteria 1493
55 Ga0070673_100001051 3300005364 Bacteria 15685
56 Ga0070673_100001247 3300005364 Bacteria 14780
57 Ga0070673_100005738 3300005364 Bacteria 7984
58 Ga0070673_100010807 3300005364 Bacteria 6200
59 Ga0070673_100149311 3300005364 Bacteria 1978
60 Ga0070688_100001596 3300005365 Bacteria 11347
61 Ga0070688_100016679 3300005365 Bacteria 4203
62 Ga0070688_100028783 3300005365 Unclassified 3321
63 Ga0070688_100127606 3300005365 Bacteria 1711
64 Ga0070659_100013312 3300005366 Bacteria 6120
65 Ga0070659_100032446 3300005366 Bacteria 4051
66 Ga0070667_100037221 3300005367 Bacteria 4079
67 Ga0070667_100184211 3300005367 Bacteria 1847
68 Ga0070678_100001383 3300005456 Bacteria 12932
69 Ga0070678_100005396 3300005456 Bacteria 7375
70 Ga0070678_100045196 3300005456 Bacteria 3149
71 Ga0070678_100229929 3300005456 Bacteria 1546
72 Ga0070662_100019885 3300005457 Bacteria 4567
73 Ga0070662_100103860 3300005457 Bacteria 2155
74 Ga0068867_100001757 3300005459 Bacteria 15079
75 Ga0068867_100032393 3300005459 Bacteria 3780
76 Ga0068867_100204279 3300005459 Bacteria 1583
77 Ga0070685_10088836 3300005466 Bacteria 1867
78 Ga0070698_100007807 3300005471 Bacteria 11578
79 Ga0070698_100010891 3300005471 Bacteria 9674
80 Ga0070699_100382417 3300005518 Bacteria 1271
81 Ga0070679_100075740 3300005530 Bacteria 3354
82 Ga0070684_100000214 3300005535 Bacteria 40555
83 Ga0070684_100099301 3300005535 Bacteria 2598
84 Ga0068853_100006773 3300005539 Bacteria 9130
85 Ga0068853_100010271 3300005539 Bacteria 7572
86 Ga0068853_100015144 3300005539 Bacteria 6340
87 Ga0068853_100037422 3300005539 Bacteria 4128
88 Ga0070672_100110521 3300005543 Bacteria 2239
89 Ga0070672_100115006 3300005543 Bacteria 2197
90 Ga0070686_100066447 3300005544 Bacteria 2346
91 Ga0070686_100197362 3300005544 Unclassified 1440
92 Ga0070695_100138089 3300005545 Bacteria 1687
93 Ga0070693_100011300 3300005547 Bacteria 4495
94 Ga0070665_100000002 3300005548 Bacteria 849037
95 Ga0070665_100029337 3300005548 Bacteria 5537
96 Ga0068855_100089734 3300005563 Bacteria 3548
97 Ga0070664_100012890 3300005564 Bacteria 6802
98 Ga0070664_100015514 3300005564 Bacteria 6234
99 Ga0070664_100023280 3300005564 Bacteria 5116
100 Ga0070664_100031927 3300005564 Bacteria 4404
101 Ga0070664_100101497 3300005564 Unclassified 2502
102 Ga0070664_100120158 3300005564 Bacteria 2300
103 Ga0070664_100145285 3300005564 Bacteria 2091
104 Ga0070664_100151438 3300005564 Bacteria 2048
105 Ga0068857_100005631 3300005577 Bacteria 10706
106 Ga0068857_100007064 3300005577 Bacteria 9670
107 Ga0068857_100086156 3300005577 Bacteria 2808
108 Ga0068857_100294802 3300005577 Bacteria 1494
109 Ga0068857_100313618 3300005577 Bacteria 1447
110 Ga0068856_100298192 3300005614 Bacteria 1629
111 Ga0068852_100001327 3300005616 Bacteria 16562
112 Ga0068852_100055098 3300005616 Unclassified 3431
113 Ga0068852_100227271 3300005616 Bacteria 1778
114 Ga0068859_100004846 3300005617 Bacteria 13695
115 Ga0068859_100034310 3300005617 Bacteria 5093
116 Ga0068859_100042186 3300005617 Bacteria 4583
117 Ga0068859_100109144 3300005617 Bacteria 2828
118 Ga0068864_100033896 3300005618 Unclassified 4341
119 Ga0068864_100098614 3300005618 Bacteria 2588
120 Ga0068864_100206417 3300005618 Bacteria 1807
121 Ga0068864_100269422 3300005618 Bacteria 1586
122 Ga0068864_100315407 3300005618 Bacteria 1467
123 Ga0068866_10044651 3300005718 Bacteria 2218
124 Ga0068866_10093264 3300005718 Bacteria 1644
125 Ga0068861_100019954 3300005719 Bacteria 4792
126 Ga0068861_100344990 3300005719 Bacteria 1304
127 Ga0068861_100632871 3300005719 Bacteria 986
128 Ga0068851_10039361 3300005834 Bacteria 2374
129 Ga0068870_10002774 3300005840 Bacteria 7364
130 Ga0068870_10026774 3300005840 Bacteria 2877
131 Ga0068863_100003354 3300005841 Bacteria 15821
132 Ga0068863_100010871 3300005841 Bacteria 8826
133 Ga0068863_100258676 3300005841 Bacteria 1682
134 Ga0068863_100313133 3300005841 Unclassified 1524
135 Ga0068858_100347458 3300005842 Bacteria 1420
136 Ga0068860_100000003 3300005843 Bacteria 575741
137 Ga0068860_100090998 3300005843 Unclassified 2906
138 Ga0068862_100018238 3300005844 Bacteria 5843
139 Ga0081539_10047681 3300005985 Bacteria 2444
140 Ga0075366_10006741 3300006195 Bacteria 6309
141 Ga0097621_100017133 3300006237 Bacteria 5497
142 Ga0097621_100040412 3300006237 Bacteria 3750
143 Ga0097621_100055709 3300006237 Bacteria 3229
144 Ga0068871_100044471 3300006358 Unclassified 3572
145 Ga0068871_100067878 3300006358 Bacteria 2927
146 Ga0068871_100318261 3300006358 Bacteria 1369
147 Ga0075428_100008296 3300006844 Bacteria 11514
148 Ga0075428_100020478 3300006844 Bacteria 7323
149 Ga0075431_100094366 3300006847 Bacteria 3088
150 Ga0075434_100352295 3300006871 Bacteria 1493
151 Ga0075429_100076661 3300006880 Bacteria 2912
152 Ga0068865_100007355 3300006881 Bacteria 6772
153 Ga0097620_100004846 3300006931 Bacteria 13695
154 Ga0097620_100034309 3300006931 Bacteria 5093
155 Ga0097620_100042187 3300006931 Bacteria 4583
156 Ga0097620_100109137 3300006931 Bacteria 2828
157 Ga0105240_10003432 3300009093 Bacteria 24627
158 Ga0105240_10008651 3300009093 Bacteria 14544
159 Ga0111539_10074105 3300009094 Bacteria 4011
160 Ga0105247_10001649 3300009101 Bacteria 15780
161 Ga0105247_10044306 3300009101 Bacteria 2728
162 Ga0114129_10033444 3300009147 Bacteria 7266
163 Ga0105241_10004810 3300009174 Bacteria 9949
164 Ga0105241_10026917 3300009174 Bacteria 4280
165 Ga0105242_10009462 3300009176 Bacteria 7467
166 Ga0105242_10017510 3300009176 Bacteria 5586
167 Ga0105242_10123934 3300009176 Unclassified 2222
168 Ga0105242_10127686 3300009176 Unclassified 2190
169 Ga0105242_10136635 3300009176 Bacteria 2123
170 Ga0105248_10128178 3300009177 Bacteria 2863
171 Ga0105237_10074600 3300009545 Bacteria 3384
172 Ga0105237_10086507 3300009545 Bacteria 3124
173 Ga0105249_10011029 3300009553 Bacteria 7940
174 Ga0105249_10016077 3300009553 Bacteria 6633
175 Ga0105249_10051577 3300009553 Bacteria 3753
176 Ga0105249_10079608 3300009553 Bacteria 3042
177 Ga0105249_10125767 3300009553 Bacteria 2441
178 Ga0105239_10000925 3300010375 Bacteria 41596
179 Ga0105246_10356449 3300011119 Unclassified 1200
180 Ga0157373_10007437 3300013100 Bacteria 8147
181 Ga0157371_10108317 3300013102 Bacteria 1972
182 Ga0157370_10006558 3300013104 Bacteria 12819
183 Ga0157370_10006824 3300013104 Bacteria 12513
184 Ga0157370_10468817 3300013104 Bacteria 1157
185 Ga0157369_10017140 3300013105 Bacteria 8138
186 Ga0157374_10000013 3300013296 Bacteria 461240
187 Ga0157374_10000660 3300013296 Bacteria 30313
188 Ga0157374_10085313 3300013296 Bacteria 3002
189 Ga0157374_10087491 3300013296 Bacteria 2966
190 Ga0157374_10090356 3300013296 Bacteria 2920
191 Ga0157374_10180859 3300013296 Bacteria 2060
192 Ga0157378_10074088 3300013297 Bacteria 3063
193 Ga0157378_10111054 3300013297 Bacteria 2513
194 Ga0157378_10230028 3300013297 Bacteria 1766
195 Ga0163162_10001229 3300013306 Bacteria 23943
196 Ga0163162_10009287 3300013306 Bacteria 9564
197 Ga0163162_10028216 3300013306 Bacteria 5552
198 Ga0163162_10040942 3300013306 Bacteria 4635
199 Ga0163162_10123747 3300013306 Bacteria 2692
200 Ga0163162_10146826 3300013306 Bacteria 2475
201 Ga0163162_10153352 3300013306 Bacteria 2422
202 Ga0157372_10006795 3300013307 Bacteria 12162
203 Ga0157372_10033946 3300013307 Bacteria 5606
204 Ga0157372_10152851 3300013307 Bacteria 2664
205 Ga0157372_10208085 3300013307 Bacteria 2267
206 Ga0157372_10286036 3300013307 Bacteria 1917
207 Ga0157372_10347052 3300013307 Bacteria 1729
208 Ga0157375_10021149 3300013308 Bacteria 5959
209 Ga0157375_10076836 3300013308 Bacteria 3367
210 Ga0157375_10122934 3300013308 Bacteria 2707
211 Ga0157375_10193067 3300013308 Unclassified 2191
212 Ga0157375_10384595 3300013308 Bacteria 1570
213 Ga0157375_10600442 3300013308 Bacteria 1260
214 Ga0163163_10001180 3300014325 Bacteria 22130
215 Ga0163163_10214717 3300014325 Unclassified 1973
216 Ga0157380_10008120 3300014326 Bacteria 7480
217 Ga0157380_10106873 3300014326 Bacteria 2343
218 Ga0157377_10000543 3300014745 Bacteria 15933
219 Ga0157377_10048249 3300014745 Bacteria 2388
220 Ga0157377_10059819 3300014745 Bacteria 2173
221 Ga0157377_10095509 3300014745 Bacteria 1762
222 Ga0157379_10068036 3300014968 Bacteria 3184
223 Ga0157379_10080009 3300014968 Bacteria 2927
224 Ga0157379_10106468 3300014968 Bacteria 2517
225 Ga0157379_10135241 3300014968 Bacteria 2220
226 Ga0157379_10219568 3300014968 Bacteria 1722
227 Ga0157376_10001116 3300014969 Bacteria 17609
228 Ga0157376_10017768 3300014969 Bacteria 5434
229 Ga0157376_10156051 3300014969 Bacteria 2064
230 Ga0163161_10014179 3300017792 Bacteria 5551
231 Ga0163161_10094296 3300017792 Bacteria 2219
232 Ga0207697_10027164 3300025315 Bacteria 2341
233 Ga0207682_10008809 3300025893 Bacteria 3990
234 Ga0207642_10007648 3300025899 Bacteria 3659
235 Ga0207642_10015556 3300025899 Unclassified 2839
236 Ga0207688_10005909 3300025901 Bacteria 6663
237 Ga0207647_10000131 3300025904 Bacteria 58960
238 Ga0207647_10036676 3300025904 Bacteria 3114
239 Ga0207685_10066428 3300025905 Bacteria 1447
240 Ga0207645_10007635 3300025907 Bacteria 7620
241 Ga0207645_10020161 3300025907 Unclassified 4365
242 Ga0207643_10007039 3300025908 Bacteria 6026
243 Ga0207705_10228684 3300025909 Bacteria 1414
244 Ga0207654_10002774 3300025911 Bacteria 8895
245 Ga0207707_10004563 3300025912 Bacteria 12175
246 Ga0207695_10001383 3300025913 Bacteria 41051
247 Ga0207695_10067016 3300025913 Bacteria 3684
248 Ga0207671_10016606 3300025914 Bacteria 5716
249 Ga0207671_10030081 3300025914 Bacteria 4050
250 Ga0207649_10002535 3300025920 Bacteria 10172
251 Ga0207649_10044779 3300025920 Bacteria 2710
252 Ga0207649_10068936 3300025920 Bacteria 2250
253 Ga0207652_10013744 3300025921 Bacteria 6547
254 Ga0207681_10291270 3300025923 Bacteria 1289
255 Ga0207650_10012929 3300025925 Bacteria 5770
256 Ga0207650_10040148 3300025925 Bacteria 3423
257 Ga0207650_10115529 3300025925 Bacteria 2083
258 Ga0207650_10173540 3300025925 Bacteria 1714
259 Ga0207650_10336255 3300025925 Bacteria 1239
260 Ga0207659_10002722 3300025926 Bacteria 10536
261 Ga0207659_10112188 3300025926 Bacteria 2074
262 Ga0207644_10193148 3300025931 Bacteria 1602
263 Ga0207644_10294658 3300025931 Bacteria 1306
264 Ga0207644_10414872 3300025931 Bacteria 1102
265 Ga0207690_10015145 3300025932 Bacteria 4669
266 Ga0207690_10120079 3300025932 Bacteria 1908
267 Ga0207690_10129863 3300025932 Bacteria 1843
268 Ga0207690_10255756 3300025932 Bacteria 1355
269 Ga0207706_10009526 3300025933 Bacteria 8918
270 Ga0207706_10012285 3300025933 Bacteria 7804
271 Ga0207706_10017920 3300025933 Bacteria 6374
272 Ga0207706_10084665 3300025933 Bacteria 2788
273 Ga0207686_10001307 3300025934 Bacteria 14268
274 Ga0207686_10003874 3300025934 Bacteria 8026
275 Ga0207670_10185044 3300025936 Bacteria 1572
276 Ga0207669_10063989 3300025937 Unclassified 2274
277 Ga0207669_10237634 3300025937 Bacteria 1348
278 Ga0207704_10026419 3300025938 Bacteria 3186
279 Ga0207691_10010693 3300025940 Bacteria 8809
280 Ga0207691_10011768 3300025940 Bacteria 8398
281 Ga0207691_10043215 3300025940 Bacteria 4154
282 Ga0207691_10075290 3300025940 Bacteria 3044
283 Ga0207711_10315766 3300025941 Bacteria 1443
284 Ga0207689_10001731 3300025942 Bacteria 20624
285 Ga0207689_10001814 3300025942 Bacteria 20165
286 Ga0207689_10001835 3300025942 Bacteria 20086
287 Ga0207689_10007158 3300025942 Bacteria 9811
288 Ga0207689_10015447 3300025942 Bacteria 6464
289 Ga0207689_10015585 3300025942 Bacteria 6438
290 Ga0207689_10035848 3300025942 Unclassified 4118
291 Ga0207689_10266542 3300025942 Bacteria 1418
292 Ga0207661_10009240 3300025944 Bacteria 7063
293 Ga0207661_10157241 3300025944 Bacteria 1970
294 Ga0207661_10240559 3300025944 Bacteria 1606
295 Ga0207679_10001053 3300025945 Bacteria 17570
296 Ga0207679_10059670 3300025945 Bacteria 2831
297 Ga0207679_10440594 3300025945 Bacteria 1153
298 Ga0207667_10065865 3300025949 Bacteria 3777
299 Ga0207667_10273109 3300025949 Bacteria 1728
300 Ga0207667_10338345 3300025949 Bacteria 1536
301 Ga0207651_10009460 3300025960 Bacteria 5339
302 Ga0207651_10025954 3300025960 Bacteria 3651
303 Ga0207651_10068785 3300025960 Bacteria 2498
304 Ga0207651_10084808 3300025960 Bacteria 2296
305 Ga0207651_10157336 3300025960 Bacteria 1777
306 Ga0207712_10016274 3300025961 Bacteria 4812
307 Ga0207668_10275489 3300025972 Bacteria 1377
308 Ga0207640_10034289 3300025981 Bacteria 3166
309 Ga0207677_10113273 3300026023 Bacteria 2024
310 Ga0207703_10042603 3300026035 Unclassified 3641
311 Ga0207703_10589776 3300026035 Bacteria 1050
312 Ga0207639_10003626 3300026041 Bacteria 10368
313 Ga0207639_10005873 3300026041 Bacteria 8317
314 Ga0207639_10020635 3300026041 Bacteria 4719
315 Ga0207639_10176385 3300026041 Bacteria 1814
316 Ga0207639_10279993 3300026041 Bacteria 1466
317 Ga0207639_10324193 3300026041 Bacteria 1369
318 Ga0207678_10086652 3300026067 Unclassified 2676
319 Ga0207702_10018882 3300026078 Bacteria 5703
320 Ga0207641_10000422 3300026088 Bacteria 49394
321 Ga0207641_10010722 3300026088 Bacteria 7515
322 Ga0207648_10003325 3300026089 Bacteria 16891
323 Ga0207648_10004672 3300026089 Bacteria 14008
324 Ga0207648_10025892 3300026089 Bacteria 5218
325 Ga0207648_10054988 3300026089 Unclassified 3475
326 Ga0207648_10060785 3300026089 Bacteria 3295
327 Ga0207648_10137853 3300026089 Bacteria 2149
328 Ga0207648_10245274 3300026089 Bacteria 1596
329 Ga0207676_10002771 3300026095 Bacteria 12465
330 Ga0207676_10047418 3300026095 Bacteria 3330
331 Ga0207676_10138261 3300026095 Bacteria 2082
332 Ga0207676_10202858 3300026095 Bacteria 1754
333 Ga0207674_10004608 3300026116 Bacteria 16555
334 Ga0207674_10006491 3300026116 Bacteria 13755
335 Ga0207674_10060286 3300026116 Bacteria 3838
336 Ga0207674_10067958 3300026116 Bacteria 3587
337 Ga0207674_10098518 3300026116 Bacteria 2907
338 Ga0207674_10130508 3300026116 Bacteria 2477
339 Ga0207674_10243649 3300026116 Bacteria 1745
340 Ga0207675_100000144 3300026118 Bacteria 61517
341 Ga0207675_100004931 3300026118 Bacteria 12862
342 Ga0207675_100115909 3300026118 Bacteria 2531
343 Ga0207675_100264922 3300026118 Unclassified 1666
344 Ga0207683_10004506 3300026121 Bacteria 12018
345 Ga0207683_10016585 3300026121 Bacteria 6270
346 Ga0207683_10078229 3300026121 Bacteria 2930
347 Ga0207683_10137068 3300026121 Bacteria 2203
348 Ga0207683_10535235 3300026121 Bacteria 1083
349 Ga0207698_10013000 3300026142 Bacteria 5475
350 Ga0207698_10122930 3300026142 Bacteria 2201
351 Ga0207698_10206620 3300026142 Bacteria 1763
352 Ga0207428_10028420 3300027907 Bacteria 4646
353 Ga0207428_10065752 3300027907 Bacteria 2859
354 Ga0268266_10000169 3300028379 Bacteria 119437
355 Ga0268265_10142851 3300028380 Bacteria 2006
356 Ga0268265_10311902 3300028380 Bacteria 1421
357 Ga0268264_10000063 3300028381 Bacteria 301702
358 Ga0268264_10013279 3300028381 Bacteria 6781
359 Ga0268264_10060770 3300028381 Bacteria 3168
360 Ga0268264_10199516 3300028381 Unclassified 1829
361 Ga0307517_10011456 3300028786 Bacteria 12286
362 Ga0307512_10094429 3300030522 Bacteria 2064
363 Ga0265340_10067647 3300031247 Bacteria 1698
364 Ga0265327_10009830 3300031251 Bacteria 6833
365 Ga0265313_10013924 3300031595 Bacteria 4789
366 Ga0307516_10000384 3300031730 Bacteria 57633
367 Ga0307516_10029937 3300031730 Bacteria 5499
368 Ga0307413_10119337 3300031824 Bacteria 1783
369 Ga0307414_10011156 3300032004 Bacteria 5257
370 Ga0307414_10228523 3300032004 Bacteria 1533
371 Ga0307510_10000156 3300033180 Bacteria 56919
372 Ga0373937_0069982 3300036401 Bacteria 3236
373 Ga0373937_0160956 3300036401 Bacteria 2104
374 Ga0395900_0021316 3300037418 Bacteria 6625
375 Ga0395905_0034764 3300037471 Bacteria 4732
376 Ga0395905_0079295 3300037471 Bacteria 3078
377 Ga0436365_0536489 3300039437 Unclassified 1573
378 Ga0439461_0010482 3300041410 Bacteria 1703
379 Ga0439431_0006646 3300041997 Bacteria 2563
380 Ga0439441_007657 3300042001 Bacteria 1747
381 Ga0439449_0005282 3300042007 Bacteria 4953
382 Ga0450896_005306 3300042133 Unclassified 1757
383 Ga0451577_0165345 3300042876 Bacteria 1993
384 Ga0466965_0032936 3300044683 Bacteria 2532
385 Ga0466963_0217485 3300044694 Bacteria 1338
386 Ga0453684_0005543 3300044712 Bacteria 24910
387 Ga0453684_0023709 3300044712 Bacteria 9015
388 Ga0453684_0141732 3300044712 Bacteria 2869
389 Ga0466971_0025697 3300044719 Bacteria 2630
390 Ga0466959_0010464 3300045049 Bacteria 6636
391 Ga0466958_0075610 3300045836 Bacteria 2066
392 Ga0495653_0085649 3300046463 Bacteria 2318
393 Ga0495580_0088246 3300046472 Bacteria 2160
394 Ga0495643_0037362 3300046522 Bacteria 2665
395 Ga0495587_0070587 3300046536 Bacteria 2033
396 Ga0495598_0050145 3300046537 Bacteria 1254
397 Ga0495668_0002479 3300046616 Bacteria 15155
398 Ga0495611_0000061 3300046648 Bacteria 77533
399 Ga0495625_0219417 3300046660 Bacteria 1247
400 Ga0495625_0323258 3300046660 Bacteria 982
401 Ga0495658_0168550 3300046683 Bacteria 1354
402 Ga0495649_0036653 3300046694 Bacteria 2694
403 Ga0495672_0003985 3300047320 Bacteria 12353
404 Ga0495672_0117877 3300047320 Bacteria 1416
405 Ga0495676_0218171 3300047321 Bacteria 1316
406 Ga0495687_001475 3300047443 Bacteria 21512
407 Ga0495684_0137943 3300047471 Bacteria 1830
408 Ga0495686_0000010 3300047472 Bacteria 573229
409 Ga0495686_0051295 3300047472 Bacteria 2589
410 Ga0496108_0290753 3300048911 Bacteria 1423
411 Ga0501031_0187570 3300049568 Bacteria 1350
412 Ga0501032_0021890 3300049569 Bacteria 4439
413 Ga0501036_0025581 3300049572 Bacteria 4980
414 Ga0501037_0070492 3300049573 Bacteria 2543
415 Ga0501043_0016479 3300049579 Bacteria 5793
416 Ga0501043_0102685 3300049579 Bacteria 2247
417 Ga0501046_0015881 3300049580 Bacteria 6316
418 Ga0501047_0435881 3300049581 Bacteria 1141
419 Ga0501072_0034199 3300049588 Bacteria 3983
420 Ga0501233_006178 3300049668 Bacteria 2244
421 Ga0501257_002695 3300049686 Bacteria 3750
422 Ga0501080_0206999 3300049742 Bacteria 1799
423 Ga0501083_0261018 3300049744 Bacteria 1127
424 Ga0501044_0292065 3300049823 Bacteria 1561
425 nmdc:mga0k408_77004_c1 3300050493 Bacteria 1950
426 nmdc:mga05p37_139120_c1 3300050507 Bacteria 2975
427 nmdc:mga05p37_98044_c1 3300050507 Bacteria 3610
428 nmdc:mga0qj67_123552_c1 3300050509 Bacteria 2094
429 nmdc:mga06r32_196417_c1 3300050510 Bacteria 2005
430 nmdc:mga06r32_369111_c1 3300050510 Bacteria 1418
431 nmdc:mga08y16_13488_c1 3300050511 Bacteria 8599
432 nmdc:mga0n895_419427_c1 3300050512 Bacteria 1353
433 nmdc:mga0a205_349851_c1 3300050515 Bacteria 1345
434 Ga0500578_0000386 3300053086 Bacteria 54049
435 Ga0500646_0055853 3300053090 Bacteria 1150
436 Ga0500583_0000035 3300053092 Bacteria 96248
437 Ga0500658_0054425 3300053134 Bacteria 1645
438 Ga0500568_0000974 3300053139 Bacteria 19719
439 Ga0500568_0061553 3300053139 Bacteria 1452
440 Ga0500589_044178 3300053147 Bacteria 2077
441 Ga0500604_0005466 3300053151 Bacteria 3354
442 Ga0500616_0021796 3300053153 Bacteria 3584
443 Ga0500636_0111172 3300053177 Bacteria 1548
444 Ga0500637_0030420 3300053178 Bacteria 3004
445 Ga0500611_000001 3300053727 Bacteria 385744
446 Ga0500645_011827 3300053730 Bacteria 2837
447 Ga0466962_0059454 3300061719 Bacteria 1824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10243649 Ga0207674_102436492 280
2 3300005328 Ga0070676_10051936 Ga0070676_100519362 289
3 3300005331 Ga0070670_100008241 Ga0070670_1000082417 289
4 3300005334 Ga0068869_100004161 Ga0068869_1000041617 289
5 3300005347 Ga0070668_100031849 Ga0070668_1000318497 289
6 3300005353 Ga0070669_100061303 Ga0070669_1000613034 289
7 3300005354 Ga0070675_100009539 Ga0070675_10000953911 289
8 3300005364 Ga0070673_100001247 Ga0070673_10000124710 289
9 3300005365 Ga0070688_100001596 Ga0070688_1000015968 289
10 3300005564 Ga0070664_100145285 Ga0070664_1001452854 289
11 3300005577 Ga0068857_100086156 Ga0068857_1000861562 289
12 3300005617 Ga0068859_100004846 Ga0068859_10000484613 289
13 3300005618 Ga0068864_100269422 Ga0068864_1002694221 289
14 3300005719 Ga0068861_100019954 Ga0068861_1000199542 289
15 3300005840 Ga0068870_10002774 Ga0068870_100027745 289
16 3300005844 Ga0068862_100018238 Ga0068862_1000182384 289
17 3300006844 Ga0075428_100008296 Ga0075428_10000829612 289
18 3300006880 Ga0075429_100076661 Ga0075429_1000766612 289
19 3300006931 Ga0097620_100004846 Ga0097620_10000484613 289
20 3300025315 Ga0207697_10027164 Ga0207697_100271642 289
21 3300025926 Ga0207659_10112188 Ga0207659_101121884 289
22 3300025933 Ga0207706_10017920 Ga0207706_100179208 289
23 3300025942 Ga0207689_10007158 Ga0207689_100071584 289
24 3300025972 Ga0207668_10275489 Ga0207668_102754893 289
25 3300026095 Ga0207676_10202858 Ga0207676_102028584 289
26 3300026116 Ga0207674_10130508 Ga0207674_101305084 289
27 3300026118 Ga0207675_100000144 Ga0207675_10000014420 289
28 3300027907 Ga0207428_10028420 Ga0207428_100284203 289
29 3300028380 Ga0268265_10142851 Ga0268265_101428513 289
30 3300030522 Ga0307512_10094429 Ga0307512_100944292 289
31 3300046660 Ga0495625_0323258 Ga0495625_0323258_60_968 289
32 3300050509 nmdc:mga0qj67_123552_c1 nmdc:mga0qj67_123552_c1_352_1248 289
33 3300050510 nmdc:mga06r32_369111_c1 nmdc:mga06r32_369111_c1_29_925 289
34 3300053139 Ga0500568_0061553 Ga0500568_0061553_10_918 289
35 3300049588 Ga0501072_0034199 Ga0501072_0034199_1338_2342 291
36 3300005564 Ga0070664_100120158 Ga0070664_1001201581 292
37 3300005842 Ga0068858_100347458 Ga0068858_1003474581 292
38 3300005985 Ga0081539_10047681 Ga0081539_100476812 292
39 3300006358 Ga0068871_100318261 Ga0068871_1003182611 292
40 3300013296 Ga0157374_10000660 Ga0157374_1000066010 292
41 3300013306 Ga0163162_10028216 Ga0163162_100282165 292
42 3300013308 Ga0157375_10076836 Ga0157375_100768363 292
43 3300014325 Ga0163163_10001180 Ga0163163_1000118018 292
44 3300014745 Ga0157377_10059819 Ga0157377_100598192 292
45 3300025905 Ga0207685_10066428 Ga0207685_100664281 292
46 3300025931 Ga0207644_10414872 Ga0207644_104148721 292
47 3300025944 Ga0207661_10240559 Ga0207661_102405592 292
48 3300025945 Ga0207679_10440594 Ga0207679_104405941 292
49 3300026035 Ga0207703_10589776 Ga0207703_105897762 292
50 3300036401 Ga0373937_0160956 Ga0373937_0160956_466_1380 292
51 3300046463 Ga0495653_0085649 Ga0495653_0085649_212_1126 292
52 3300046536 Ga0495587_0070587 Ga0495587_0070587_196_1110 292
53 3300047321 Ga0495676_0218171 Ga0495676_0218171_237_1154 292
54 3300047471 Ga0495684_0137943 Ga0495684_0137943_880_1794 292
55 3300005518 Ga0070699_100382417 Ga0070699_1003824172 293
56 3300047472 Ga0495686_0000010 Ga0495686_0000010_502491_503492 293
57 3300050507 nmdc:mga05p37_139120_c1 nmdc:mga05p37_139120_c1_1705_2697 294
58 3300005471 Ga0070698_100010891 Ga0070698_1000108913 295
59 3300009553 Ga0105249_10079608 Ga0105249_100796083 295
60 3300005331 Ga0070670_100113634 Ga0070670_1001136342 296
61 3300005618 Ga0068864_100098614 Ga0068864_1000986142 296
62 3300005719 Ga0068861_100632871 Ga0068861_1006328711 296
63 3300006237 Ga0097621_100055709 Ga0097621_1000557092 296
64 3300006358 Ga0068871_100067878 Ga0068871_1000678784 296
65 3300009093 Ga0105240_10003432 Ga0105240_1000343217 296
66 3300009101 Ga0105247_10001649 Ga0105247_1000164916 296
67 3300009176 Ga0105242_10136635 Ga0105242_101366353 296
68 3300009553 Ga0105249_10016077 Ga0105249_100160775 296
69 3300011119 Ga0105246_10356449 Ga0105246_103564492 296
70 3300013297 Ga0157378_10230028 Ga0157378_102300281 296
71 3300013308 Ga0157375_10021149 Ga0157375_100211494 296
72 3300014326 Ga0157380_10008120 Ga0157380_100081209 296
73 3300014745 Ga0157377_10000543 Ga0157377_1000054314 296
74 3300025913 Ga0207695_10001383 Ga0207695_1000138324 296
75 3300025914 Ga0207671_10030081 Ga0207671_100300812 296
76 3300025925 Ga0207650_10115529 Ga0207650_101155292 296
77 3300025938 Ga0207704_10026419 Ga0207704_100264192 296
78 3300026089 Ga0207648_10137853 Ga0207648_101378531 296
79 3300028380 Ga0268265_10311902 Ga0268265_103119022 296
80 3300028786 Ga0307517_10011456 Ga0307517_100114566 296
81 3300031730 Ga0307516_10000384 Ga0307516_100003845 296
82 3300031730 Ga0307516_10029937 Ga0307516_100299373 296
83 3300036401 Ga0373937_0069982 Ga0373937_0069982_405_1334 296
84 3300039437 Ga0436365_0536489 Ga0436365_0536489_127_1056 296
85 3300041410 Ga0439461_0010482 Ga0439461_0010482_41_964 296
86 3300041997 Ga0439431_0006646 Ga0439431_0006646_282_1205 296
87 3300042133 Ga0450896_005306 Ga0450896_005306_568_1491 296
88 3300042876 Ga0451577_0165345 Ga0451577_0165345_359_1285 296
89 3300044683 Ga0466965_0032936 Ga0466965_0032936_119_1063 296
90 3300046522 Ga0495643_0037362 Ga0495643_0037362_330_1253 296
91 3300046660 Ga0495625_0219417 Ga0495625_0219417_257_1192 296
92 3300049568 Ga0501031_0187570 Ga0501031_0187570_309_1232 296
93 3300049573 Ga0501037_0070492 Ga0501037_0070492_107_1030 296
94 3300049580 Ga0501046_0015881 Ga0501046_0015881_819_1742 296
95 3300049581 Ga0501047_0435881 Ga0501047_0435881_40_963 296
96 3300050511 nmdc:mga08y16_13488_c1 nmdc:mga08y16_13488_c1_4784_5707 296
97 3300050515 nmdc:mga0a205_349851_c1 nmdc:mga0a205_349851_c1_266_1189 296
98 3300053090 Ga0500646_0055853 Ga0500646_0055853_68_1003 296
99 3300053139 Ga0500568_0000974 Ga0500568_0000974_11571_12494 296
100 3300053178 Ga0500637_0030420 Ga0500637_0030420_1365_2312 296
101 3300053727 Ga0500611_000001 Ga0500611_000001_261682_262605 296
102 3300037418 Ga0395900_0021316 Ga0395900_0021316_5133_6134 301
103 3300037471 Ga0395905_0034764 Ga0395905_0034764_3187_4188 301
104 3300049686 Ga0501257_002695 Ga0501257_002695_2564_3565 302
105 3300050510 nmdc:mga06r32_196417_c1 nmdc:mga06r32_196417_c1_528_1529 302
106 3300005290 Ga0065712_10096188 Ga0065712_100961882 305
107 3300009147 Ga0114129_10033444 Ga0114129_100334442 305
108 3300025923 Ga0207681_10291270 Ga0207681_102912701 305
109 3300050507 nmdc:mga05p37_98044_c1 nmdc:mga05p37_98044_c1_2272_3273 305
110 3300003320 rootH2_10043903 rootH2_100439037 306
111 3300005344 Ga0070661_100126963 Ga0070661_1001269632 306
112 3300005366 Ga0070659_100013312 Ga0070659_1000133124 306
113 3300005616 Ga0068852_100001327 Ga0068852_1000013275 306
114 3300005618 Ga0068864_100315407 Ga0068864_1003154072 306
115 3300025904 Ga0207647_10000131 Ga0207647_1000013134 306
116 3300026095 Ga0207676_10138261 Ga0207676_101382612 306
117 3300026142 Ga0207698_10122930 Ga0207698_101229302 306
118 3300053730 Ga0500645_011827 Ga0500645_011827_1326_2333 306
119 3300005328 Ga0070676_10042967 Ga0070676_100429672 307
120 3300005334 Ga0068869_100001936 Ga0068869_10000193610 307
121 3300005338 Ga0068868_100045912 Ga0068868_1000459124 307
122 3300005364 Ga0070673_100010807 Ga0070673_1000108075 307
123 3300005530 Ga0070679_100075740 Ga0070679_1000757403 307
124 3300005617 Ga0068859_100042186 Ga0068859_1000421862 307
125 3300006844 Ga0075428_100020478 Ga0075428_1000204787 307
126 3300006847 Ga0075431_100094366 Ga0075431_1000943662 307
127 3300006931 Ga0097620_100042187 Ga0097620_1000421872 307
128 3300013306 Ga0163162_10009287 Ga0163162_100092872 307
129 3300014745 Ga0157377_10048249 Ga0157377_100482491 307
130 3300017792 Ga0163161_10094296 Ga0163161_100942962 307
131 3300025942 Ga0207689_10001835 Ga0207689_1000183511 307
132 3300025960 Ga0207651_10025954 Ga0207651_100259541 307
133 3300026023 Ga0207677_10113273 Ga0207677_101132731 307
134 3300032004 Ga0307414_10228523 Ga0307414_102285232 307
135 3300026118 Ga0207675_100004931 Ga0207675_10000493110 308
136 3300044712 Ga0453684_0141732 Ga0453684_0141732_136_1149 308
137 3300005355 Ga0070671_100059115 Ga0070671_1000591152 309
138 3300005841 Ga0068863_100313133 Ga0068863_1003131332 310
139 3300013307 Ga0157372_10152851 Ga0157372_101528513 310
140 3300017792 Ga0163161_10014179 Ga0163161_100141794 310
141 3300049579 Ga0501043_0102685 Ga0501043_0102685_941_1909 310
142 3300013307 Ga0157372_10006795 Ga0157372_100067952 311
143 3300009094 Ga0111539_10074105 Ga0111539_100741052 313
144 3300027907 Ga0207428_10065752 Ga0207428_100657522 313
145 3300013307 Ga0157372_10347052 Ga0157372_103470523 314
146 3300005471 Ga0070698_100007807 Ga0070698_1000078072 315
147 3300026095 Ga0207676_10047418 Ga0207676_100474181 315
148 3300026116 Ga0207674_10067958 Ga0207674_100679583 315
149 3300044719 Ga0466971_0025697 Ga0466971_0025697_1566_2570 315
150 3300045049 Ga0466959_0010464 Ga0466959_0010464_1002_2006 315
151 3300045836 Ga0466958_0075610 Ga0466958_0075610_728_1732 315
152 3300061719 Ga0466962_0059454 Ga0466962_0059454_183_1187 315
153 3300013306 Ga0163162_10123747 Ga0163162_101237472 317
154 iso_pu_bacteria 2738541278 2738725187 318
155 iso_pu_bacteria 2818991444 2819586164 318
156 iso_pu_bacteria 2929154850 2929158919 318
157 3300005327 Ga0070658_10074193 Ga0070658_100741932 320
158 3300013307 Ga0157372_10033946 Ga0157372_100339463 320
159 3300025909 Ga0207705_10228684 Ga0207705_102286841 320
160 3300025932 Ga0207690_10255756 Ga0207690_102557562 320
161 3300025949 Ga0207667_10338345 Ga0207667_103383451 320
162 3300044712 Ga0453684_0005543 Ga0453684_0005543_14858_15859 320
163 3300005331 Ga0070670_100250668 Ga0070670_1002506682 321
164 3300005564 Ga0070664_100151438 Ga0070664_1001514381 321
165 3300005719 Ga0068861_100344990 Ga0068861_1003449901 321
166 3300005834 Ga0068851_10039361 Ga0068851_100393613 321
167 3300009545 Ga0105237_10086507 Ga0105237_100865073 321
168 3300013296 Ga0157374_10085313 Ga0157374_100853132 321
169 3300025925 Ga0207650_10012929 Ga0207650_100129292 321
170 3300026118 Ga0207675_100264922 Ga0207675_1002649222 321
171 3300026142 Ga0207698_10206620 Ga0207698_102066203 321
172 3300037471 Ga0395905_0079295 Ga0395905_0079295_810_1811 321
173 3300053153 Ga0500616_0021796 Ga0500616_0021796_261_1265 321
174 3300003320 rootH2_10006480 rootH2_100064804 322
175 3300005293 Ga0065715_10009069 Ga0065715_100090692 322
176 3300005328 Ga0070676_10097090 Ga0070676_100970902 322
177 3300005329 Ga0070683_100007723 Ga0070683_1000077237 322
178 3300005330 Ga0070690_100012248 Ga0070690_1000122482 322
179 3300005330 Ga0070690_100161504 Ga0070690_1001615041 322
180 3300005331 Ga0070670_100025299 Ga0070670_1000252994 322
181 3300005331 Ga0070670_100279134 Ga0070670_1002791341 322
182 3300005334 Ga0068869_100111652 Ga0068869_1001116522 322
183 3300005335 Ga0070666_10024700 Ga0070666_100247001 322
184 3300005338 Ga0068868_100008858 Ga0068868_1000088581 322
185 3300005340 Ga0070689_100052763 Ga0070689_1000527633 322
186 3300005340 Ga0070689_100110204 Ga0070689_1001102043 322
187 3300005341 Ga0070691_10018640 Ga0070691_100186402 322
188 3300005344 Ga0070661_100000394 Ga0070661_10000039418 322
189 3300005344 Ga0070661_100040753 Ga0070661_1000407532 322
190 3300005347 Ga0070668_100048551 Ga0070668_1000485512 322
191 3300005353 Ga0070669_100143048 Ga0070669_1001430482 322
192 3300005353 Ga0070669_100344766 Ga0070669_1003447661 322
193 3300005354 Ga0070675_100109665 Ga0070675_1001096652 322
194 3300005354 Ga0070675_100150032 Ga0070675_1001500323 322
195 3300005355 Ga0070671_100047266 Ga0070671_1000472662 322
196 3300005355 Ga0070671_100137665 Ga0070671_1001376652 322
197 3300005356 Ga0070674_100118326 Ga0070674_1001183262 322
198 3300005364 Ga0070673_100005738 Ga0070673_1000057382 322
199 3300005365 Ga0070688_100028783 Ga0070688_1000287833 322
200 3300005365 Ga0070688_100127606 Ga0070688_1001276062 322
201 3300005366 Ga0070659_100032446 Ga0070659_1000324463 322
202 3300005367 Ga0070667_100037221 Ga0070667_1000372212 322
203 3300005456 Ga0070678_100005396 Ga0070678_1000053963 322
204 3300005456 Ga0070678_100229929 Ga0070678_1002299291 322
205 3300005457 Ga0070662_100019885 Ga0070662_1000198852 322
206 3300005457 Ga0070662_100103860 Ga0070662_1001038603 322
207 3300005459 Ga0068867_100001757 Ga0068867_1000017579 322
208 3300005459 Ga0068867_100204279 Ga0068867_1002042791 322
209 3300005535 Ga0070684_100000214 Ga0070684_10000021417 322
210 3300005535 Ga0070684_100099301 Ga0070684_1000993011 322
211 3300005539 Ga0068853_100006773 Ga0068853_1000067733 322
212 3300005539 Ga0068853_100010271 Ga0068853_1000102716 322
213 3300005539 Ga0068853_100015144 Ga0068853_1000151444 322
214 3300005543 Ga0070672_100110521 Ga0070672_1001105212 322
215 3300005544 Ga0070686_100066447 Ga0070686_1000664472 322
216 3300005544 Ga0070686_100197362 Ga0070686_1001973621 322
217 3300005545 Ga0070695_100138089 Ga0070695_1001380891 322
218 3300005547 Ga0070693_100011300 Ga0070693_1000113003 322
219 3300005548 Ga0070665_100000002 Ga0070665_100000002668 322
220 3300005563 Ga0068855_100089734 Ga0068855_1000897342 322
221 3300005564 Ga0070664_100012890 Ga0070664_1000128902 322
222 3300005564 Ga0070664_100023280 Ga0070664_1000232803 322
223 3300005564 Ga0070664_100031927 Ga0070664_1000319271 322
224 3300005564 Ga0070664_100101497 Ga0070664_1001014972 322
225 3300005577 Ga0068857_100007064 Ga0068857_1000070643 322
226 3300005577 Ga0068857_100294802 Ga0068857_1002948021 322
227 3300005577 Ga0068857_100313618 Ga0068857_1003136182 322
228 3300005614 Ga0068856_100298192 Ga0068856_1002981922 322
229 3300005616 Ga0068852_100055098 Ga0068852_1000550983 322
230 3300005616 Ga0068852_100227271 Ga0068852_1002272712 322
231 3300005617 Ga0068859_100034310 Ga0068859_1000343104 322
232 3300005618 Ga0068864_100033896 Ga0068864_1000338962 322
233 3300005618 Ga0068864_100206417 Ga0068864_1002064172 322
234 3300005718 Ga0068866_10044651 Ga0068866_100446512 322
235 3300005840 Ga0068870_10026774 Ga0068870_100267744 322
236 3300005841 Ga0068863_100010871 Ga0068863_1000108714 322
237 3300005843 Ga0068860_100090998 Ga0068860_1000909983 322
238 3300006195 Ga0075366_10006741 Ga0075366_100067414 322
239 3300006237 Ga0097621_100040412 Ga0097621_1000404123 322
240 3300006358 Ga0068871_100044471 Ga0068871_1000444714 322
241 3300006871 Ga0075434_100352295 Ga0075434_1003522951 322
242 3300006931 Ga0097620_100034309 Ga0097620_1000343094 322
243 3300009093 Ga0105240_10008651 Ga0105240_100086518 322
244 3300009174 Ga0105241_10004810 Ga0105241_100048108 322
245 3300009174 Ga0105241_10026917 Ga0105241_100269173 322
246 3300009176 Ga0105242_10009462 Ga0105242_100094626 322
247 3300009176 Ga0105242_10127686 Ga0105242_101276862 322
248 3300009177 Ga0105248_10128178 Ga0105248_101281782 322
249 3300009545 Ga0105237_10074600 Ga0105237_100746002 322
250 3300009553 Ga0105249_10011029 Ga0105249_100110298 322
251 3300009553 Ga0105249_10051577 Ga0105249_100515772 322
252 3300009553 Ga0105249_10125767 Ga0105249_101257673 322
253 3300010375 Ga0105239_10000925 Ga0105239_1000092510 322
254 3300013102 Ga0157371_10108317 Ga0157371_101083172 322
255 3300013104 Ga0157370_10006558 Ga0157370_100065584 322
256 3300013104 Ga0157370_10006824 Ga0157370_1000682411 322
257 3300013104 Ga0157370_10468817 Ga0157370_104688172 322
258 3300013105 Ga0157369_10017140 Ga0157369_100171403 322
259 3300013296 Ga0157374_10000013 Ga0157374_10000013355 322
260 3300013296 Ga0157374_10090356 Ga0157374_100903563 322
261 3300013297 Ga0157378_10074088 Ga0157378_100740882 322
262 3300013306 Ga0163162_10001229 Ga0163162_1000122919 322
263 3300013306 Ga0163162_10040942 Ga0163162_100409424 322
264 3300013306 Ga0163162_10146826 Ga0163162_101468262 322
265 3300013306 Ga0163162_10153352 Ga0163162_101533522 322
266 3300013307 Ga0157372_10208085 Ga0157372_102080852 322
267 3300013307 Ga0157372_10286036 Ga0157372_102860361 322
268 3300013308 Ga0157375_10122934 Ga0157375_101229343 322
269 3300013308 Ga0157375_10193067 Ga0157375_101930671 322
270 3300013308 Ga0157375_10384595 Ga0157375_103845952 322
271 3300013308 Ga0157375_10600442 Ga0157375_106004421 322
272 3300014326 Ga0157380_10106873 Ga0157380_101068734 322
273 3300014745 Ga0157377_10095509 Ga0157377_100955092 322
274 3300014968 Ga0157379_10080009 Ga0157379_100800093 322
275 3300014968 Ga0157379_10106468 Ga0157379_101064683 322
276 3300014968 Ga0157379_10135241 Ga0157379_101352412 322
277 3300014968 Ga0157379_10219568 Ga0157379_102195682 322
278 3300014969 Ga0157376_10001116 Ga0157376_1000111616 322
279 3300014969 Ga0157376_10017768 Ga0157376_100177684 322
280 3300014969 Ga0157376_10156051 Ga0157376_101560512 322
281 3300025899 Ga0207642_10007648 Ga0207642_100076482 322
282 3300025899 Ga0207642_10015556 Ga0207642_100155563 322
283 3300025907 Ga0207645_10020161 Ga0207645_100201612 322
284 3300025908 Ga0207643_10007039 Ga0207643_100070393 322
285 3300025911 Ga0207654_10002774 Ga0207654_100027748 322
286 3300025912 Ga0207707_10004563 Ga0207707_100045632 322
287 3300025913 Ga0207695_10067016 Ga0207695_100670162 322
288 3300025914 Ga0207671_10016606 Ga0207671_100166067 322
289 3300025920 Ga0207649_10002535 Ga0207649_100025356 322
290 3300025920 Ga0207649_10068936 Ga0207649_100689362 322
291 3300025921 Ga0207652_10013744 Ga0207652_100137446 322
292 3300025931 Ga0207644_10193148 Ga0207644_101931482 322
293 3300025931 Ga0207644_10294658 Ga0207644_102946582 322
294 3300025932 Ga0207690_10120079 Ga0207690_101200792 322
295 3300025933 Ga0207706_10009526 Ga0207706_100095269 322
296 3300025934 Ga0207686_10001307 Ga0207686_1000130710 322
297 3300025934 Ga0207686_10003874 Ga0207686_100038746 322
298 3300025937 Ga0207669_10063989 Ga0207669_100639893 322
299 3300025940 Ga0207691_10011768 Ga0207691_100117688 322
300 3300025940 Ga0207691_10075290 Ga0207691_100752902 322
301 3300025941 Ga0207711_10315766 Ga0207711_103157661 322
302 3300025942 Ga0207689_10015447 Ga0207689_100154472 322
303 3300025942 Ga0207689_10015585 Ga0207689_100155854 322
304 3300025942 Ga0207689_10035848 Ga0207689_100358482 322
305 3300025942 Ga0207689_10266542 Ga0207689_102665421 322
306 3300025944 Ga0207661_10009240 Ga0207661_100092404 322
307 3300025944 Ga0207661_10157241 Ga0207661_101572412 322
308 3300025945 Ga0207679_10001053 Ga0207679_1000105314 322
309 3300025949 Ga0207667_10065865 Ga0207667_100658652 322
310 3300025949 Ga0207667_10273109 Ga0207667_102731092 322
311 3300025960 Ga0207651_10084808 Ga0207651_100848082 322
312 3300025960 Ga0207651_10157336 Ga0207651_101573361 322
313 3300025961 Ga0207712_10016274 Ga0207712_100162742 322
314 3300026035 Ga0207703_10042603 Ga0207703_100426034 322
315 3300026041 Ga0207639_10003626 Ga0207639_100036264 322
316 3300026041 Ga0207639_10005873 Ga0207639_100058733 322
317 3300026041 Ga0207639_10020635 Ga0207639_100206353 322
318 3300026041 Ga0207639_10176385 Ga0207639_101763852 322
319 3300026041 Ga0207639_10324193 Ga0207639_103241932 322
320 3300026078 Ga0207702_10018882 Ga0207702_100188827 322
321 3300026088 Ga0207641_10010722 Ga0207641_100107222 322
322 3300026089 Ga0207648_10004672 Ga0207648_100046727 322
323 3300026089 Ga0207648_10025892 Ga0207648_100258927 322
324 3300026089 Ga0207648_10054988 Ga0207648_100549882 322
325 3300026089 Ga0207648_10060785 Ga0207648_100607854 322
326 3300026089 Ga0207648_10245274 Ga0207648_102452742 322
327 3300026116 Ga0207674_10004608 Ga0207674_1000460813 322
328 3300026116 Ga0207674_10060286 Ga0207674_100602863 322
329 3300026116 Ga0207674_10098518 Ga0207674_100985183 322
330 3300026121 Ga0207683_10016585 Ga0207683_100165854 322
331 3300026121 Ga0207683_10137068 Ga0207683_101370681 322
332 3300026121 Ga0207683_10535235 Ga0207683_105352351 322
333 3300026142 Ga0207698_10013000 Ga0207698_100130003 322
334 3300028379 Ga0268266_10000169 Ga0268266_1000016983 322
335 3300028381 Ga0268264_10060770 Ga0268264_100607703 322
336 3300031247 Ga0265340_10067647 Ga0265340_100676472 322
337 3300031251 Ga0265327_10009830 Ga0265327_100098303 322
338 3300031595 Ga0265313_10013924 Ga0265313_100139245 322
339 3300031824 Ga0307413_10119337 Ga0307413_101193372 322
340 3300032004 Ga0307414_10011156 Ga0307414_100111562 322
341 3300033180 Ga0307510_10000156 Ga0307510_1000015652 322
342 3300042001 Ga0439441_007657 Ga0439441_007657_329_1321 322
343 3300042007 Ga0439449_0005282 Ga0439449_0005282_194_1186 322
344 3300044694 Ga0466963_0217485 Ga0466963_0217485_211_1215 322
345 3300046537 Ga0495598_0050145 Ga0495598_0050145_82_1074 322
346 3300046616 Ga0495668_0002479 Ga0495668_0002479_6584_7603 322
347 3300046648 Ga0495611_0000061 Ga0495611_0000061_19978_20991 322
348 3300046683 Ga0495658_0168550 Ga0495658_0168550_143_1135 322
349 3300046694 Ga0495649_0036653 Ga0495649_0036653_641_1645 322
350 3300047320 Ga0495672_0003985 Ga0495672_0003985_1503_2516 322
351 3300047320 Ga0495672_0117877 Ga0495672_0117877_171_1184 322
352 3300047443 Ga0495687_001475 Ga0495687_001475_7656_8663 322
353 3300047472 Ga0495686_0051295 Ga0495686_0051295_1099_2100 322
354 3300048911 Ga0496108_0290753 Ga0496108_0290753_319_1332 322
355 3300049569 Ga0501032_0021890 Ga0501032_0021890_235_1236 322
356 3300049572 Ga0501036_0025581 Ga0501036_0025581_3908_4909 322
357 3300049579 Ga0501043_0016479 Ga0501043_0016479_3182_4183 322
358 3300049668 Ga0501233_006178 Ga0501233_006178_268_1269 322
359 3300049742 Ga0501080_0206999 Ga0501080_0206999_489_1490 322
360 3300049744 Ga0501083_0261018 Ga0501083_0261018_47_1048 322
361 3300049823 Ga0501044_0292065 Ga0501044_0292065_479_1480 322
362 3300050493 nmdc:mga0k408_77004_c1 nmdc:mga0k408_77004_c1_390_1391 322
363 3300050512 nmdc:mga0n895_419427_c1 nmdc:mga0n895_419427_c1_279_1280 322
364 3300053086 Ga0500578_0000386 Ga0500578_0000386_19643_20659 322
365 3300053092 Ga0500583_0000035 Ga0500583_0000035_8629_9642 322
366 3300053134 Ga0500658_0054425 Ga0500658_0054425_130_1143 322
367 3300053147 Ga0500589_044178 Ga0500589_044178_334_1347 322
368 3300053151 Ga0500604_0005466 Ga0500604_0005466_512_1516 322
369 3300053177 Ga0500636_0111172 Ga0500636_0111172_261_1274 322
370 3300013100 Ga0157373_10007437 Ga0157373_100074376 324
371 3300009101 Ga0105247_10044306 Ga0105247_100443062 326
372 3300013296 Ga0157374_10180859 Ga0157374_101808593 326
373 3300014325 Ga0163163_10214717 Ga0163163_102147172 326
374 3300014968 Ga0157379_10068036 Ga0157379_100680363 326
375 3300025925 Ga0207650_10336255 Ga0207650_103362551 326
376 3300028381 Ga0268264_10199516 Ga0268264_101995163 326
377 3300044712 Ga0453684_0023709 Ga0453684_0023709_2201_3244 326
378 3300005295 Ga0065707_10176754 Ga0065707_101767542 327
379 3300005456 Ga0070678_100045196 Ga0070678_1000451963 327
380 3300005843 Ga0068860_100000003 Ga0068860_100000003289 327
381 3300028381 Ga0268264_10000063 Ga0268264_10000063206 327
382 3300046472 Ga0495580_0088246 Ga0495580_0088246_990_2015 327
383 3300005356 Ga0070674_100214728 Ga0070674_1002147281 329
384 3300005364 Ga0070673_100149311 Ga0070673_1001493111 329
385 3300009176 Ga0105242_10123934 Ga0105242_101239343 329
386 3300005331 Ga0070670_100070140 Ga0070670_1000701402 334
387 3300005353 Ga0070669_100050475 Ga0070669_1000504753 334
388 3300005354 Ga0070675_100019461 Ga0070675_1000194615 334
389 3300005365 Ga0070688_100016679 Ga0070688_1000166793 334
390 3300025926 Ga0207659_10002722 Ga0207659_100027224 334
391 3300002077 JGI24744J21845_10008081 JGI24744J21845_100080812 335
392 3300005328 Ga0070676_10010090 Ga0070676_100100902 335
393 3300005329 Ga0070683_100013225 Ga0070683_1000132256 335
394 3300005333 Ga0070677_10011541 Ga0070677_100115414 335
395 3300005334 Ga0068869_100015920 Ga0068869_1000159203 335
396 3300005334 Ga0068869_100030113 Ga0068869_1000301132 335
397 3300005338 Ga0068868_100137690 Ga0068868_1001376902 335
398 3300005344 Ga0070661_100003541 Ga0070661_1000035413 335
399 3300005354 Ga0070675_100022347 Ga0070675_1000223474 335
400 3300005364 Ga0070673_100001051 Ga0070673_10000105110 335
401 3300005367 Ga0070667_100184211 Ga0070667_1001842111 335
402 3300005456 Ga0070678_100001383 Ga0070678_10000138310 335
403 3300005459 Ga0068867_100032393 Ga0068867_1000323934 335
404 3300005466 Ga0070685_10088836 Ga0070685_100888361 335
405 3300005539 Ga0068853_100037422 Ga0068853_1000374224 335
406 3300005543 Ga0070672_100115006 Ga0070672_1001150062 335
407 3300005548 Ga0070665_100029337 Ga0070665_1000293373 335
408 3300005564 Ga0070664_100015514 Ga0070664_1000155144 335
409 3300005577 Ga0068857_100005631 Ga0068857_10000563113 335
410 3300005617 Ga0068859_100109144 Ga0068859_1001091443 335
411 3300005718 Ga0068866_10093264 Ga0068866_100932643 335
412 3300005841 Ga0068863_100003354 Ga0068863_1000033545 335
413 3300005841 Ga0068863_100258676 Ga0068863_1002586762 335
414 3300006237 Ga0097621_100017133 Ga0097621_1000171333 335
415 3300006881 Ga0068865_100007355 Ga0068865_1000073554 335
416 3300006931 Ga0097620_100109137 Ga0097620_1001091373 335
417 3300009176 Ga0105242_10017510 Ga0105242_100175102 335
418 3300013296 Ga0157374_10087491 Ga0157374_100874913 335
419 3300013297 Ga0157378_10111054 Ga0157378_101110543 335
420 3300025893 Ga0207682_10008809 Ga0207682_100088093 335
421 3300025901 Ga0207688_10005909 Ga0207688_100059093 335
422 3300025904 Ga0207647_10036676 Ga0207647_100366763 335
423 3300025907 Ga0207645_10007635 Ga0207645_100076355 335
424 3300025920 Ga0207649_10044779 Ga0207649_100447791 335
425 3300025925 Ga0207650_10040148 Ga0207650_100401483 335
426 3300025925 Ga0207650_10173540 Ga0207650_101735401 335
427 3300025932 Ga0207690_10015145 Ga0207690_100151452 335
428 3300025932 Ga0207690_10129863 Ga0207690_101298631 335
429 3300025933 Ga0207706_10012285 Ga0207706_1001228510 335
430 3300025933 Ga0207706_10084665 Ga0207706_100846652 335
431 3300025936 Ga0207670_10185044 Ga0207670_101850441 335
432 3300025937 Ga0207669_10237634 Ga0207669_102376342 335
433 3300025940 Ga0207691_10010693 Ga0207691_100106935 335
434 3300025940 Ga0207691_10043215 Ga0207691_100432153 335
435 3300025942 Ga0207689_10001731 Ga0207689_100017315 335
436 3300025942 Ga0207689_10001814 Ga0207689_1000181417 335
437 3300025945 Ga0207679_10059670 Ga0207679_100596703 335
438 3300025960 Ga0207651_10009460 Ga0207651_100094605 335
439 3300025960 Ga0207651_10068785 Ga0207651_100687853 335
440 3300025981 Ga0207640_10034289 Ga0207640_100342893 335
441 3300026041 Ga0207639_10279993 Ga0207639_102799932 335
442 3300026067 Ga0207678_10086652 Ga0207678_100866522 335
443 3300026088 Ga0207641_10000422 Ga0207641_1000042215 335
444 3300026089 Ga0207648_10003325 Ga0207648_100033254 335
445 3300026095 Ga0207676_10002771 Ga0207676_100027712 335
446 3300026116 Ga0207674_10006491 Ga0207674_100064916 335
447 3300026118 Ga0207675_100115909 Ga0207675_1001159091 335
448 3300026121 Ga0207683_10004506 Ga0207683_100045064 335
449 3300026121 Ga0207683_10078229 Ga0207683_100782294 335
450 3300028381 Ga0268264_10013279 Ga0268264_100132794 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01018

GTP1_OBG

GTP1/OBG

7

160

0.98

PF01926

MMR_HSR1

50S ribosome-binding GTPase

163

283

0.9

PF02421

FeoB_N

Ferrous iron transport protein B

162

323

0.75

Feature Viewer

pLDDT pTM Quality
60.87 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map