F446537

General Info

Members Datasets Scaffolds Average Seq Length
450 232 900 238

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100000138|Ga0070667_10000013831
Length 253
Sequence VTDATQATQHVIAGQTLTMPVQIRKATQHMAMFSVDADAAQRMIDDSGLQVCRYRPNKAVVVLMLVHYVDGDLGQYFEYGTNVMVNPPGSNASGLKALQSAGAYIHHLPVDQTFTLEAGRSIWGYPKVMADFTVRGANDRAGARGRHPFGFDVTIDGQFAVGMDFKPGLPVPSAFTAKPQVHPTYSHMDGVIRETAGEMRSSGVRYRLGGATVRLGEHPYARELASLGFPKRAMISSSTDNVAMTFGDAKEIA

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
131 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
134 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
135 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
218 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
221 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
226 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
227 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
228 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
229 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
230 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
231 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
232 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 0
Isolates 1.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.67
Nodule 0
Rhizoplane 13.33
Rhizosphere 53.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100000138 3300005367 Bacteria 92766
2 JGI24744J21845_10000433 3300002077 Bacteria 7352
3 JGI24034J26672_10031356 3300002239 Bacteria 867
4 Ga0055540_1000129 3300003792 Bacteria 76241
5 Ga0055540_1000931 3300003792 Bacteria 19067
6 Ga0055540_1002507 3300003792 Bacteria 9600
7 Ga0055540_1006033 3300003792 Bacteria 4907
8 Ga0070670_100086229 3300005331 Bacteria 2698
9 Ga0068869_100019271 3300005334 Bacteria 4657
10 Ga0070666_10009772 3300005335 Bacteria 5995
11 Ga0070666_10179312 3300005335 Bacteria 1485
12 Ga0070682_100019542 3300005337 Bacteria 3975
13 Ga0068868_100001283 3300005338 Bacteria 17299
14 Ga0070689_100051596 3300005340 Bacteria 3180
15 Ga0070691_10032885 3300005341 Bacteria 2438
16 Ga0070668_100000292 3300005347 Bacteria 32961
17 Ga0070668_100002701 3300005347 Bacteria 13054
18 Ga0070671_100001930 3300005355 Bacteria 15892
19 Ga0070674_100009756 3300005356 Bacteria 5768
20 Ga0070688_100003046 3300005365 Bacteria 8552
21 Ga0070659_100392722 3300005366 Bacteria 1170
22 Ga0070667_100001166 3300005367 Bacteria 23879
23 Ga0070667_100002543 3300005367 Bacteria 15874
24 Ga0070667_100237637 3300005367 Bacteria 1626
25 Ga0070714_100103244 3300005435 Bacteria 2514
26 Ga0070710_10002096 3300005437 Bacteria 9458
27 Ga0070711_100001608 3300005439 Bacteria 12466
28 Ga0070694_100180493 3300005444 Bacteria 1561
29 Ga0070663_100114443 3300005455 Bacteria 2031
30 Ga0070663_100167732 3300005455 Bacteria 1695
31 Ga0070678_100005329 3300005456 Bacteria 7422
32 Ga0070662_100242130 3300005457 Bacteria 1447
33 Ga0068867_100004647 3300005459 Bacteria 9660
34 Ga0070685_10032349 3300005466 Bacteria 2929
35 Ga0070685_10136695 3300005466 Bacteria 1538
36 Ga0070685_10362482 3300005466 Bacteria 994
37 Ga0068853_100030227 3300005539 Bacteria 4574
38 Ga0068853_100092885 3300005539 Bacteria 2655
39 Ga0070672_100102893 3300005543 Bacteria 2319
40 Ga0070686_100613551 3300005544 Bacteria 859
41 Ga0070665_100003261 3300005548 Bacteria 17405
42 Ga0070665_100031738 3300005548 Bacteria 5316
43 Ga0070704_100001375 3300005549 Bacteria 12911
44 Ga0068855_100300510 3300005563 Bacteria 1777
45 Ga0068854_100060090 3300005578 Bacteria 2748
46 Ga0068854_100238308 3300005578 Bacteria 1447
47 Ga0070702_100000803 3300005615 Bacteria 11995
48 Ga0068852_100051370 3300005616 Bacteria 3537
49 Ga0068859_100002961 3300005617 Bacteria 17226
50 Ga0068866_10002608 3300005718 Bacteria 7448
51 Ga0068863_100001295 3300005841 Bacteria 24969
52 Ga0068863_100257393 3300005841 Bacteria 1687
53 Ga0068863_100315951 3300005841 Bacteria 1517
54 Ga0068858_100065280 3300005842 Bacteria 3367
55 Ga0068858_100120534 3300005842 Bacteria 2453
56 Ga0068858_100482717 3300005842 Bacteria 1196
57 Ga0068860_100000079 3300005843 Bacteria 170752
58 Ga0068860_100129952 3300005843 Bacteria 2416
59 Ga0068862_100000990 3300005844 Bacteria 27177
60 Ga0081455_10047947 3300005937 Bacteria 3695
61 Ga0081455_10082924 3300005937 Bacteria 2621
62 Ga0075365_10003354 3300006038 Bacteria 8235
63 Ga0075365_10021385 3300006038 Bacteria 4035
64 Ga0075365_10171949 3300006038 Bacteria 1512
65 Ga0075365_10206792 3300006038 Bacteria 1376
66 Ga0075368_10004668 3300006042 Bacteria 4660
67 Ga0075363_100002131 3300006048 Bacteria 7956
68 Ga0075363_100015502 3300006048 Bacteria 3748
69 Ga0075363_100035366 3300006048 Bacteria 2614
70 Ga0075363_100043219 3300006048 Bacteria 2383
71 Ga0075363_100175062 3300006048 Bacteria 1219
72 Ga0075363_100353163 3300006048 Bacteria 859
73 Ga0075364_10000448 3300006051 Bacteria 20715
74 Ga0075364_10002666 3300006051 Bacteria 10022
75 Ga0075364_10009776 3300006051 Bacteria 5766
76 Ga0075364_10030095 3300006051 Bacteria 3483
77 Ga0075364_10041532 3300006051 Bacteria 2986
78 Ga0075364_10053129 3300006051 Bacteria 2648
79 Ga0075364_10053756 3300006051 Bacteria 2632
80 Ga0075364_10075529 3300006051 Bacteria 2223
81 Ga0075364_10097257 3300006051 Bacteria 1958
82 Ga0075364_10157584 3300006051 Bacteria 1531
83 Ga0075364_10227000 3300006051 Bacteria 1268
84 Ga0075364_10471634 3300006051 Bacteria 858
85 Ga0070716_100008402 3300006173 Bacteria 5121
86 Ga0070712_100002794 3300006175 Bacteria 10787
87 Ga0075362_10013689 3300006177 Bacteria 3254
88 Ga0075362_10019922 3300006177 Bacteria 2798
89 Ga0075362_10065061 3300006177 Bacteria 1655
90 Ga0075362_10070081 3300006177 Bacteria 1600
91 Ga0075362_10072479 3300006177 Bacteria 1575
92 Ga0075367_10101459 3300006178 Bacteria 1760
93 Ga0075367_10113793 3300006178 Bacteria 1663
94 Ga0075367_10146048 3300006178 Bacteria 1467
95 Ga0075369_10000137 3300006186 Bacteria 20418
96 Ga0075369_10010342 3300006186 Bacteria 3647
97 Ga0075369_10014339 3300006186 Bacteria 3165
98 Ga0075369_10018404 3300006186 Bacteria 2844
99 Ga0075369_10035170 3300006186 Bacteria 2129
100 Ga0075369_10040547 3300006186 Bacteria 1991
101 Ga0075369_10060552 3300006186 Bacteria 1651
102 Ga0075370_10003106 3300006353 Bacteria 7839
103 Ga0075370_10003654 3300006353 Bacteria 7366
104 Ga0075370_10060589 3300006353 Bacteria 2156
105 Ga0075370_10085441 3300006353 Bacteria 1817
106 Ga0075370_10087721 3300006353 Bacteria 1793
107 Ga0075370_10203184 3300006353 Bacteria 1169
108 Ga0075430_100024778 3300006846 Bacteria 5103
109 Ga0075433_10783714 3300006852 Bacteria 833
110 Ga0068865_100005797 3300006881 Bacteria 7508
111 Ga0097620_100002961 3300006931 Bacteria 17226
112 Ga0099795_10033180 3300007788 Bacteria 1791
113 Ga0105250_10099419 3300009092 Bacteria 1187
114 Ga0111539_10318040 3300009094 Bacteria 1811
115 Ga0105245_10009271 3300009098 Bacteria 8583
116 Ga0105245_10546664 3300009098 Bacteria 1180
117 Ga0105247_10000044 3300009101 Bacteria 153728
118 Ga0105247_10001271 3300009101 Bacteria 18679
119 Ga0114129_10126975 3300009147 Bacteria 3506
120 Ga0105243_10001493 3300009148 Bacteria 20484
121 Ga0105243_10276011 3300009148 Bacteria 1512
122 Ga0105248_10000060 3300009177 Bacteria 131634
123 Ga0105248_10019802 3300009177 Bacteria 7453
124 Ga0105248_10028758 3300009177 Bacteria 6195
125 Ga0105237_10010789 3300009545 Bacteria 9698
126 Ga0105237_10016207 3300009545 Bacteria 7751
127 Ga0105237_10043109 3300009545 Bacteria 4547
128 Ga0105237_10167424 3300009545 Bacteria 2197
129 Ga0105238_10122326 3300009551 Bacteria 2582
130 Ga0105249_10000049 3300009553 Bacteria 169899
131 Ga0105249_10048412 3300009553 Bacteria 3875
132 Ga0105249_10292407 3300009553 Bacteria 1631
133 Ga0099796_10007304 3300010159 Bacteria 2882
134 Ga0105239_10057520 3300010375 Bacteria 4265
135 Ga0105239_10131340 3300010375 Bacteria 2786
136 Ga0157374_10262831 3300013296 Bacteria 1700
137 Ga0157378_10008665 3300013297 Bacteria 8852
138 Ga0163162_10058389 3300013306 Bacteria 3887
139 Ga0163162_10070740 3300013306 Bacteria 3540
140 Ga0163162_10229940 3300013306 Bacteria 1985
141 Ga0163162_10257984 3300013306 Bacteria 1875
142 Ga0157375_10032533 3300013308 Bacteria 4947
143 Ga0163163_10146392 3300014325 Bacteria 2406
144 Ga0157380_10001369 3300014326 Bacteria 15887
145 Ga0182008_10040248 3300014497 Bacteria 2334
146 Ga0157379_10103660 3300014968 Bacteria 2553
147 Ga0163161_10004651 3300017792 Bacteria 9548
148 Ga0213876_10070330 3300021384 Bacteria 1849
149 Ga0209673_1010865 3300025273 Bacteria 3803
150 Ga0209025_1031175 3300025294 Bacteria 2529
151 Ga0209051_1000034 3300025303 Bacteria 371498
152 Ga0209051_1000782 3300025303 Bacteria 33613
153 Ga0209051_1002904 3300025303 Bacteria 11753
154 Ga0209051_1012387 3300025303 Bacteria 4129
155 Ga0207692_10008616 3300025898 Bacteria 4228
156 Ga0207642_10001462 3300025899 Bacteria 7321
157 Ga0207710_10000066 3300025900 Bacteria 153734
158 Ga0207688_10001994 3300025901 Bacteria 10952
159 Ga0207688_10424795 3300025901 Bacteria 826
160 Ga0207680_10116943 3300025903 Bacteria 1738
161 Ga0207647_10031429 3300025904 Bacteria 3417
162 Ga0207707_10558936 3300025912 Bacteria 972
163 Ga0207671_10008020 3300025914 Bacteria 9036
164 Ga0207671_10054993 3300025914 Bacteria 2949
165 Ga0207693_10001084 3300025915 Bacteria 24435
166 Ga0207693_10117889 3300025915 Bacteria 2085
167 Ga0207650_10129568 3300025925 Bacteria 1973
168 Ga0207687_10003134 3300025927 Bacteria 11216
169 Ga0207700_10059979 3300025928 Bacteria 2879
170 Ga0207664_10111210 3300025929 Bacteria 2279
171 Ga0207644_10024540 3300025931 Bacteria 4140
172 Ga0207690_10634209 3300025932 Bacteria 874
173 Ga0207706_10025606 3300025933 Bacteria 5284
174 Ga0207709_10195631 3300025935 Bacteria 1440
175 Ga0207709_10312179 3300025935 Bacteria 1173
176 Ga0207669_10000441 3300025937 Bacteria 18034
177 Ga0207704_10450257 3300025938 Bacteria 1027
178 Ga0207665_10005690 3300025939 Bacteria 8302
179 Ga0207665_10289336 3300025939 Bacteria 1222
180 Ga0207711_10000058 3300025941 Bacteria 133317
181 Ga0207689_10012063 3300025942 Bacteria 7404
182 Ga0207712_10000038 3300025961 Bacteria 192762
183 Ga0207712_10115467 3300025961 Bacteria 2021
184 Ga0207668_10006592 3300025972 Bacteria 6864
185 Ga0207668_10040517 3300025972 Bacteria 3143
186 Ga0207640_10001012 3300025981 Bacteria 15547
187 Ga0207658_10000061 3300025986 Bacteria 119045
188 Ga0207658_10009195 3300025986 Bacteria 6700
189 Ga0207658_10011749 3300025986 Bacteria 5963
190 Ga0207658_10047862 3300025986 Bacteria 3132
191 Ga0207658_10093327 3300025986 Bacteria 2340
192 Ga0207658_10109005 3300025986 Bacteria 2185
193 Ga0207658_10512843 3300025986 Bacteria 1069
194 Ga0207703_10070172 3300026035 Bacteria 2891
195 Ga0207639_10013613 3300026041 Bacteria 5700
196 Ga0207639_10051576 3300026041 Bacteria 3130
197 Ga0207678_10039043 3300026067 Bacteria 4121
198 Ga0207678_10224234 3300026067 Bacteria 1609
199 Ga0207708_10001567 3300026075 Bacteria 17081
200 Ga0207641_10002714 3300026088 Bacteria 16147
201 Ga0207641_10011242 3300026088 Bacteria 7343
202 Ga0207648_10000940 3300026089 Bacteria 32902
203 Ga0207675_100002612 3300026118 Bacteria 17825
204 Ga0207683_10000387 3300026121 Bacteria 40593
205 Ga0268266_10006695 3300028379 Bacteria 10512
206 Ga0268266_10020586 3300028379 Bacteria 5620
207 Ga0268265_10000053 3300028380 Bacteria 170215
208 Ga0268264_10000017 3300028381 Bacteria 498037
209 Ga0268264_10106251 3300028381 Bacteria 2450
210 Ga0265327_10000901 3300031251 Bacteria 43691
211 Ga0307407_10066166 3300031903 Bacteria 2131
212 Ga0307409_100198071 3300031995 Bacteria 1794
213 Ga0307416_100024643 3300032002 Bacteria 4396
214 Ga0307415_100062638 3300032126 Bacteria 2581
215 Ga0373939_0157615 3300035114 Bacteria 831
216 Ga0373943_0196475 3300035170 Bacteria 1115
217 Ga0373931_0132299 3300035691 Bacteria 1437
218 Ga0436364_0564307 3300037853 Bacteria 5323
219 Ga0436365_0208486 3300039437 Bacteria 2982
220 Ga0436365_0926650 3300039437 Bacteria 14533
221 Ga0436365_1126865 3300039437 Bacteria 14337
222 Ga0436361_0107916 3300039447 Bacteria 885
223 Ga0439461_0000292 3300041410 Bacteria 7154
224 Ga0439461_0001773 3300041410 Bacteria 3378
225 Ga0439461_0003301 3300041410 Bacteria 2649
226 Ga0439466_0007563 3300041411 Bacteria 4106
227 Ga0439466_0010775 3300041411 Bacteria 3394
228 Ga0439465_0002066 3300041413 Bacteria 6583
229 Ga0439465_0012974 3300041413 Bacteria 2604
230 Ga0439465_0023849 3300041413 Bacteria 1926
231 Ga0451795_1235270 3300041456 Bacteria 1188
232 Ga0439431_0005171 3300041997 Bacteria 2876
233 Ga0439431_0012265 3300041997 Bacteria 1967
234 Ga0439445_0059804 3300042004 Bacteria 1040
235 Ga0439434_0002556 3300042435 Bacteria 5297
236 Ga0439434_0017842 3300042435 Bacteria 2124
237 Ga0439435_0188627 3300042436 Bacteria 676
238 Ga0466972_0003232 3300044658 Bacteria 8084
239 Ga0466972_0005507 3300044658 Bacteria 6342
240 Ga0466972_0013882 3300044658 Bacteria 4042
241 Ga0466965_0005833 3300044683 Bacteria 5558
242 Ga0466965_0016465 3300044683 Bacteria 3519
243 Ga0466965_0020185 3300044683 Bacteria 3201
244 Ga0466965_0207690 3300044683 Bacteria 1040
245 Ga0466966_0025289 3300044684 Bacteria 3879
246 Ga0466961_0001983 3300044693 Bacteria 12737
247 Ga0466963_0502244 3300044694 Bacteria 856
248 Ga0466964_0078845 3300044706 Bacteria 1409
249 Ga0466971_0038556 3300044719 Bacteria 2144
250 Ga0466971_0119126 3300044719 Bacteria 1221
251 Ga0466968_0001660 3300044735 Bacteria 8024
252 Ga0466968_0036939 3300044735 Bacteria 2048
253 Ga0466970_0004845 3300044765 Bacteria 6641
254 Ga0466970_0127882 3300044765 Bacteria 1394
255 Ga0466960_0003893 3300044901 Bacteria 5791
256 Ga0466960_0043505 3300044901 Bacteria 2136
257 Ga0466960_0321706 3300044901 Bacteria 876
258 Ga0466959_0165059 3300045049 Bacteria 1555
259 Ga0466958_0081551 3300045836 Bacteria 1991
260 Ga0466967_0037949 3300045976 Bacteria 4128
261 Ga0466967_0088936 3300045976 Bacteria 2804
262 Ga0466967_0219621 3300045976 Bacteria 1805
263 Ga0466967_0222030 3300045976 Bacteria 1796
264 Ga0466967_0525557 3300045976 Bacteria 1163
265 Ga0495603_0082125 3300046455 Bacteria 1888
266 Ga0495638_0008363 3300046460 Bacteria 7339
267 Ga0495641_0073666 3300046461 Bacteria 1532
268 Ga0495582_0029031 3300046473 Bacteria 3037
269 Ga0495648_0008999 3300046524 Bacteria 7796
270 Ga0495665_0229691 3300046531 Bacteria 958
271 Ga0495640_0078954 3300046533 Bacteria 2192
272 Ga0495640_0087538 3300046533 Bacteria 2060
273 Ga0495586_0383210 3300046535 Bacteria 809
274 Ga0495658_0058158 3300046683 Bacteria 2211
275 Ga0495624_0026749 3300046690 Bacteria 3780
276 Ga0495671_0138425 3300046692 Bacteria 1186
277 Ga0495581_0113157 3300047315 Bacteria 1578
278 Ga0495674_0386421 3300047319 Bacteria 1132
279 Ga0495672_0020366 3300047320 Bacteria 4349
280 Ga0495672_0132915 3300047320 Bacteria 1307
281 Ga0495676_0073470 3300047321 Bacteria 2622
282 Ga0495686_0006852 3300047472 Bacteria 8635
283 Ga0495593_0030155 3300047673 Bacteria 2969
284 Ga0496100_0000071 3300048903 Bacteria 56566
285 Ga0496100_0000646 3300048903 Bacteria 16548
286 Ga0496100_0001138 3300048903 Bacteria 12925
287 Ga0496100_0015138 3300048903 Bacteria 4500
288 Ga0496100_0063306 3300048903 Bacteria 2444
289 Ga0496100_0188967 3300048903 Bacteria 1494
290 Ga0496100_0607228 3300048903 Bacteria 850
291 Ga0496101_0000059 3300048904 Bacteria 130521
292 Ga0496101_0000201 3300048904 Bacteria 45817
293 Ga0496101_0002649 3300048904 Bacteria 10993
294 Ga0496101_0006279 3300048904 Bacteria 7650
295 Ga0496101_0021613 3300048904 Bacteria 4422
296 Ga0496101_0237230 3300048904 Bacteria 1419
297 Ga0496102_0000065 3300048905 Bacteria 161370
298 Ga0496102_0000227 3300048905 Bacteria 74131
299 Ga0496102_0000844 3300048905 Bacteria 29434
300 Ga0496102_0005876 3300048905 Bacteria 10443
301 Ga0496102_0068031 3300048905 Bacteria 3267
302 Ga0496102_0071313 3300048905 Bacteria 3190
303 Ga0496102_0082041 3300048905 Bacteria 2974
304 Ga0496102_0492590 3300048905 Bacteria 1147
305 Ga0496103_0000048 3300048906 Bacteria 160911
306 Ga0496103_0000514 3300048906 Bacteria 31928
307 Ga0496103_0003502 3300048906 Bacteria 9597
308 Ga0496103_0091062 3300048906 Bacteria 1924
309 Ga0496104_0003559 3300048907 Bacteria 13440
310 Ga0496104_0027527 3300048907 Bacteria 5262
311 Ga0496105_0010371 3300048908 Bacteria 7326
312 Ga0496105_0015757 3300048908 Bacteria 6032
313 Ga0496106_0001439 3300048909 Bacteria 17834
314 Ga0496106_0003211 3300048909 Bacteria 12242
315 Ga0496106_0027010 3300048909 Bacteria 4274
316 Ga0496106_0034373 3300048909 Bacteria 3785
317 Ga0496107_0001159 3300048910 Bacteria 15970
318 Ga0496107_0008372 3300048910 Bacteria 7156
319 Ga0496107_0008774 3300048910 Bacteria 7004
320 Ga0496107_0016997 3300048910 Bacteria 5114
321 Ga0496107_0053464 3300048910 Bacteria 2913
322 Ga0496108_0005959 3300048911 Bacteria 9874
323 Ga0496108_0178390 3300048911 Bacteria 1839
324 Ga0496108_0658429 3300048911 Bacteria 910
325 Ga0496109_0001243 3300048912 Bacteria 21130
326 Ga0496109_0068177 3300048912 Bacteria 3261
327 Ga0496109_0730634 3300048912 Bacteria 928
328 Ga0496110_0003824 3300048913 Bacteria 11595
329 Ga0496110_0028874 3300048913 Bacteria 4768
330 Ga0496111_0274391 3300048914 Bacteria 1251
331 Ga0496111_0342200 3300048914 Bacteria 1107
332 Ga0496112_0075667 3300048915 Bacteria 3329
333 Ga0496113_0011772 3300048916 Bacteria 5857
334 Ga0496113_0109331 3300048916 Bacteria 2150
335 Ga0496113_0500784 3300048916 Bacteria 975
336 Ga0496113_0577471 3300048916 Bacteria 901
337 Ga0496114_0000925 3300048917 Bacteria 21965
338 Ga0496114_0001153 3300048917 Bacteria 19968
339 Ga0496114_0001348 3300048917 Bacteria 18599
340 Ga0496115_0006338 3300048918 Bacteria 8664
341 Ga0496115_0013247 3300048918 Bacteria 6231
342 Ga0496115_0118138 3300048918 Bacteria 2181
343 Ga0496116_0000125 3300048919 Bacteria 160885
344 Ga0496116_0003447 3300048919 Bacteria 15612
345 Ga0496116_0060500 3300048919 Bacteria 2456
346 Ga0496117_0000111 3300048920 Bacteria 184570
347 Ga0496117_0002302 3300048920 Bacteria 24580
348 Ga0496117_0022340 3300048920 Bacteria 5077
349 Ga0496117_0039117 3300048920 Bacteria 3505
350 Ga0496118_0000083 3300048921 Bacteria 184570
351 Ga0496118_0000249 3300048921 Bacteria 95339
352 Ga0496118_0000697 3300048921 Bacteria 54602
353 Ga0496118_0022957 3300048921 Bacteria 5435
354 Ga0496118_0340948 3300048921 Bacteria 803
355 Ga0496119_0016835 3300048922 Bacteria 5533
356 Ga0496119_0024241 3300048922 Bacteria 4271
357 Ga0496119_0061643 3300048922 Bacteria 2238
358 Ga0496120_0007070 3300048923 Bacteria 8428
359 Ga0496120_0016111 3300048923 Bacteria 4897
360 Ga0496120_0114063 3300048923 Bacteria 1407
361 Ga0496121_0000002 3300048924 Bacteria 1494588
362 Ga0496121_0004596 3300048924 Bacteria 18381
363 Ga0496121_0009620 3300048924 Bacteria 11072
364 Ga0496122_0000639 3300048925 Bacteria 71085
365 Ga0496122_0019666 3300048925 Bacteria 6155
366 Ga0496123_0055050 3300048926 Bacteria 2612
367 Ga0496124_0000002 3300048927 Bacteria 1494588
368 Ga0496124_0404282 3300048927 Bacteria 947
369 Ga0496125_0000002 3300048928 Bacteria 1480920
370 Ga0496125_0026913 3300048928 Bacteria 5223
371 Ga0496126_0000009 3300048929 Bacteria 750350
372 Ga0496126_0001376 3300048929 Bacteria 38453
373 Ga0496126_0001532 3300048929 Bacteria 35585
374 Ga0496126_0007869 3300048929 Bacteria 11604
375 Ga0496126_0159453 3300048929 Bacteria 1929
376 Ga0496126_0164992 3300048929 Bacteria 1891
377 Ga0501032_0000241 3300049569 Bacteria 45455
378 Ga0501033_0177284 3300049570 Bacteria 1529
379 Ga0501034_0001923 3300049571 Bacteria 26310
380 Ga0501034_0021045 3300049571 Bacteria 6657
381 Ga0501037_0000194 3300049573 Bacteria 56286
382 Ga0501038_0000974 3300049574 Bacteria 25680
383 Ga0501039_0000361 3300049575 Bacteria 32489
384 Ga0501043_0000320 3300049579 Bacteria 43615
385 Ga0501043_0366548 3300049579 Bacteria 1093
386 Ga0501067_0118564 3300049583 Bacteria 1472
387 Ga0501070_0001246 3300049586 Bacteria 22829
388 Ga0501070_0168417 3300049586 Bacteria 1805
389 Ga0501073_0011796 3300049589 Bacteria 6379
390 Ga0501044_0017638 3300049823 Bacteria 7657
391 nmdc:mga03683_19475_c1 3300050489 Bacteria 2591
392 nmdc:mga03683_22155_c1 3300050489 Bacteria 2460
393 nmdc:mga03683_99485_c1 3300050489 Bacteria 1277
394 nmdc:mga03n38_13269_c1 3300050490 Bacteria 3124
395 nmdc:mga03n38_148_c1 3300050490 Bacteria 15468
396 nmdc:mga03n38_15565_c1 3300050490 Bacteria 2939
397 nmdc:mga03n38_16531_c1 3300050490 Bacteria 2871
398 nmdc:mga03n38_824_c1 3300050490 Bacteria 8307
399 nmdc:mga00v17_17313_c2 3300050491 Bacteria 3741
400 nmdc:mga00v17_17494_c1 3300050491 Bacteria 4060
401 nmdc:mga00v17_23595_c1 3300050491 Bacteria 3559
402 nmdc:mga00v17_28012_c1 3300050491 Bacteria 3295
403 nmdc:mga00v17_41469_c1 3300050491 Bacteria 2765
404 nmdc:mga00v17_4568_c1 3300050491 Bacteria 7215
405 nmdc:mga00v17_462036_c1 3300050491 Bacteria 824
406 nmdc:mga00v17_506906_c1 3300050491 Bacteria 782
407 nmdc:mga00v17_7372_c1 3300050491 Bacteria 5866
408 nmdc:mga00v17_80767_c1 3300050491 Bacteria 2029
409 nmdc:mga0yw44_11840_c1 3300050492 Bacteria 4524
410 nmdc:mga0yw44_12528_c1 3300050492 Bacteria 4426
411 nmdc:mga0yw44_169846_c1 3300050492 Bacteria 1431
412 nmdc:mga0yw44_25717_c1 3300050492 Bacteria 3352
413 nmdc:mga0yw44_367342_c1 3300050492 Bacteria 970
414 nmdc:mga0yw44_49523_c1 3300050492 Bacteria 2536
415 nmdc:mga0yw44_54957_c1 3300050492 Bacteria 2421
416 nmdc:mga0k408_215560_c1 3300050493 Bacteria 1146
417 nmdc:mga06z11_10334_c1 3300050494 Bacteria 3973
418 nmdc:mga06z11_120163_c1 3300050494 Bacteria 1465
419 nmdc:mga04h51_19934_c1 3300050495 Bacteria 1995
420 nmdc:mga04h51_236674_c1 3300050495 Bacteria 728
421 nmdc:mga07m45_1122_c1 3300050496 Bacteria 12009
422 nmdc:mga07m45_169600_c1 3300050496 Bacteria 1268
423 nmdc:mga07m45_199859_c1 3300050496 Bacteria 1163
424 nmdc:mga07m45_25788_c1 3300050496 Bacteria 3227
425 nmdc:mga07m45_37608_c1 3300050496 Bacteria 2264
426 nmdc:mga05p37_108526_c1 3300050507 Bacteria 3414
427 nmdc:mga0qj67_95981_c1 3300050509 Bacteria 2387
428 nmdc:mga0sz30_10718_c1 3300050516 Bacteria 3518
429 nmdc:mga0sz30_20301_c1 3300050516 Bacteria 2679
430 nmdc:mga0sz30_33777_c1 3300050516 Bacteria 2127
431 nmdc:mga0sz30_3515_c1 3300050516 Bacteria 5649
432 nmdc:mga0sz30_6155_c1 3300050516 Bacteria 4444
433 nmdc:mga0sz30_94323_c1 3300050516 Bacteria 1304
434 Ga0500578_0281494 3300053086 Bacteria 992
435 Ga0500643_011754 3300053087 Bacteria 3173
436 Ga0500641_0024740 3300053096 Bacteria 2318
437 Ga0500562_041703 3300053108 Bacteria 1220
438 Ga0500604_0032031 3300053151 Bacteria 1547
439 Ga0500616_0008664 3300053153 Bacteria 6286
440 Ga0500620_095970 3300053155 Bacteria 1035
441 Ga0466962_0015898 3300061719 Bacteria 3631
442 Ga0466962_0030647 3300061719 Bacteria 2576
443 2644491351 2643221687 Bacteria 6500351
444 2644636500 2643221715 Bacteria 6671032
445 2738669183 2738541264 Bacteria 5935393
446 2739148279 2738541356 Bacteria 5935017
447 2902797100 2902792274 Bacteria 7270173
448 2902814417 2902810491 Bacteria 6794147
449 2902839149 2902837492 Bacteria 6697721
450 2939585244 2939582691 Bacteria 7088898
451 Ga0070667_100000138
452 JGI24744J21845_10000433
453 JGI24034J26672_10031356
454 Ga0055540_1000129
455 Ga0055540_1000931
456 Ga0055540_1002507
457 Ga0055540_1006033
458 Ga0070670_100086229
459 Ga0068869_100019271
460 Ga0070666_10009772
461 Ga0070666_10179312
462 Ga0070682_100019542
463 Ga0068868_100001283
464 Ga0070689_100051596
465 Ga0070691_10032885
466 Ga0070668_100000292
467 Ga0070668_100002701
468 Ga0070671_100001930
469 Ga0070674_100009756
470 Ga0070688_100003046
471 Ga0070659_100392722
472 Ga0070667_100001166
473 Ga0070667_100002543
474 Ga0070667_100237637
475 Ga0070714_100103244
476 Ga0070710_10002096
477 Ga0070711_100001608
478 Ga0070694_100180493
479 Ga0070663_100114443
480 Ga0070663_100167732
481 Ga0070678_100005329
482 Ga0070662_100242130
483 Ga0068867_100004647
484 Ga0070685_10032349
485 Ga0070685_10136695
486 Ga0070685_10362482
487 Ga0068853_100030227
488 Ga0068853_100092885
489 Ga0070672_100102893
490 Ga0070686_100613551
491 Ga0070665_100003261
492 Ga0070665_100031738
493 Ga0070704_100001375
494 Ga0068855_100300510
495 Ga0068854_100060090
496 Ga0068854_100238308
497 Ga0070702_100000803
498 Ga0068852_100051370
499 Ga0068859_100002961
500 Ga0068866_10002608
501 Ga0068863_100001295
502 Ga0068863_100257393
503 Ga0068863_100315951
504 Ga0068858_100065280
505 Ga0068858_100120534
506 Ga0068858_100482717
507 Ga0068860_100000079
508 Ga0068860_100129952
509 Ga0068862_100000990
510 Ga0081455_10047947
511 Ga0081455_10082924
512 Ga0075365_10003354
513 Ga0075365_10021385
514 Ga0075365_10171949
515 Ga0075365_10206792
516 Ga0075368_10004668
517 Ga0075363_100002131
518 Ga0075363_100015502
519 Ga0075363_100035366
520 Ga0075363_100043219
521 Ga0075363_100175062
522 Ga0075363_100353163
523 Ga0075364_10000448
524 Ga0075364_10002666
525 Ga0075364_10009776
526 Ga0075364_10030095
527 Ga0075364_10041532
528 Ga0075364_10053129
529 Ga0075364_10053756
530 Ga0075364_10075529
531 Ga0075364_10097257
532 Ga0075364_10157584
533 Ga0075364_10227000
534 Ga0075364_10471634
535 Ga0070716_100008402
536 Ga0070712_100002794
537 Ga0075362_10013689
538 Ga0075362_10019922
539 Ga0075362_10065061
540 Ga0075362_10070081
541 Ga0075362_10072479
542 Ga0075367_10101459
543 Ga0075367_10113793
544 Ga0075367_10146048
545 Ga0075369_10000137
546 Ga0075369_10010342
547 Ga0075369_10014339
548 Ga0075369_10018404
549 Ga0075369_10035170
550 Ga0075369_10040547
551 Ga0075369_10060552
552 Ga0075370_10003106
553 Ga0075370_10003654
554 Ga0075370_10060589
555 Ga0075370_10085441
556 Ga0075370_10087721
557 Ga0075370_10203184
558 Ga0075430_100024778
559 Ga0075433_10783714
560 Ga0068865_100005797
561 Ga0097620_100002961
562 Ga0099795_10033180
563 Ga0105250_10099419
564 Ga0111539_10318040
565 Ga0105245_10009271
566 Ga0105245_10546664
567 Ga0105247_10000044
568 Ga0105247_10001271
569 Ga0114129_10126975
570 Ga0105243_10001493
571 Ga0105243_10276011
572 Ga0105248_10000060
573 Ga0105248_10019802
574 Ga0105248_10028758
575 Ga0105237_10010789
576 Ga0105237_10016207
577 Ga0105237_10043109
578 Ga0105237_10167424
579 Ga0105238_10122326
580 Ga0105249_10000049
581 Ga0105249_10048412
582 Ga0105249_10292407
583 Ga0099796_10007304
584 Ga0105239_10057520
585 Ga0105239_10131340
586 Ga0157374_10262831
587 Ga0157378_10008665
588 Ga0163162_10058389
589 Ga0163162_10070740
590 Ga0163162_10229940
591 Ga0163162_10257984
592 Ga0157375_10032533
593 Ga0163163_10146392
594 Ga0157380_10001369
595 Ga0182008_10040248
596 Ga0157379_10103660
597 Ga0163161_10004651
598 Ga0213876_10070330
599 Ga0209673_1010865
600 Ga0209025_1031175
601 Ga0209051_1000034
602 Ga0209051_1000782
603 Ga0209051_1002904
604 Ga0209051_1012387
605 Ga0207692_10008616
606 Ga0207642_10001462
607 Ga0207710_10000066
608 Ga0207688_10001994
609 Ga0207688_10424795
610 Ga0207680_10116943
611 Ga0207647_10031429
612 Ga0207707_10558936
613 Ga0207671_10008020
614 Ga0207671_10054993
615 Ga0207693_10001084
616 Ga0207693_10117889
617 Ga0207650_10129568
618 Ga0207687_10003134
619 Ga0207700_10059979
620 Ga0207664_10111210
621 Ga0207644_10024540
622 Ga0207690_10634209
623 Ga0207706_10025606
624 Ga0207709_10195631
625 Ga0207709_10312179
626 Ga0207669_10000441
627 Ga0207704_10450257
628 Ga0207665_10005690
629 Ga0207665_10289336
630 Ga0207711_10000058
631 Ga0207689_10012063
632 Ga0207712_10000038
633 Ga0207712_10115467
634 Ga0207668_10006592
635 Ga0207668_10040517
636 Ga0207640_10001012
637 Ga0207658_10000061
638 Ga0207658_10009195
639 Ga0207658_10011749
640 Ga0207658_10047862
641 Ga0207658_10093327
642 Ga0207658_10109005
643 Ga0207658_10512843
644 Ga0207703_10070172
645 Ga0207639_10013613
646 Ga0207639_10051576
647 Ga0207678_10039043
648 Ga0207678_10224234
649 Ga0207708_10001567
650 Ga0207641_10002714
651 Ga0207641_10011242
652 Ga0207648_10000940
653 Ga0207675_100002612
654 Ga0207683_10000387
655 Ga0268266_10006695
656 Ga0268266_10020586
657 Ga0268265_10000053
658 Ga0268264_10000017
659 Ga0268264_10106251
660 Ga0265327_10000901
661 Ga0307407_10066166
662 Ga0307409_100198071
663 Ga0307416_100024643
664 Ga0307415_100062638
665 Ga0373939_0157615
666 Ga0373943_0196475
667 Ga0373931_0132299
668 Ga0436364_0564307
669 Ga0436365_0208486
670 Ga0436365_0926650
671 Ga0436365_1126865
672 Ga0436361_0107916
673 Ga0439461_0000292
674 Ga0439461_0001773
675 Ga0439461_0003301
676 Ga0439466_0007563
677 Ga0439466_0010775
678 Ga0439465_0002066
679 Ga0439465_0012974
680 Ga0439465_0023849
681 Ga0451795_1235270
682 Ga0439431_0005171
683 Ga0439431_0012265
684 Ga0439445_0059804
685 Ga0439434_0002556
686 Ga0439434_0017842
687 Ga0439435_0188627
688 Ga0466972_0003232
689 Ga0466972_0005507
690 Ga0466972_0013882
691 Ga0466965_0005833
692 Ga0466965_0016465
693 Ga0466965_0020185
694 Ga0466965_0207690
695 Ga0466966_0025289
696 Ga0466961_0001983
697 Ga0466963_0502244
698 Ga0466964_0078845
699 Ga0466971_0038556
700 Ga0466971_0119126
701 Ga0466968_0001660
702 Ga0466968_0036939
703 Ga0466970_0004845
704 Ga0466970_0127882
705 Ga0466960_0003893
706 Ga0466960_0043505
707 Ga0466960_0321706
708 Ga0466959_0165059
709 Ga0466958_0081551
710 Ga0466967_0037949
711 Ga0466967_0088936
712 Ga0466967_0219621
713 Ga0466967_0222030
714 Ga0466967_0525557
715 Ga0495603_0082125
716 Ga0495638_0008363
717 Ga0495641_0073666
718 Ga0495582_0029031
719 Ga0495648_0008999
720 Ga0495665_0229691
721 Ga0495640_0078954
722 Ga0495640_0087538
723 Ga0495586_0383210
724 Ga0495658_0058158
725 Ga0495624_0026749
726 Ga0495671_0138425
727 Ga0495581_0113157
728 Ga0495674_0386421
729 Ga0495672_0020366
730 Ga0495672_0132915
731 Ga0495676_0073470
732 Ga0495686_0006852
733 Ga0495593_0030155
734 Ga0496100_0000071
735 Ga0496100_0000646
736 Ga0496100_0001138
737 Ga0496100_0015138
738 Ga0496100_0063306
739 Ga0496100_0188967
740 Ga0496100_0607228
741 Ga0496101_0000059
742 Ga0496101_0000201
743 Ga0496101_0002649
744 Ga0496101_0006279
745 Ga0496101_0021613
746 Ga0496101_0237230
747 Ga0496102_0000065
748 Ga0496102_0000227
749 Ga0496102_0000844
750 Ga0496102_0005876
751 Ga0496102_0068031
752 Ga0496102_0071313
753 Ga0496102_0082041
754 Ga0496102_0492590
755 Ga0496103_0000048
756 Ga0496103_0000514
757 Ga0496103_0003502
758 Ga0496103_0091062
759 Ga0496104_0003559
760 Ga0496104_0027527
761 Ga0496105_0010371
762 Ga0496105_0015757
763 Ga0496106_0001439
764 Ga0496106_0003211
765 Ga0496106_0027010
766 Ga0496106_0034373
767 Ga0496107_0001159
768 Ga0496107_0008372
769 Ga0496107_0008774
770 Ga0496107_0016997
771 Ga0496107_0053464
772 Ga0496108_0005959
773 Ga0496108_0178390
774 Ga0496108_0658429
775 Ga0496109_0001243
776 Ga0496109_0068177
777 Ga0496109_0730634
778 Ga0496110_0003824
779 Ga0496110_0028874
780 Ga0496111_0274391
781 Ga0496111_0342200
782 Ga0496112_0075667
783 Ga0496113_0011772
784 Ga0496113_0109331
785 Ga0496113_0500784
786 Ga0496113_0577471
787 Ga0496114_0000925
788 Ga0496114_0001153
789 Ga0496114_0001348
790 Ga0496115_0006338
791 Ga0496115_0013247
792 Ga0496115_0118138
793 Ga0496116_0000125
794 Ga0496116_0003447
795 Ga0496116_0060500
796 Ga0496117_0000111
797 Ga0496117_0002302
798 Ga0496117_0022340
799 Ga0496117_0039117
800 Ga0496118_0000083
801 Ga0496118_0000249
802 Ga0496118_0000697
803 Ga0496118_0022957
804 Ga0496118_0340948
805 Ga0496119_0016835
806 Ga0496119_0024241
807 Ga0496119_0061643
808 Ga0496120_0007070
809 Ga0496120_0016111
810 Ga0496120_0114063
811 Ga0496121_0000002
812 Ga0496121_0004596
813 Ga0496121_0009620
814 Ga0496122_0000639
815 Ga0496122_0019666
816 Ga0496123_0055050
817 Ga0496124_0000002
818 Ga0496124_0404282
819 Ga0496125_0000002
820 Ga0496125_0026913
821 Ga0496126_0000009
822 Ga0496126_0001376
823 Ga0496126_0001532
824 Ga0496126_0007869
825 Ga0496126_0159453
826 Ga0496126_0164992
827 Ga0501032_0000241
828 Ga0501033_0177284
829 Ga0501034_0001923
830 Ga0501034_0021045
831 Ga0501037_0000194
832 Ga0501038_0000974
833 Ga0501039_0000361
834 Ga0501043_0000320
835 Ga0501043_0366548
836 Ga0501067_0118564
837 Ga0501070_0001246
838 Ga0501070_0168417
839 Ga0501073_0011796
840 Ga0501044_0017638
841 nmdc:mga03683_19475_c1
842 nmdc:mga03683_22155_c1
843 nmdc:mga03683_99485_c1
844 nmdc:mga03n38_13269_c1
845 nmdc:mga03n38_148_c1
846 nmdc:mga03n38_15565_c1
847 nmdc:mga03n38_16531_c1
848 nmdc:mga03n38_824_c1
849 nmdc:mga00v17_17313_c2
850 nmdc:mga00v17_17494_c1
851 nmdc:mga00v17_23595_c1
852 nmdc:mga00v17_28012_c1
853 nmdc:mga00v17_41469_c1
854 nmdc:mga00v17_4568_c1
855 nmdc:mga00v17_462036_c1
856 nmdc:mga00v17_506906_c1
857 nmdc:mga00v17_7372_c1
858 nmdc:mga00v17_80767_c1
859 nmdc:mga0yw44_11840_c1
860 nmdc:mga0yw44_12528_c1
861 nmdc:mga0yw44_169846_c1
862 nmdc:mga0yw44_25717_c1
863 nmdc:mga0yw44_367342_c1
864 nmdc:mga0yw44_49523_c1
865 nmdc:mga0yw44_54957_c1
866 nmdc:mga0k408_215560_c1
867 nmdc:mga06z11_10334_c1
868 nmdc:mga06z11_120163_c1
869 nmdc:mga04h51_19934_c1
870 nmdc:mga04h51_236674_c1
871 nmdc:mga07m45_1122_c1
872 nmdc:mga07m45_169600_c1
873 nmdc:mga07m45_199859_c1
874 nmdc:mga07m45_25788_c1
875 nmdc:mga07m45_37608_c1
876 nmdc:mga05p37_108526_c1
877 nmdc:mga0qj67_95981_c1
878 nmdc:mga0sz30_10718_c1
879 nmdc:mga0sz30_20301_c1
880 nmdc:mga0sz30_33777_c1
881 nmdc:mga0sz30_3515_c1
882 nmdc:mga0sz30_6155_c1
883 nmdc:mga0sz30_94323_c1
884 Ga0500578_0281494
885 Ga0500643_011754
886 Ga0500641_0024740
887 Ga0500562_041703
888 Ga0500604_0032031
889 Ga0500616_0008664
890 Ga0500620_095970
891 Ga0466962_0015898
892 Ga0466962_0030647
893 2644491351
894 2644636500
895 2738669183
896 2739148279
897 2902797100
898 2902814417
899 2902839149
900 2939585244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06314

ADC

Acetoacetate decarboxylase (ADC)

10

250

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.772 16 239
3c8w-assembly1.cif.gz_A crystal structure of acetoacetate decarboxylase (adc) (yp_094708.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.60 a resolution 0.7247 16 239
6eej-assembly1.cif.gz_B streptomyces bingchenggensis aldolase-dehydratase in covalent complex with dienone product. 0.7093 16 239
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.7058 16 239
4zbt-assembly1.cif.gz_B streptomyces bingchenggensis aldolase-dehydratase in schiff base complex with pyruvate 0.7026 16 239
ID Description Score Start End Superfamily
af_O53564_9_236_2.40.400.10 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.9912 9 239 2.40.400.10
af_O53564_9_236_2.40.400.10 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.9868 9 239 2.40.400.10
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.7491 16 239 2.40.400.10
af_F1QKD7_7_112_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7066 132 153 3.40.630.30
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.7053 16 239 2.40.400.10
ID Description Score Start End GO Terms
AF-A0A7I7XMQ0-F1-model_v4 Acetoacetate decarboxylase 0.9962 4 239 GO:0016829
AF-A0A810P9H2-F1-model_v4 deleted 0.9929 3 239
AF-A0A7I7LVL3-F1-model_v4 deleted 0.9852 1 239
AF-K5B7Q0-F1-model_v4 Acetoacetate decarboxylase family protein 0.9851 4 239 GO:0016829
AF-A0A7I7XMQ0-F1-model_v4 Acetoacetate decarboxylase 0.9837 4 239 GO:0016829

Map