F446548
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 450 | 237 | 449 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100300494|Ga0070698_1003004942 |
| Length | 284 |
| Sequence | VRAGLRLRRTITLSTIGCSVSKSLDRLLAWLPAESADRELARRVNPERLPRHVAIIMDGNGRWAGKRHLPRVEGHRAGIEAVRAVVETSARLGLDVLTLYAFSVENWKRPAAEVSTLMLLLKRYLRSELSTLLENDIRFNVIGRAEELAPDILQELRAAEQKTAKSSGMLFNIALNYGGRSEIIDAARRAIEAGIPADALDERRFGELLYTAGQPDPDLLIRTSGEMRVSNFLLWQIAYAEIWVTDTLWPDFRCRDLLEAILAYQKRDRRYGGIASAHVAAGAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2939615513 | Lactococcus lactis 1925 | Isolate | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 121 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 122 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 126 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 127 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 128 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 134 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 135 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 137 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 138 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 141 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 143 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 145 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 146 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 147 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 148 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 149 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 150 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 151 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 152 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 153 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 154 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 155 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 156 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 157 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 158 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 159 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 160 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 161 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 191 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 192 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 193 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 194 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 195 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 196 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 197 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 216 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 219 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 220 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 233 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 235 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 236 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.56 |
| Nodule | 0 |
| Rhizoplane | 4.44 |
| Rhizosphere | 93.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10039260 | 3300005290 | Bacteria | 1148 |
| 2 | Ga0065712_10239246 | 3300005290 | Bacteria | 989 |
| 3 | Ga0065715_10409685 | 3300005293 | Bacteria | 871 |
| 4 | Ga0070670_100059476 | 3300005331 | Bacteria | 3280 |
| 5 | Ga0068869_100278026 | 3300005334 | Bacteria | 1346 |
| 6 | Ga0070666_10072574 | 3300005335 | Bacteria | 2343 |
| 7 | Ga0070666_10087235 | 3300005335 | Bacteria | 2139 |
| 8 | Ga0070682_100245426 | 3300005337 | Bacteria | 1288 |
| 9 | Ga0070692_10043816 | 3300005345 | Bacteria | 2303 |
| 10 | Ga0070668_100006636 | 3300005347 | Bacteria | 8578 |
| 11 | Ga0070668_100070147 | 3300005347 | Bacteria | 2728 |
| 12 | Ga0070669_100043411 | 3300005353 | Bacteria | 3274 |
| 13 | Ga0070669_100105149 | 3300005353 | Bacteria | 2135 |
| 14 | Ga0070675_100524120 | 3300005354 | Bacteria | 1069 |
| 15 | Ga0070675_100542900 | 3300005354 | Bacteria | 1051 |
| 16 | Ga0070671_100090311 | 3300005355 | Bacteria | 2564 |
| 17 | Ga0070674_100033558 | 3300005356 | Bacteria | 3418 |
| 18 | Ga0070674_100085165 | 3300005356 | Bacteria | 2268 |
| 19 | Ga0070673_100026814 | 3300005364 | Bacteria | 4261 |
| 20 | Ga0070659_100098075 | 3300005366 | Bacteria | 2356 |
| 21 | Ga0070659_100129725 | 3300005366 | Bacteria | 2047 |
| 22 | Ga0070667_100101921 | 3300005367 | Bacteria | 2480 |
| 23 | Ga0070709_10368880 | 3300005434 | Bacteria | 1065 |
| 24 | Ga0070713_100004300 | 3300005436 | Bacteria | 9545 |
| 25 | Ga0070711_100069949 | 3300005439 | Bacteria | 2470 |
| 26 | Ga0070705_100055922 | 3300005440 | Bacteria | 2321 |
| 27 | Ga0070705_100348680 | 3300005440 | Bacteria | 1079 |
| 28 | Ga0070662_100157840 | 3300005457 | Bacteria | 1772 |
| 29 | Ga0070662_100195523 | 3300005457 | Bacteria | 1602 |
| 30 | Ga0070662_100285510 | 3300005457 | Bacteria | 1337 |
| 31 | Ga0070681_10003693 | 3300005458 | Bacteria | 14358 |
| 32 | Ga0068867_100074656 | 3300005459 | Bacteria | 2542 |
| 33 | Ga0070707_100125144 | 3300005468 | Bacteria | 2497 |
| 34 | Ga0070698_100133526 | 3300005471 | Bacteria | 2437 |
| 35 | Ga0070698_100159625 | 3300005471 | Bacteria | 2199 |
| 36 | Ga0070698_100300494 | 3300005471 | Bacteria | 1536 |
| 37 | Ga0070698_100410225 | 3300005471 | Bacteria | 1288 |
| 38 | Ga0070679_100080150 | 3300005530 | Bacteria | 3254 |
| 39 | Ga0070672_100160747 | 3300005543 | Bacteria | 1863 |
| 40 | Ga0070672_100317365 | 3300005543 | Bacteria | 1324 |
| 41 | Ga0070695_100191896 | 3300005545 | Bacteria | 1454 |
| 42 | Ga0070696_100019487 | 3300005546 | Bacteria | 4593 |
| 43 | Ga0070665_100001879 | 3300005548 | Bacteria | 23848 |
| 44 | Ga0070665_100233467 | 3300005548 | Bacteria | 1840 |
| 45 | Ga0070704_100019719 | 3300005549 | Bacteria | 4338 |
| 46 | Ga0070704_100071006 | 3300005549 | Bacteria | 2528 |
| 47 | Ga0070664_100144108 | 3300005564 | Bacteria | 2100 |
| 48 | Ga0070664_100444122 | 3300005564 | Bacteria | 1190 |
| 49 | Ga0068857_100315828 | 3300005577 | Bacteria | 1442 |
| 50 | Ga0070702_100010325 | 3300005615 | Bacteria | 4593 |
| 51 | Ga0068852_100054353 | 3300005616 | Bacteria | 3451 |
| 52 | Ga0068859_100540531 | 3300005617 | Bacteria | 1260 |
| 53 | Ga0068859_100566826 | 3300005617 | Bacteria | 1230 |
| 54 | Ga0068866_10041048 | 3300005718 | Bacteria | 2294 |
| 55 | Ga0068861_100012368 | 3300005719 | Bacteria | 5951 |
| 56 | Ga0068851_10184555 | 3300005834 | Bacteria | 1157 |
| 57 | Ga0068863_100025860 | 3300005841 | Bacteria | 5600 |
| 58 | Ga0068863_100325393 | 3300005841 | Bacteria | 1494 |
| 59 | Ga0068858_100012178 | 3300005842 | Bacteria | 8109 |
| 60 | Ga0068860_100241626 | 3300005843 | Bacteria | 1757 |
| 61 | Ga0068860_100415101 | 3300005843 | Bacteria | 1333 |
| 62 | Ga0068862_100012037 | 3300005844 | Bacteria | 7149 |
| 63 | Ga0068862_100538314 | 3300005844 | Bacteria | 1114 |
| 64 | Ga0068862_100548568 | 3300005844 | Bacteria | 1103 |
| 65 | Ga0068862_100659791 | 3300005844 | Bacteria | 1010 |
| 66 | Ga0081455_10187638 | 3300005937 | Bacteria | 1560 |
| 67 | Ga0075368_10019907 | 3300006042 | Bacteria | 2537 |
| 68 | Ga0075367_10007865 | 3300006178 | Bacteria | 5487 |
| 69 | Ga0075366_10240951 | 3300006195 | Bacteria | 1102 |
| 70 | Ga0097621_100008625 | 3300006237 | Bacteria | 7353 |
| 71 | Ga0097621_100057255 | 3300006237 | Bacteria | 3187 |
| 72 | Ga0068871_100024332 | 3300006358 | Bacteria | 4695 |
| 73 | Ga0068871_100178172 | 3300006358 | Bacteria | 1826 |
| 74 | Ga0075428_100000995 | 3300006844 | Bacteria | 29993 |
| 75 | Ga0075428_100025242 | 3300006844 | Bacteria | 6577 |
| 76 | Ga0075428_100063291 | 3300006844 | Bacteria | 4050 |
| 77 | Ga0075428_100068382 | 3300006844 | Bacteria | 3885 |
| 78 | Ga0075428_100816357 | 3300006844 | Bacteria | 991 |
| 79 | Ga0075430_100003143 | 3300006846 | Bacteria | 13813 |
| 80 | Ga0075430_100003168 | 3300006846 | Bacteria | 13771 |
| 81 | Ga0075430_100179339 | 3300006846 | Bacteria | 1762 |
| 82 | Ga0075430_100185525 | 3300006846 | Bacteria | 1730 |
| 83 | Ga0075430_100297844 | 3300006846 | Bacteria | 1334 |
| 84 | Ga0075431_100009084 | 3300006847 | Bacteria | 9964 |
| 85 | Ga0075431_100011342 | 3300006847 | Bacteria | 8979 |
| 86 | Ga0075431_100014869 | 3300006847 | Bacteria | 7880 |
| 87 | Ga0075431_100015000 | 3300006847 | Bacteria | 7844 |
| 88 | Ga0075431_100021584 | 3300006847 | Bacteria | 6586 |
| 89 | Ga0075431_100035152 | 3300006847 | Bacteria | 5160 |
| 90 | Ga0075431_100096381 | 3300006847 | Bacteria | 3054 |
| 91 | Ga0075431_100171089 | 3300006847 | Bacteria | 2232 |
| 92 | Ga0075431_100182583 | 3300006847 | Bacteria | 2153 |
| 93 | Ga0075431_100237155 | 3300006847 | Bacteria | 1857 |
| 94 | Ga0075431_100400283 | 3300006847 | Bacteria | 1374 |
| 95 | Ga0075433_10008838 | 3300006852 | Bacteria | 8038 |
| 96 | Ga0075433_10021567 | 3300006852 | Bacteria | 5403 |
| 97 | Ga0075433_10053906 | 3300006852 | Bacteria | 3507 |
| 98 | Ga0075433_10077673 | 3300006852 | Bacteria | 2924 |
| 99 | Ga0075433_10126984 | 3300006852 | Bacteria | 2265 |
| 100 | Ga0075433_10176061 | 3300006852 | Bacteria | 1904 |
| 101 | Ga0075434_100086563 | 3300006871 | Bacteria | 3133 |
| 102 | Ga0075429_100001657 | 3300006880 | Bacteria | 18416 |
| 103 | Ga0075429_100046262 | 3300006880 | Bacteria | 3787 |
| 104 | Ga0068865_100136772 | 3300006881 | Bacteria | 1842 |
| 105 | Ga0068865_100283461 | 3300006881 | Bacteria | 1320 |
| 106 | Ga0075436_100050954 | 3300006914 | Bacteria | 2857 |
| 107 | Ga0097620_100540538 | 3300006931 | Bacteria | 1260 |
| 108 | Ga0097620_100566826 | 3300006931 | Bacteria | 1230 |
| 109 | Ga0075435_100004980 | 3300007076 | Bacteria | 9220 |
| 110 | Ga0075435_100019332 | 3300007076 | Bacteria | 5201 |
| 111 | Ga0105240_10017120 | 3300009093 | Bacteria | 9785 |
| 112 | Ga0111539_10000201 | 3300009094 | Bacteria | 70327 |
| 113 | Ga0111539_10098969 | 3300009094 | Bacteria | 3425 |
| 114 | Ga0111539_10156632 | 3300009094 | Bacteria | 2665 |
| 115 | Ga0111539_10211645 | 3300009094 | Bacteria | 2259 |
| 116 | Ga0111539_10428899 | 3300009094 | Bacteria | 1540 |
| 117 | Ga0105245_10044220 | 3300009098 | Bacteria | 3974 |
| 118 | Ga0105247_10002386 | 3300009101 | Bacteria | 12782 |
| 119 | Ga0105247_10196378 | 3300009101 | Bacteria | 1353 |
| 120 | Ga0114129_10000751 | 3300009147 | Bacteria | 41232 |
| 121 | Ga0114129_10001134 | 3300009147 | Bacteria | 35181 |
| 122 | Ga0114129_10001999 | 3300009147 | Bacteria | 27921 |
| 123 | Ga0114129_10003812 | 3300009147 | Bacteria | 21254 |
| 124 | Ga0114129_10005506 | 3300009147 | Bacteria | 17904 |
| 125 | Ga0114129_10008750 | 3300009147 | Bacteria | 14437 |
| 126 | Ga0114129_10035177 | 3300009147 | Bacteria | 7077 |
| 127 | Ga0114129_10042024 | 3300009147 | Bacteria | 6437 |
| 128 | Ga0114129_10066845 | 3300009147 | Bacteria | 5013 |
| 129 | Ga0114129_10155160 | 3300009147 | Bacteria | 3131 |
| 130 | Ga0114129_10347217 | 3300009147 | Bacteria | 1967 |
| 131 | Ga0105243_10375938 | 3300009148 | Bacteria | 1312 |
| 132 | Ga0105241_10174158 | 3300009174 | Bacteria | 1779 |
| 133 | Ga0105242_10067202 | 3300009176 | Bacteria | 2963 |
| 134 | Ga0105242_10128458 | 3300009176 | Bacteria | 2184 |
| 135 | Ga0105242_10714701 | 3300009176 | Bacteria | 982 |
| 136 | Ga0105248_10004005 | 3300009177 | Bacteria | 16285 |
| 137 | Ga0105248_10053353 | 3300009177 | Bacteria | 4537 |
| 138 | Ga0105248_10066354 | 3300009177 | Bacteria | 4052 |
| 139 | Ga0105248_10139208 | 3300009177 | Bacteria | 2737 |
| 140 | Ga0105248_10172496 | 3300009177 | Bacteria | 2438 |
| 141 | Ga0105248_10764480 | 3300009177 | Bacteria | 1090 |
| 142 | Ga0105237_10465478 | 3300009545 | Bacteria | 1270 |
| 143 | Ga0105239_10089908 | 3300010375 | Bacteria | 3387 |
| 144 | Ga0157378_10630835 | 3300013297 | Bacteria | 1086 |
| 145 | Ga0157378_10849033 | 3300013297 | Bacteria | 941 |
| 146 | Ga0157375_10073949 | 3300013308 | Bacteria | 3428 |
| 147 | Ga0157375_10221390 | 3300013308 | Bacteria | 2051 |
| 148 | Ga0157375_10633748 | 3300013308 | Bacteria | 1226 |
| 149 | Ga0163163_10036126 | 3300014325 | Bacteria | 4797 |
| 150 | Ga0157380_10668318 | 3300014326 | Bacteria | 1039 |
| 151 | Ga0157379_10079608 | 3300014968 | Bacteria | 2934 |
| 152 | Ga0157379_10131682 | 3300014968 | Bacteria | 2251 |
| 153 | Ga0157376_10004135 | 3300014969 | Bacteria | 10058 |
| 154 | Ga0157376_10156950 | 3300014969 | Bacteria | 2058 |
| 155 | Ga0163161_10315553 | 3300017792 | Bacteria | 1234 |
| 156 | Ga0207642_10018052 | 3300025899 | Bacteria | 2699 |
| 157 | Ga0207642_10090128 | 3300025899 | Bacteria | 1512 |
| 158 | Ga0207680_10150851 | 3300025903 | Bacteria | 1549 |
| 159 | Ga0207699_10046271 | 3300025906 | Bacteria | 2544 |
| 160 | Ga0207645_10002511 | 3300025907 | Bacteria | 14376 |
| 161 | Ga0207645_10057285 | 3300025907 | Bacteria | 2488 |
| 162 | Ga0207654_10109300 | 3300025911 | Bacteria | 1717 |
| 163 | Ga0207707_10083559 | 3300025912 | Bacteria | 2788 |
| 164 | Ga0207660_10082272 | 3300025917 | Bacteria | 2368 |
| 165 | Ga0207662_10010044 | 3300025918 | Bacteria | 5219 |
| 166 | Ga0207657_10119585 | 3300025919 | Bacteria | 2168 |
| 167 | Ga0207652_10463580 | 3300025921 | Bacteria | 1142 |
| 168 | Ga0207646_10425005 | 3300025922 | Bacteria | 1199 |
| 169 | Ga0207681_10151045 | 3300025923 | Bacteria | 1741 |
| 170 | Ga0207650_10094438 | 3300025925 | Bacteria | 2291 |
| 171 | Ga0207659_10091502 | 3300025926 | Bacteria | 2272 |
| 172 | Ga0207700_10133593 | 3300025928 | Bacteria | 2029 |
| 173 | Ga0207644_10081279 | 3300025931 | Bacteria | 2394 |
| 174 | Ga0207690_10038420 | 3300025932 | Bacteria | 3116 |
| 175 | Ga0207690_10297155 | 3300025932 | Bacteria | 1262 |
| 176 | Ga0207706_10130589 | 3300025933 | Bacteria | 2210 |
| 177 | Ga0207706_10347139 | 3300025933 | Bacteria | 1290 |
| 178 | Ga0207706_10573120 | 3300025933 | Bacteria | 971 |
| 179 | Ga0207686_10336129 | 3300025934 | Bacteria | 1133 |
| 180 | Ga0207686_10548616 | 3300025934 | Bacteria | 903 |
| 181 | Ga0207669_10095277 | 3300025937 | Bacteria | 1951 |
| 182 | Ga0207704_10102171 | 3300025938 | Bacteria | 1914 |
| 183 | Ga0207691_10061874 | 3300025940 | Bacteria | 3399 |
| 184 | Ga0207711_10023199 | 3300025941 | Bacteria | 5193 |
| 185 | Ga0207711_10318220 | 3300025941 | Bacteria | 1437 |
| 186 | Ga0207689_10014199 | 3300025942 | Bacteria | 6776 |
| 187 | Ga0207689_10070467 | 3300025942 | Bacteria | 2872 |
| 188 | Ga0207679_10750783 | 3300025945 | Bacteria | 887 |
| 189 | Ga0207667_10876940 | 3300025949 | Bacteria | 890 |
| 190 | Ga0207651_10006484 | 3300025960 | Bacteria | 6134 |
| 191 | Ga0207651_10013471 | 3300025960 | Bacteria | 4681 |
| 192 | Ga0207651_10239837 | 3300025960 | Bacteria | 1477 |
| 193 | Ga0207677_10605277 | 3300026023 | Bacteria | 962 |
| 194 | Ga0207703_10116728 | 3300026035 | Bacteria | 2285 |
| 195 | Ga0207703_10242892 | 3300026035 | Bacteria | 1620 |
| 196 | Ga0207703_10891737 | 3300026035 | Bacteria | 851 |
| 197 | Ga0207703_10935250 | 3300026035 | Bacteria | 831 |
| 198 | Ga0207708_10018403 | 3300026075 | Bacteria | 5260 |
| 199 | Ga0207708_10107833 | 3300026075 | Bacteria | 2160 |
| 200 | Ga0207708_10175554 | 3300026075 | Bacteria | 1699 |
| 201 | Ga0207641_10251413 | 3300026088 | Bacteria | 1651 |
| 202 | Ga0207641_10416857 | 3300026088 | Bacteria | 1292 |
| 203 | Ga0207641_10533023 | 3300026088 | Bacteria | 1143 |
| 204 | Ga0207648_10093742 | 3300026089 | Bacteria | 2626 |
| 205 | Ga0207648_10115526 | 3300026089 | Bacteria | 2358 |
| 206 | Ga0207648_10708425 | 3300026089 | Bacteria | 933 |
| 207 | Ga0207676_10016334 | 3300026095 | Bacteria | 5375 |
| 208 | Ga0207675_100003564 | 3300026118 | Bacteria | 15160 |
| 209 | Ga0207675_100064733 | 3300026118 | Bacteria | 3417 |
| 210 | Ga0207683_10195712 | 3300026121 | Bacteria | 1837 |
| 211 | Ga0207683_10513953 | 3300026121 | Bacteria | 1107 |
| 212 | Ga0209813_10014211 | 3300027866 | Bacteria | 2141 |
| 213 | Ga0207428_10000445 | 3300027907 | Bacteria | 50527 |
| 214 | Ga0207428_10002413 | 3300027907 | Bacteria | 18659 |
| 215 | Ga0207428_10179209 | 3300027907 | Bacteria | 1602 |
| 216 | Ga0207428_10347185 | 3300027907 | Bacteria | 1092 |
| 217 | Ga0268266_10203955 | 3300028379 | Bacteria | 1811 |
| 218 | Ga0268266_10298376 | 3300028379 | Bacteria | 1502 |
| 219 | Ga0268265_10096738 | 3300028380 | Bacteria | 2373 |
| 220 | Ga0268265_10265068 | 3300028380 | Bacteria | 1529 |
| 221 | Ga0268265_10555111 | 3300028380 | Bacteria | 1091 |
| 222 | Ga0268264_10150083 | 3300028381 | Bacteria | 2089 |
| 223 | Ga0268264_10708771 | 3300028381 | Bacteria | 1000 |
| 224 | Ga0307513_10547502 | 3300031456 | Bacteria | 870 |
| 225 | Ga0307408_100005759 | 3300031548 | Bacteria | 8254 |
| 226 | Ga0307408_100095422 | 3300031548 | Bacteria | 2254 |
| 227 | Ga0307408_100189122 | 3300031548 | Bacteria | 1657 |
| 228 | Ga0316578_10066203 | 3300031728 | Bacteria | 2134 |
| 229 | Ga0307410_10084721 | 3300031852 | Bacteria | 2235 |
| 230 | Ga0307410_10232206 | 3300031852 | Bacteria | 1425 |
| 231 | Ga0307410_10479431 | 3300031852 | Bacteria | 1020 |
| 232 | Ga0307406_10075346 | 3300031901 | Bacteria | 2226 |
| 233 | Ga0307406_10106325 | 3300031901 | Bacteria | 1922 |
| 234 | Ga0307406_10668662 | 3300031901 | Bacteria | 864 |
| 235 | Ga0307412_10552741 | 3300031911 | Bacteria | 967 |
| 236 | Ga0307416_100040297 | 3300032002 | Bacteria | 3627 |
| 237 | Ga0307416_100076446 | 3300032002 | Bacteria | 2806 |
| 238 | Ga0307416_100138570 | 3300032002 | Bacteria | 2206 |
| 239 | Ga0307416_100151899 | 3300032002 | Bacteria | 2125 |
| 240 | Ga0307416_100182350 | 3300032002 | Bacteria | 1969 |
| 241 | Ga0307411_10100466 | 3300032005 | Bacteria | 2044 |
| 242 | Ga0307415_100048304 | 3300032126 | Bacteria | 2871 |
| 243 | Ga0316580_10028413 | 3300032139 | Bacteria | 1729 |
| 244 | Ga0373934_0037848 | 3300035086 | Bacteria | 1899 |
| 245 | Ga0373934_0074023 | 3300035086 | Bacteria | 1364 |
| 246 | Ga0373951_0035804 | 3300035091 | Bacteria | 1183 |
| 247 | Ga0373945_0022207 | 3300035116 | Bacteria | 2184 |
| 248 | Ga0373945_0038785 | 3300035116 | Bacteria | 1715 |
| 249 | Ga0373953_0030439 | 3300035117 | Bacteria | 2093 |
| 250 | Ga0373954_0091942 | 3300035118 | Bacteria | 1458 |
| 251 | Ga0373943_0031772 | 3300035170 | Bacteria | 2506 |
| 252 | Ga0373943_0168899 | 3300035170 | Bacteria | 1196 |
| 253 | Ga0373943_0270547 | 3300035170 | Bacteria | 958 |
| 254 | Ga0373946_0010185 | 3300035171 | Bacteria | 3476 |
| 255 | Ga0373946_0056744 | 3300035171 | Bacteria | 1655 |
| 256 | Ga0373946_0214062 | 3300035171 | Bacteria | 928 |
| 257 | Ga0373955_0037650 | 3300035172 | Bacteria | 2573 |
| 258 | Ga0373955_0092149 | 3300035172 | Bacteria | 1728 |
| 259 | Ga0373955_0230022 | 3300035172 | Bacteria | 1109 |
| 260 | Ga0316574_0183873 | 3300035398 | Bacteria | 1344 |
| 261 | Ga0373924_0002742 | 3300035410 | Bacteria | 5949 |
| 262 | Ga0373931_0169563 | 3300035691 | Bacteria | 1285 |
| 263 | Ga0373927_0080617 | 3300035695 | Bacteria | 2109 |
| 264 | Ga0373947_0091904 | 3300035725 | Bacteria | 1894 |
| 265 | Ga0373937_0000513 | 3300036401 | Bacteria | 35017 |
| 266 | Ga0373937_0057140 | 3300036401 | Bacteria | 3584 |
| 267 | Ga0373937_0243982 | 3300036401 | Bacteria | 1693 |
| 268 | Ga0316584_0081934 | 3300036712 | Bacteria | 2417 |
| 269 | Ga0373925_0003323 | 3300037068 | Bacteria | 12500 |
| 270 | Ga0373925_0003479 | 3300037068 | Bacteria | 12183 |
| 271 | Ga0373925_0543968 | 3300037068 | Bacteria | 955 |
| 272 | Ga0436365_0589265 | 3300039437 | Bacteria | 3362 |
| 273 | Ga0439461_0036812 | 3300041410 | Bacteria | 1043 |
| 274 | Ga0439461_0082316 | 3300041410 | Bacteria | 761 |
| 275 | Ga0439433_0033950 | 3300041999 | Bacteria | 1173 |
| 276 | Ga0439441_020618 | 3300042001 | Bacteria | 1209 |
| 277 | Ga0439445_0031255 | 3300042004 | Bacteria | 1383 |
| 278 | Ga0439449_0022696 | 3300042007 | Bacteria | 2350 |
| 279 | Ga0439457_014388 | 3300042014 | Bacteria | 1771 |
| 280 | Ga0450888_012300 | 3300042126 | Bacteria | 1013 |
| 281 | Ga0450895_004607 | 3300042132 | Bacteria | 1091 |
| 282 | Ga0439446_0130586 | 3300042156 | Bacteria | 814 |
| 283 | Ga0439434_0001238 | 3300042435 | Bacteria | 7351 |
| 284 | Ga0439435_0003326 | 3300042436 | Bacteria | 3331 |
| 285 | Ga0439464_0006098 | 3300042439 | Bacteria | 3134 |
| 286 | Ga0439464_0025314 | 3300042439 | Bacteria | 1643 |
| 287 | Ga0439460_0016107 | 3300042461 | Bacteria | 1988 |
| 288 | Ga0439460_0058392 | 3300042461 | Bacteria | 1172 |
| 289 | Ga0439460_0083519 | 3300042461 | Bacteria | 1005 |
| 290 | Ga0451577_0012810 | 3300042876 | Bacteria | 7870 |
| 291 | Ga0451577_0664002 | 3300042876 | Bacteria | 945 |
| 292 | Ga0439440_0016925 | 3300042993 | Bacteria | 1601 |
| 293 | Ga0453684_0124671 | 3300044712 | Bacteria | 3103 |
| 294 | Ga0453684_0863226 | 3300044712 | Bacteria | 972 |
| 295 | Ga0495592_0306915 | 3300046454 | Bacteria | 1030 |
| 296 | Ga0495629_0233023 | 3300046459 | Bacteria | 1269 |
| 297 | Ga0495582_0080216 | 3300046473 | Bacteria | 1812 |
| 298 | Ga0495608_0008013 | 3300046511 | Bacteria | 7428 |
| 299 | Ga0495628_0002852 | 3300046516 | Bacteria | 15494 |
| 300 | Ga0495628_0364169 | 3300046516 | Bacteria | 1061 |
| 301 | Ga0495630_0009226 | 3300046517 | Bacteria | 7092 |
| 302 | Ga0495630_0024883 | 3300046517 | Bacteria | 4426 |
| 303 | Ga0495652_0470402 | 3300046529 | Bacteria | 876 |
| 304 | Ga0495587_0047900 | 3300046536 | Bacteria | 2533 |
| 305 | Ga0495634_0208798 | 3300046642 | Bacteria | 1210 |
| 306 | Ga0495599_0136612 | 3300046678 | Bacteria | 1522 |
| 307 | Ga0495646_0290419 | 3300046680 | Bacteria | 867 |
| 308 | Ga0495647_0106873 | 3300046681 | Bacteria | 1164 |
| 309 | Ga0495658_0192801 | 3300046683 | Bacteria | 1268 |
| 310 | Ga0495613_0003890 | 3300046689 | Bacteria | 11176 |
| 311 | Ga0495613_0443950 | 3300046689 | Bacteria | 880 |
| 312 | Ga0495604_0031490 | 3300047317 | Bacteria | 4206 |
| 313 | Ga0495604_0130531 | 3300047317 | Bacteria | 1807 |
| 314 | Ga0495604_0255119 | 3300047317 | Bacteria | 1194 |
| 315 | Ga0495674_0008199 | 3300047319 | Bacteria | 9969 |
| 316 | Ga0495680_0319320 | 3300047322 | Bacteria | 1087 |
| 317 | Ga0495675_0220553 | 3300047444 | Bacteria | 1148 |
| 318 | Ga0495684_0017049 | 3300047471 | Bacteria | 5594 |
| 319 | Ga0495602_0218847 | 3300048088 | Bacteria | 1439 |
| 320 | Ga0496100_0000818 | 3300048903 | Bacteria | 14930 |
| 321 | Ga0496101_0001661 | 3300048904 | Bacteria | 13342 |
| 322 | Ga0496102_0010055 | 3300048905 | Bacteria | 8138 |
| 323 | Ga0496102_0173353 | 3300048905 | Bacteria | 2031 |
| 324 | Ga0496104_0003527 | 3300048907 | Bacteria | 13490 |
| 325 | Ga0496104_0030167 | 3300048907 | Bacteria | 5037 |
| 326 | Ga0496104_0116293 | 3300048907 | Bacteria | 2566 |
| 327 | Ga0496105_0056566 | 3300048908 | Bacteria | 3238 |
| 328 | Ga0496106_0011246 | 3300048909 | Bacteria | 6623 |
| 329 | Ga0496107_0225137 | 3300048910 | Bacteria | 1395 |
| 330 | Ga0496108_0246200 | 3300048911 | Bacteria | 1555 |
| 331 | Ga0496108_0727049 | 3300048911 | Bacteria | 860 |
| 332 | Ga0496109_0229569 | 3300048912 | Bacteria | 1746 |
| 333 | Ga0496109_0343137 | 3300048912 | Bacteria | 1410 |
| 334 | Ga0496110_0303874 | 3300048913 | Bacteria | 1453 |
| 335 | Ga0496111_0057054 | 3300048914 | Bacteria | 2827 |
| 336 | Ga0496112_0010102 | 3300048915 | Bacteria | 8546 |
| 337 | Ga0496113_0265775 | 3300048916 | Bacteria | 1371 |
| 338 | Ga0496114_0000958 | 3300048917 | Bacteria | 21594 |
| 339 | Ga0496115_0065821 | 3300048918 | Bacteria | 2928 |
| 340 | Ga0496117_0000079 | 3300048920 | Bacteria | 226960 |
| 341 | Ga0501031_0088367 | 3300049568 | Bacteria | 2021 |
| 342 | Ga0501034_0009079 | 3300049571 | Bacteria | 10442 |
| 343 | Ga0501038_0287785 | 3300049574 | Bacteria | 1292 |
| 344 | Ga0501038_0684501 | 3300049574 | Bacteria | 770 |
| 345 | Ga0501039_0046708 | 3300049575 | Bacteria | 3346 |
| 346 | Ga0501039_0078906 | 3300049575 | Bacteria | 2561 |
| 347 | Ga0501039_0437031 | 3300049575 | Bacteria | 1028 |
| 348 | Ga0501040_0031302 | 3300049576 | Bacteria | 3595 |
| 349 | Ga0501040_0070246 | 3300049576 | Bacteria | 2416 |
| 350 | Ga0501042_0059731 | 3300049578 | Bacteria | 2723 |
| 351 | Ga0501042_0235950 | 3300049578 | Bacteria | 1320 |
| 352 | Ga0501042_0316276 | 3300049578 | Bacteria | 1128 |
| 353 | Ga0501046_0237003 | 3300049580 | Bacteria | 1347 |
| 354 | Ga0501048_0213897 | 3300049582 | Bacteria | 1367 |
| 355 | Ga0501048_0309266 | 3300049582 | Bacteria | 1125 |
| 356 | Ga0501068_0276809 | 3300049584 | Bacteria | 1072 |
| 357 | Ga0501071_0228613 | 3300049587 | Bacteria | 1401 |
| 358 | Ga0501072_0066874 | 3300049588 | Bacteria | 2835 |
| 359 | Ga0501072_0111471 | 3300049588 | Bacteria | 2178 |
| 360 | Ga0501073_0018855 | 3300049589 | Bacteria | 4986 |
| 361 | Ga0501073_0323958 | 3300049589 | Bacteria | 1064 |
| 362 | Ga0501075_0059639 | 3300049591 | Bacteria | 2874 |
| 363 | Ga0501076_0012889 | 3300049592 | Bacteria | 6257 |
| 364 | Ga0501076_0022893 | 3300049592 | Bacteria | 4807 |
| 365 | Ga0501076_0038905 | 3300049592 | Bacteria | 3733 |
| 366 | Ga0501076_0060409 | 3300049592 | Bacteria | 3016 |
| 367 | Ga0501076_0136981 | 3300049592 | Bacteria | 1988 |
| 368 | Ga0501076_0343459 | 3300049592 | Bacteria | 1225 |
| 369 | Ga0501077_0359841 | 3300049593 | Bacteria | 929 |
| 370 | Ga0501077_0375248 | 3300049593 | Bacteria | 908 |
| 371 | Ga0501077_0380277 | 3300049593 | Bacteria | 902 |
| 372 | Ga0501079_0106001 | 3300049741 | Bacteria | 2181 |
| 373 | Ga0501079_0182038 | 3300049741 | Bacteria | 1640 |
| 374 | Ga0501080_0370117 | 3300049742 | Bacteria | 1292 |
| 375 | Ga0501081_0028362 | 3300049743 | Bacteria | 3778 |
| 376 | Ga0501081_0064578 | 3300049743 | Bacteria | 2543 |
| 377 | Ga0501081_0137400 | 3300049743 | Bacteria | 1750 |
| 378 | Ga0501275_007175 | 3300049772 | Bacteria | 1115 |
| 379 | Ga0501044_0005862 | 3300049823 | Bacteria | 13610 |
| 380 | Ga0501045_0264565 | 3300049824 | Bacteria | 1280 |
| 381 | Ga0501045_0358456 | 3300049824 | Bacteria | 1085 |
| 382 | nmdc:mga0k408_399725_c1 | 3300050493 | Bacteria | 818 |
| 383 | nmdc:mga06z11_99953_c1 | 3300050494 | Bacteria | 1590 |
| 384 | nmdc:mga05p37_1089_c2 | 3300050507 | Bacteria | 22817 |
| 385 | nmdc:mga05p37_13248_c1 | 3300050507 | Bacteria | 9872 |
| 386 | nmdc:mga05p37_17662_c1 | 3300050507 | Bacteria | 8608 |
| 387 | nmdc:mga05p37_24585_c1 | 3300050507 | Bacteria | 7323 |
| 388 | nmdc:mga05p37_3190_c1 | 3300050507 | Bacteria | 19076 |
| 389 | nmdc:mga05p37_406677_c1 | 3300050507 | Bacteria | 1588 |
| 390 | nmdc:mga05p37_48699_c1 | 3300050507 | Bacteria | 5212 |
| 391 | nmdc:mga05p37_638_c1 | 3300050507 | Bacteria | 38795 |
| 392 | nmdc:mga05p37_7289_c1 | 3300050507 | Bacteria | 13048 |
| 393 | nmdc:mga09592_201795_c1 | 3300050508 | Bacteria | 1722 |
| 394 | nmdc:mga09592_2104_c1 | 3300050508 | Bacteria | 16079 |
| 395 | nmdc:mga09592_574513_c1 | 3300050508 | Bacteria | 967 |
| 396 | nmdc:mga09592_98413_c1 | 3300050508 | Bacteria | 2504 |
| 397 | nmdc:mga0qj67_1418_c1 | 3300050509 | Bacteria | 16781 |
| 398 | nmdc:mga0qj67_16753_c1 | 3300050509 | Bacteria | 1778 |
| 399 | nmdc:mga0qj67_191129_c1 | 3300050509 | Bacteria | 1664 |
| 400 | nmdc:mga0qj67_26156_c1 | 3300050509 | Bacteria | 4516 |
| 401 | nmdc:mga0qj67_462470_c1 | 3300050509 | Bacteria | 1021 |
| 402 | nmdc:mga0qj67_68163_c1 | 3300050509 | Bacteria | 2835 |
| 403 | nmdc:mga0qj67_84767_c1 | 3300050509 | Bacteria | 2541 |
| 404 | nmdc:mga06r32_116222_c1 | 3300050510 | Bacteria | 2636 |
| 405 | nmdc:mga06r32_171214_c1 | 3300050510 | Bacteria | 2155 |
| 406 | nmdc:mga06r32_18246_c1 | 3300050510 | Bacteria | 6422 |
| 407 | nmdc:mga06r32_256112_c1 | 3300050510 | Bacteria | 1738 |
| 408 | nmdc:mga06r32_330202_c1 | 3300050510 | Bacteria | 1510 |
| 409 | nmdc:mga06r32_402227_c1 | 3300050510 | Bacteria | 1351 |
| 410 | nmdc:mga06r32_420285_c1 | 3300050510 | Bacteria | 1318 |
| 411 | nmdc:mga06r32_531038_c1 | 3300050510 | Bacteria | 1152 |
| 412 | nmdc:mga06r32_635494_c1 | 3300050510 | Bacteria | 1036 |
| 413 | nmdc:mga06r32_640784_c1 | 3300050510 | Bacteria | 1031 |
| 414 | nmdc:mga06r32_7742_c1 | 3300050510 | Bacteria | 9661 |
| 415 | nmdc:mga08y16_11526_c1 | 3300050511 | Bacteria | 9290 |
| 416 | nmdc:mga08y16_134943_c1 | 3300050511 | Bacteria | 2565 |
| 417 | nmdc:mga08y16_22957_c1 | 3300050511 | Bacteria | 6586 |
| 418 | nmdc:mga08y16_240936_c1 | 3300050511 | Bacteria | 1870 |
| 419 | nmdc:mga08y16_422576_c1 | 3300050511 | Bacteria | 1362 |
| 420 | nmdc:mga08y16_4743_c1 | 3300050511 | Bacteria | 14177 |
| 421 | nmdc:mga0n895_23759_c1 | 3300050512 | Bacteria | 5767 |
| 422 | nmdc:mga0n895_948488_c1 | 3300050512 | Bacteria | 844 |
| 423 | nmdc:mga0rr50_14702_c1 | 3300050513 | Bacteria | 5145 |
| 424 | nmdc:mga0rr50_172872_c1 | 3300050513 | Bacteria | 1762 |
| 425 | nmdc:mga08x19_198661_c1 | 3300050514 | Bacteria | 1374 |
| 426 | nmdc:mga08x19_41891_c1 | 3300050514 | Bacteria | 2917 |
| 427 | nmdc:mga0a205_189664_c1 | 3300050515 | Bacteria | 1948 |
| 428 | nmdc:mga0a205_197897_c2 | 3300050515 | Bacteria | 1604 |
| 429 | nmdc:mga0a205_30478_c1 | 3300050515 | Bacteria | 5165 |
| 430 | nmdc:mga0a205_42661_c1 | 3300050515 | Bacteria | 4371 |
| 431 | nmdc:mga0a205_7790_c1 | 3300050515 | Bacteria | 9724 |
| 432 | Ga0495601_0009584 | 3300053077 | Bacteria | 5735 |
| 433 | Ga0495601_0335179 | 3300053077 | Bacteria | 984 |
| 434 | Ga0495595_0138976 | 3300053084 | Bacteria | 1191 |
| 435 | Ga0495619_0002018 | 3300053085 | Bacteria | 13495 |
| 436 | Ga0495619_0051374 | 3300053085 | Bacteria | 2724 |
| 437 | Ga0495619_0086299 | 3300053085 | Bacteria | 2121 |
| 438 | Ga0495619_0096362 | 3300053085 | Bacteria | 2008 |
| 439 | Ga0495619_0303285 | 3300053085 | Bacteria | 1106 |
| 440 | Ga0500556_0077228 | 3300053104 | Bacteria | 1253 |
| 441 | Ga0501084_0035846 | 3300054114 | Bacteria | 4147 |
| 442 | Ga0501084_0062718 | 3300054114 | Bacteria | 3112 |
| 443 | Ga0501084_0168936 | 3300054114 | Bacteria | 1846 |
| 444 | Ga0501084_0249946 | 3300054114 | Bacteria | 1497 |
| 445 | Ga0590075_049921 | 3300059424 | Bacteria | 1073 |
| 446 | Ga0590077_021269 | 3300059426 | Bacteria | 1380 |
| 447 | Ga0501082_0062927 | 3300060353 | Bacteria | 3195 |
| 448 | Ga0501082_0104346 | 3300060353 | Bacteria | 2452 |
| 449 | Ga0530510_0142745 | 3300061734 | Bacteria | 1765 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035118 | Ga0373954_0091942 | Ga0373954_0091942_18_698 | 222 |
| 2 | 3300026035 | Ga0207703_10891737 | Ga0207703_108917371 | 228 |
| 3 | 3300026075 | Ga0207708_10107833 | Ga0207708_101078332 | 228 |
| 4 | 3300046689 | Ga0495613_0443950 | Ga0495613_0443950_21_716 | 228 |
| 5 | 3300050514 | nmdc:mga08x19_198661_c1 | nmdc:mga08x19_198661_c1_678_1364 | 228 |
| 6 | 3300041410 | Ga0439461_0082316 | Ga0439461_0082316_53_745 | 230 |
| 7 | 3300049574 | Ga0501038_0684501 | Ga0501038_0684501_17_709 | 230 |
| 8 | 3300044712 | Ga0453684_0863226 | Ga0453684_0863226_11_709 | 232 |
| 9 | 3300048911 | Ga0496108_0727049 | Ga0496108_0727049_10_708 | 232 |
| 10 | 3300049592 | Ga0501076_0012889 | Ga0501076_0012889_121_912 | 233 |
| 11 | 3300017792 | Ga0163161_10315553 | Ga0163161_103155532 | 235 |
| 12 | 3300048920 | Ga0496117_0000079 | Ga0496117_0000079_13615_14349 | 236 |
| 13 | 3300049772 | Ga0501275_007175 | Ga0501275_007175_87_797 | 236 |
| 14 | iso_pu_bacteria | 2939615513 | 2939617208 | 236 |
| 15 | 3300005440 | Ga0070705_100348680 | Ga0070705_1003486802 | 239 |
| 16 | 3300005468 | Ga0070707_100125144 | Ga0070707_1001251442 | 239 |
| 17 | 3300005471 | Ga0070698_100410225 | Ga0070698_1004102252 | 239 |
| 18 | 3300006844 | Ga0075428_100816357 | Ga0075428_1008163571 | 239 |
| 19 | 3300006852 | Ga0075433_10126984 | Ga0075433_101269842 | 239 |
| 20 | 3300039437 | Ga0436365_0589265 | Ga0436365_0589265_1073_1804 | 239 |
| 21 | 3300046516 | Ga0495628_0364169 | Ga0495628_0364169_255_986 | 239 |
| 22 | 3300046517 | Ga0495630_0024883 | Ga0495630_0024883_2219_2950 | 239 |
| 23 | 3300050515 | nmdc:mga0a205_42661_c1 | nmdc:mga0a205_42661_c1_2262_2993 | 239 |
| 24 | 3300035091 | Ga0373951_0035804 | Ga0373951_0035804_376_1125 | 245 |
| 25 | 3300035116 | Ga0373945_0038785 | Ga0373945_0038785_613_1359 | 248 |
| 26 | 3300005937 | Ga0081455_10187638 | Ga0081455_101876382 | 250 |
| 27 | 3300050511 | nmdc:mga08y16_22957_c1 | nmdc:mga08y16_22957_c1_414_1178 | 251 |
| 28 | 3300005471 | Ga0070698_100159625 | Ga0070698_1001596252 | 255 |
| 29 | 3300006844 | Ga0075428_100068382 | Ga0075428_1000683824 | 255 |
| 30 | 3300006847 | Ga0075431_100009084 | Ga0075431_1000090848 | 255 |
| 31 | 3300006847 | Ga0075431_100400283 | Ga0075431_1004002832 | 255 |
| 32 | 3300006852 | Ga0075433_10176061 | Ga0075433_101760612 | 255 |
| 33 | 3300009094 | Ga0111539_10098969 | Ga0111539_100989694 | 255 |
| 34 | 3300009094 | Ga0111539_10428899 | Ga0111539_104288992 | 255 |
| 35 | 3300009147 | Ga0114129_10347217 | Ga0114129_103472172 | 255 |
| 36 | 3300013308 | Ga0157375_10221390 | Ga0157375_102213902 | 255 |
| 37 | 3300027907 | Ga0207428_10179209 | Ga0207428_101792092 | 255 |
| 38 | 3300027907 | Ga0207428_10347185 | Ga0207428_103471852 | 255 |
| 39 | 3300042132 | Ga0450895_004607 | Ga0450895_004607_52_822 | 255 |
| 40 | 3300050510 | nmdc:mga06r32_531038_c1 | nmdc:mga06r32_531038_c1_320_1120 | 255 |
| 41 | 3300050511 | nmdc:mga08y16_134943_c1 | nmdc:mga08y16_134943_c1_111_911 | 255 |
| 42 | 3300050511 | nmdc:mga08y16_240936_c1 | nmdc:mga08y16_240936_c1_673_1473 | 255 |
| 43 | 3300050515 | nmdc:mga0a205_189664_c1 | nmdc:mga0a205_189664_c1_113_913 | 255 |
| 44 | 3300031728 | Ga0316578_10066203 | Ga0316578_100662032 | 256 |
| 45 | 3300032139 | Ga0316580_10028413 | Ga0316580_100284132 | 256 |
| 46 | 3300035398 | Ga0316574_0183873 | Ga0316574_0183873_327_1112 | 256 |
| 47 | 3300036712 | Ga0316584_0081934 | Ga0316584_0081934_580_1365 | 256 |
| 48 | 3300006847 | Ga0075431_100014869 | Ga0075431_1000148693 | 260 |
| 49 | 3300041410 | Ga0439461_0036812 | Ga0439461_0036812_78_860 | 260 |
| 50 | 3300042004 | Ga0439445_0031255 | Ga0439445_0031255_110_892 | 260 |
| 51 | 3300042007 | Ga0439449_0022696 | Ga0439449_0022696_926_1708 | 260 |
| 52 | 3300042156 | Ga0439446_0130586 | Ga0439446_0130586_11_793 | 260 |
| 53 | 3300042435 | Ga0439434_0001238 | Ga0439434_0001238_3519_4301 | 260 |
| 54 | 3300050510 | nmdc:mga06r32_420285_c1 | nmdc:mga06r32_420285_c1_344_1126 | 260 |
| 55 | 3300005331 | Ga0070670_100059476 | Ga0070670_1000594763 | 261 |
| 56 | 3300005335 | Ga0070666_10072574 | Ga0070666_100725742 | 261 |
| 57 | 3300005345 | Ga0070692_10043816 | Ga0070692_100438162 | 261 |
| 58 | 3300005353 | Ga0070669_100043411 | Ga0070669_1000434112 | 261 |
| 59 | 3300005355 | Ga0070671_100090311 | Ga0070671_1000903113 | 261 |
| 60 | 3300005364 | Ga0070673_100026814 | Ga0070673_1000268142 | 261 |
| 61 | 3300005366 | Ga0070659_100129725 | Ga0070659_1001297252 | 261 |
| 62 | 3300005367 | Ga0070667_100101921 | Ga0070667_1001019211 | 261 |
| 63 | 3300005434 | Ga0070709_10368880 | Ga0070709_103688802 | 261 |
| 64 | 3300005436 | Ga0070713_100004300 | Ga0070713_1000043007 | 261 |
| 65 | 3300005440 | Ga0070705_100055922 | Ga0070705_1000559222 | 261 |
| 66 | 3300005457 | Ga0070662_100285510 | Ga0070662_1002855102 | 261 |
| 67 | 3300005459 | Ga0068867_100074656 | Ga0068867_1000746563 | 261 |
| 68 | 3300005543 | Ga0070672_100160747 | Ga0070672_1001607471 | 261 |
| 69 | 3300005545 | Ga0070695_100191896 | Ga0070695_1001918962 | 261 |
| 70 | 3300005549 | Ga0070704_100071006 | Ga0070704_1000710062 | 261 |
| 71 | 3300005615 | Ga0070702_100010325 | Ga0070702_1000103253 | 261 |
| 72 | 3300005616 | Ga0068852_100054353 | Ga0068852_1000543533 | 261 |
| 73 | 3300005718 | Ga0068866_10041048 | Ga0068866_100410482 | 261 |
| 74 | 3300005844 | Ga0068862_100659791 | Ga0068862_1006597912 | 261 |
| 75 | 3300006042 | Ga0075368_10019907 | Ga0075368_100199073 | 261 |
| 76 | 3300006178 | Ga0075367_10007865 | Ga0075367_100078652 | 261 |
| 77 | 3300006195 | Ga0075366_10240951 | Ga0075366_102409512 | 261 |
| 78 | 3300006358 | Ga0068871_100178172 | Ga0068871_1001781722 | 261 |
| 79 | 3300006844 | Ga0075428_100000995 | Ga0075428_1000009955 | 261 |
| 80 | 3300006844 | Ga0075428_100025242 | Ga0075428_1000252424 | 261 |
| 81 | 3300006844 | Ga0075428_100063291 | Ga0075428_1000632913 | 261 |
| 82 | 3300006846 | Ga0075430_100003143 | Ga0075430_10000314313 | 261 |
| 83 | 3300006846 | Ga0075430_100003168 | Ga0075430_1000031687 | 261 |
| 84 | 3300006846 | Ga0075430_100179339 | Ga0075430_1001793392 | 261 |
| 85 | 3300006846 | Ga0075430_100297844 | Ga0075430_1002978442 | 261 |
| 86 | 3300006847 | Ga0075431_100011342 | Ga0075431_1000113426 | 261 |
| 87 | 3300006847 | Ga0075431_100015000 | Ga0075431_1000150004 | 261 |
| 88 | 3300006847 | Ga0075431_100021584 | Ga0075431_1000215844 | 261 |
| 89 | 3300006847 | Ga0075431_100171089 | Ga0075431_1001710892 | 261 |
| 90 | 3300006847 | Ga0075431_100182583 | Ga0075431_1001825831 | 261 |
| 91 | 3300006847 | Ga0075431_100237155 | Ga0075431_1002371552 | 261 |
| 92 | 3300006852 | Ga0075433_10008838 | Ga0075433_100088385 | 261 |
| 93 | 3300006852 | Ga0075433_10053906 | Ga0075433_100539062 | 261 |
| 94 | 3300006880 | Ga0075429_100001657 | Ga0075429_10000165710 | 261 |
| 95 | 3300006880 | Ga0075429_100046262 | Ga0075429_1000462622 | 261 |
| 96 | 3300006881 | Ga0068865_100283461 | Ga0068865_1002834612 | 261 |
| 97 | 3300007076 | Ga0075435_100019332 | Ga0075435_1000193325 | 261 |
| 98 | 3300009094 | Ga0111539_10000201 | Ga0111539_1000020122 | 261 |
| 99 | 3300009094 | Ga0111539_10156632 | Ga0111539_101566322 | 261 |
| 100 | 3300009147 | Ga0114129_10000751 | Ga0114129_100007517 | 261 |
| 101 | 3300009147 | Ga0114129_10001134 | Ga0114129_1000113412 | 261 |
| 102 | 3300009147 | Ga0114129_10005506 | Ga0114129_1000550613 | 261 |
| 103 | 3300009147 | Ga0114129_10035177 | Ga0114129_100351774 | 261 |
| 104 | 3300009147 | Ga0114129_10042024 | Ga0114129_100420246 | 261 |
| 105 | 3300009147 | Ga0114129_10155160 | Ga0114129_101551603 | 261 |
| 106 | 3300009174 | Ga0105241_10174158 | Ga0105241_101741582 | 261 |
| 107 | 3300009176 | Ga0105242_10067202 | Ga0105242_100672022 | 261 |
| 108 | 3300009177 | Ga0105248_10066354 | Ga0105248_100663542 | 261 |
| 109 | 3300010375 | Ga0105239_10089908 | Ga0105239_100899084 | 261 |
| 110 | 3300025899 | Ga0207642_10018052 | Ga0207642_100180522 | 261 |
| 111 | 3300025903 | Ga0207680_10150851 | Ga0207680_101508512 | 261 |
| 112 | 3300025906 | Ga0207699_10046271 | Ga0207699_100462712 | 261 |
| 113 | 3300025907 | Ga0207645_10002511 | Ga0207645_100025116 | 261 |
| 114 | 3300025911 | Ga0207654_10109300 | Ga0207654_101093002 | 261 |
| 115 | 3300025918 | Ga0207662_10010044 | Ga0207662_100100442 | 261 |
| 116 | 3300025925 | Ga0207650_10094438 | Ga0207650_100944382 | 261 |
| 117 | 3300025928 | Ga0207700_10133593 | Ga0207700_101335932 | 261 |
| 118 | 3300025931 | Ga0207644_10081279 | Ga0207644_100812792 | 261 |
| 119 | 3300025932 | Ga0207690_10038420 | Ga0207690_100384201 | 261 |
| 120 | 3300025933 | Ga0207706_10573120 | Ga0207706_105731202 | 261 |
| 121 | 3300025940 | Ga0207691_10061874 | Ga0207691_100618744 | 261 |
| 122 | 3300025942 | Ga0207689_10014199 | Ga0207689_100141994 | 261 |
| 123 | 3300025960 | Ga0207651_10013471 | Ga0207651_100134715 | 261 |
| 124 | 3300026075 | Ga0207708_10018403 | Ga0207708_100184033 | 261 |
| 125 | 3300026089 | Ga0207648_10093742 | Ga0207648_100937423 | 261 |
| 126 | 3300026121 | Ga0207683_10513953 | Ga0207683_105139531 | 261 |
| 127 | 3300027866 | Ga0209813_10014211 | Ga0209813_100142112 | 261 |
| 128 | 3300027907 | Ga0207428_10000445 | Ga0207428_1000044528 | 261 |
| 129 | 3300028381 | Ga0268264_10150083 | Ga0268264_101500832 | 261 |
| 130 | 3300031548 | Ga0307408_100005759 | Ga0307408_1000057596 | 261 |
| 131 | 3300031548 | Ga0307408_100095422 | Ga0307408_1000954222 | 261 |
| 132 | 3300031548 | Ga0307408_100189122 | Ga0307408_1001891222 | 261 |
| 133 | 3300031852 | Ga0307410_10232206 | Ga0307410_102322062 | 261 |
| 134 | 3300031852 | Ga0307410_10479431 | Ga0307410_104794311 | 261 |
| 135 | 3300031901 | Ga0307406_10075346 | Ga0307406_100753462 | 261 |
| 136 | 3300031901 | Ga0307406_10106325 | Ga0307406_101063252 | 261 |
| 137 | 3300031901 | Ga0307406_10668662 | Ga0307406_106686621 | 261 |
| 138 | 3300031911 | Ga0307412_10552741 | Ga0307412_105527411 | 261 |
| 139 | 3300032002 | Ga0307416_100040297 | Ga0307416_1000402971 | 261 |
| 140 | 3300032002 | Ga0307416_100076446 | Ga0307416_1000764462 | 261 |
| 141 | 3300032002 | Ga0307416_100151899 | Ga0307416_1001518992 | 261 |
| 142 | 3300032005 | Ga0307411_10100466 | Ga0307411_101004662 | 261 |
| 143 | 3300032126 | Ga0307415_100048304 | Ga0307415_1000483042 | 261 |
| 144 | 3300035170 | Ga0373943_0168899 | Ga0373943_0168899_30_815 | 261 |
| 145 | 3300035691 | Ga0373931_0169563 | Ga0373931_0169563_346_1131 | 261 |
| 146 | 3300036401 | Ga0373937_0000513 | Ga0373937_0000513_7286_8071 | 261 |
| 147 | 3300037068 | Ga0373925_0003323 | Ga0373925_0003323_39_824 | 261 |
| 148 | 3300042001 | Ga0439441_020618 | Ga0439441_020618_78_863 | 261 |
| 149 | 3300042126 | Ga0450888_012300 | Ga0450888_012300_129_914 | 261 |
| 150 | 3300042436 | Ga0439435_0003326 | Ga0439435_0003326_1531_2316 | 261 |
| 151 | 3300042439 | Ga0439464_0006098 | Ga0439464_0006098_2297_3082 | 261 |
| 152 | 3300042439 | Ga0439464_0025314 | Ga0439464_0025314_760_1545 | 261 |
| 153 | 3300042461 | Ga0439460_0016107 | Ga0439460_0016107_1037_1822 | 261 |
| 154 | 3300042461 | Ga0439460_0058392 | Ga0439460_0058392_129_914 | 261 |
| 155 | 3300042461 | Ga0439460_0083519 | Ga0439460_0083519_175_960 | 261 |
| 156 | 3300042993 | Ga0439440_0016925 | Ga0439440_0016925_436_1221 | 261 |
| 157 | 3300046680 | Ga0495646_0290419 | Ga0495646_0290419_28_813 | 261 |
| 158 | 3300048916 | Ga0496113_0265775 | Ga0496113_0265775_327_1112 | 261 |
| 159 | 3300049568 | Ga0501031_0088367 | Ga0501031_0088367_996_1781 | 261 |
| 160 | 3300049575 | Ga0501039_0046708 | Ga0501039_0046708_1102_1887 | 261 |
| 161 | 3300049575 | Ga0501039_0437031 | Ga0501039_0437031_79_864 | 261 |
| 162 | 3300049576 | Ga0501040_0031302 | Ga0501040_0031302_2195_2980 | 261 |
| 163 | 3300049576 | Ga0501040_0070246 | Ga0501040_0070246_331_1116 | 261 |
| 164 | 3300049578 | Ga0501042_0059731 | Ga0501042_0059731_1699_2484 | 261 |
| 165 | 3300049578 | Ga0501042_0316276 | Ga0501042_0316276_309_1094 | 261 |
| 166 | 3300049582 | Ga0501048_0213897 | Ga0501048_0213897_388_1173 | 261 |
| 167 | 3300049582 | Ga0501048_0309266 | Ga0501048_0309266_19_804 | 261 |
| 168 | 3300049584 | Ga0501068_0276809 | Ga0501068_0276809_74_859 | 261 |
| 169 | 3300049587 | Ga0501071_0228613 | Ga0501071_0228613_415_1200 | 261 |
| 170 | 3300049588 | Ga0501072_0066874 | Ga0501072_0066874_34_819 | 261 |
| 171 | 3300049588 | Ga0501072_0111471 | Ga0501072_0111471_1179_1964 | 261 |
| 172 | 3300049589 | Ga0501073_0018855 | Ga0501073_0018855_2678_3463 | 261 |
| 173 | 3300049589 | Ga0501073_0323958 | Ga0501073_0323958_94_879 | 261 |
| 174 | 3300049591 | Ga0501075_0059639 | Ga0501075_0059639_179_964 | 261 |
| 175 | 3300049592 | Ga0501076_0022893 | Ga0501076_0022893_871_1656 | 261 |
| 176 | 3300049592 | Ga0501076_0038905 | Ga0501076_0038905_1014_1799 | 261 |
| 177 | 3300049592 | Ga0501076_0060409 | Ga0501076_0060409_1931_2716 | 261 |
| 178 | 3300049593 | Ga0501077_0375248 | Ga0501077_0375248_18_803 | 261 |
| 179 | 3300049593 | Ga0501077_0380277 | Ga0501077_0380277_92_877 | 261 |
| 180 | 3300049741 | Ga0501079_0106001 | Ga0501079_0106001_535_1320 | 261 |
| 181 | 3300049742 | Ga0501080_0370117 | Ga0501080_0370117_195_980 | 261 |
| 182 | 3300049743 | Ga0501081_0064578 | Ga0501081_0064578_1330_2115 | 261 |
| 183 | 3300049743 | Ga0501081_0137400 | Ga0501081_0137400_28_813 | 261 |
| 184 | 3300049824 | Ga0501045_0264565 | Ga0501045_0264565_244_1029 | 261 |
| 185 | 3300050493 | nmdc:mga0k408_399725_c1 | nmdc:mga0k408_399725_c1_17_802 | 261 |
| 186 | 3300050494 | nmdc:mga06z11_99953_c1 | nmdc:mga06z11_99953_c1_566_1351 | 261 |
| 187 | 3300050507 | nmdc:mga05p37_1089_c2 | nmdc:mga05p37_1089_c2_7198_7983 | 261 |
| 188 | 3300050507 | nmdc:mga05p37_13248_c1 | nmdc:mga05p37_13248_c1_6959_7744 | 261 |
| 189 | 3300050507 | nmdc:mga05p37_406677_c1 | nmdc:mga05p37_406677_c1_785_1570 | 261 |
| 190 | 3300050507 | nmdc:mga05p37_48699_c1 | nmdc:mga05p37_48699_c1_2686_3471 | 261 |
| 191 | 3300050507 | nmdc:mga05p37_638_c1 | nmdc:mga05p37_638_c1_6027_6812 | 261 |
| 192 | 3300050507 | nmdc:mga05p37_7289_c1 | nmdc:mga05p37_7289_c1_7555_8340 | 261 |
| 193 | 3300050508 | nmdc:mga09592_201795_c1 | nmdc:mga09592_201795_c1_134_919 | 261 |
| 194 | 3300050508 | nmdc:mga09592_2104_c1 | nmdc:mga09592_2104_c1_3788_4573 | 261 |
| 195 | 3300050508 | nmdc:mga09592_574513_c1 | nmdc:mga09592_574513_c1_32_817 | 261 |
| 196 | 3300050508 | nmdc:mga09592_98413_c1 | nmdc:mga09592_98413_c1_1706_2491 | 261 |
| 197 | 3300050509 | nmdc:mga0qj67_1418_c1 | nmdc:mga0qj67_1418_c1_5050_5835 | 261 |
| 198 | 3300050509 | nmdc:mga0qj67_16753_c1 | nmdc:mga0qj67_16753_c1_558_1343 | 261 |
| 199 | 3300050509 | nmdc:mga0qj67_191129_c1 | nmdc:mga0qj67_191129_c1_768_1553 | 261 |
| 200 | 3300050509 | nmdc:mga0qj67_26156_c1 | nmdc:mga0qj67_26156_c1_199_984 | 261 |
| 201 | 3300050509 | nmdc:mga0qj67_84767_c1 | nmdc:mga0qj67_84767_c1_579_1364 | 261 |
| 202 | 3300050510 | nmdc:mga06r32_116222_c1 | nmdc:mga06r32_116222_c1_1205_1990 | 261 |
| 203 | 3300050510 | nmdc:mga06r32_171214_c1 | nmdc:mga06r32_171214_c1_896_1681 | 261 |
| 204 | 3300050510 | nmdc:mga06r32_18246_c1 | nmdc:mga06r32_18246_c1_4770_5555 | 261 |
| 205 | 3300050510 | nmdc:mga06r32_256112_c1 | nmdc:mga06r32_256112_c1_543_1328 | 261 |
| 206 | 3300050510 | nmdc:mga06r32_7742_c1 | nmdc:mga06r32_7742_c1_3158_3943 | 261 |
| 207 | 3300050511 | nmdc:mga08y16_422576_c1 | nmdc:mga08y16_422576_c1_438_1223 | 261 |
| 208 | 3300050511 | nmdc:mga08y16_4743_c1 | nmdc:mga08y16_4743_c1_5293_6078 | 261 |
| 209 | 3300050512 | nmdc:mga0n895_948488_c1 | nmdc:mga0n895_948488_c1_14_799 | 261 |
| 210 | 3300050513 | nmdc:mga0rr50_172872_c1 | nmdc:mga0rr50_172872_c1_39_824 | 261 |
| 211 | 3300050515 | nmdc:mga0a205_7790_c1 | nmdc:mga0a205_7790_c1_286_1071 | 261 |
| 212 | 3300053084 | Ga0495595_0138976 | Ga0495595_0138976_175_960 | 261 |
| 213 | 3300053085 | Ga0495619_0051374 | Ga0495619_0051374_1211_1996 | 261 |
| 214 | 3300054114 | Ga0501084_0035846 | Ga0501084_0035846_2106_2891 | 261 |
| 215 | 3300054114 | Ga0501084_0168936 | Ga0501084_0168936_246_1031 | 261 |
| 216 | 3300061734 | Ga0530510_0142745 | Ga0530510_0142745_786_1571 | 261 |
| 217 | 3300006847 | Ga0075431_100096381 | Ga0075431_1000963813 | 262 |
| 218 | 3300006852 | Ga0075433_10021567 | Ga0075433_100215672 | 262 |
| 219 | 3300009094 | Ga0111539_10211645 | Ga0111539_102116452 | 262 |
| 220 | 3300009147 | Ga0114129_10001999 | Ga0114129_1000199925 | 262 |
| 221 | 3300026035 | Ga0207703_10116728 | Ga0207703_101167282 | 262 |
| 222 | 3300027907 | Ga0207428_10002413 | Ga0207428_1000241314 | 262 |
| 223 | 3300031852 | Ga0307410_10084721 | Ga0307410_100847212 | 262 |
| 224 | 3300032002 | Ga0307416_100138570 | Ga0307416_1001385702 | 262 |
| 225 | 3300049574 | Ga0501038_0287785 | Ga0501038_0287785_149_937 | 262 |
| 226 | 3300049575 | Ga0501039_0078906 | Ga0501039_0078906_1710_2498 | 262 |
| 227 | 3300049578 | Ga0501042_0235950 | Ga0501042_0235950_433_1221 | 262 |
| 228 | 3300049580 | Ga0501046_0237003 | Ga0501046_0237003_449_1258 | 262 |
| 229 | 3300049592 | Ga0501076_0343459 | Ga0501076_0343459_133_921 | 262 |
| 230 | 3300049741 | Ga0501079_0182038 | Ga0501079_0182038_35_823 | 262 |
| 231 | 3300050507 | nmdc:mga05p37_3190_c1 | nmdc:mga05p37_3190_c1_10518_11318 | 262 |
| 232 | 3300050509 | nmdc:mga0qj67_462470_c1 | nmdc:mga0qj67_462470_c1_81_869 | 262 |
| 233 | 3300050510 | nmdc:mga06r32_330202_c1 | nmdc:mga06r32_330202_c1_600_1388 | 262 |
| 234 | 3300050510 | nmdc:mga06r32_635494_c1 | nmdc:mga06r32_635494_c1_20_808 | 262 |
| 235 | 3300050510 | nmdc:mga06r32_640784_c1 | nmdc:mga06r32_640784_c1_82_870 | 262 |
| 236 | 3300050511 | nmdc:mga08y16_11526_c1 | nmdc:mga08y16_11526_c1_2307_3095 | 262 |
| 237 | 3300050515 | nmdc:mga0a205_30478_c1 | nmdc:mga0a205_30478_c1_810_1610 | 262 |
| 238 | 3300054114 | Ga0501084_0062718 | Ga0501084_0062718_2220_3008 | 262 |
| 239 | 3300005290 | Ga0065712_10039260 | Ga0065712_100392602 | 263 |
| 240 | 3300005290 | Ga0065712_10239246 | Ga0065712_102392461 | 263 |
| 241 | 3300005293 | Ga0065715_10409685 | Ga0065715_104096851 | 263 |
| 242 | 3300005334 | Ga0068869_100278026 | Ga0068869_1002780262 | 263 |
| 243 | 3300005335 | Ga0070666_10087235 | Ga0070666_100872353 | 263 |
| 244 | 3300005337 | Ga0070682_100245426 | Ga0070682_1002454262 | 263 |
| 245 | 3300005347 | Ga0070668_100006636 | Ga0070668_1000066364 | 263 |
| 246 | 3300005347 | Ga0070668_100070147 | Ga0070668_1000701472 | 263 |
| 247 | 3300005353 | Ga0070669_100105149 | Ga0070669_1001051492 | 263 |
| 248 | 3300005354 | Ga0070675_100524120 | Ga0070675_1005241201 | 263 |
| 249 | 3300005354 | Ga0070675_100542900 | Ga0070675_1005429002 | 263 |
| 250 | 3300005356 | Ga0070674_100033558 | Ga0070674_1000335584 | 263 |
| 251 | 3300005356 | Ga0070674_100085165 | Ga0070674_1000851652 | 263 |
| 252 | 3300005366 | Ga0070659_100098075 | Ga0070659_1000980752 | 263 |
| 253 | 3300005439 | Ga0070711_100069949 | Ga0070711_1000699493 | 263 |
| 254 | 3300005457 | Ga0070662_100157840 | Ga0070662_1001578402 | 263 |
| 255 | 3300005457 | Ga0070662_100195523 | Ga0070662_1001955232 | 263 |
| 256 | 3300005458 | Ga0070681_10003693 | Ga0070681_100036936 | 263 |
| 257 | 3300005471 | Ga0070698_100133526 | Ga0070698_1001335263 | 263 |
| 258 | 3300005471 | Ga0070698_100300494 | Ga0070698_1003004942 | 263 |
| 259 | 3300005530 | Ga0070679_100080150 | Ga0070679_1000801502 | 263 |
| 260 | 3300005543 | Ga0070672_100317365 | Ga0070672_1003173652 | 263 |
| 261 | 3300005546 | Ga0070696_100019487 | Ga0070696_1000194872 | 263 |
| 262 | 3300005548 | Ga0070665_100001879 | Ga0070665_10000187917 | 263 |
| 263 | 3300005548 | Ga0070665_100233467 | Ga0070665_1002334672 | 263 |
| 264 | 3300005549 | Ga0070704_100019719 | Ga0070704_1000197194 | 263 |
| 265 | 3300005564 | Ga0070664_100144108 | Ga0070664_1001441082 | 263 |
| 266 | 3300005564 | Ga0070664_100444122 | Ga0070664_1004441221 | 263 |
| 267 | 3300005577 | Ga0068857_100315828 | Ga0068857_1003158282 | 263 |
| 268 | 3300005617 | Ga0068859_100540531 | Ga0068859_1005405312 | 263 |
| 269 | 3300005617 | Ga0068859_100566826 | Ga0068859_1005668262 | 263 |
| 270 | 3300005719 | Ga0068861_100012368 | Ga0068861_1000123684 | 263 |
| 271 | 3300005834 | Ga0068851_10184555 | Ga0068851_101845552 | 263 |
| 272 | 3300005841 | Ga0068863_100025860 | Ga0068863_1000258601 | 263 |
| 273 | 3300005841 | Ga0068863_100325393 | Ga0068863_1003253932 | 263 |
| 274 | 3300005842 | Ga0068858_100012178 | Ga0068858_1000121787 | 263 |
| 275 | 3300005843 | Ga0068860_100241626 | Ga0068860_1002416261 | 263 |
| 276 | 3300005843 | Ga0068860_100415101 | Ga0068860_1004151011 | 263 |
| 277 | 3300005844 | Ga0068862_100012037 | Ga0068862_1000120376 | 263 |
| 278 | 3300005844 | Ga0068862_100538314 | Ga0068862_1005383142 | 263 |
| 279 | 3300005844 | Ga0068862_100548568 | Ga0068862_1005485681 | 263 |
| 280 | 3300006237 | Ga0097621_100008625 | Ga0097621_1000086254 | 263 |
| 281 | 3300006237 | Ga0097621_100057255 | Ga0097621_1000572554 | 263 |
| 282 | 3300006358 | Ga0068871_100024332 | Ga0068871_1000243323 | 263 |
| 283 | 3300006846 | Ga0075430_100185525 | Ga0075430_1001855252 | 263 |
| 284 | 3300006847 | Ga0075431_100035152 | Ga0075431_1000351521 | 263 |
| 285 | 3300006852 | Ga0075433_10077673 | Ga0075433_100776733 | 263 |
| 286 | 3300006871 | Ga0075434_100086563 | Ga0075434_1000865632 | 263 |
| 287 | 3300006881 | Ga0068865_100136772 | Ga0068865_1001367723 | 263 |
| 288 | 3300006914 | Ga0075436_100050954 | Ga0075436_1000509541 | 263 |
| 289 | 3300006931 | Ga0097620_100540538 | Ga0097620_1005405382 | 263 |
| 290 | 3300006931 | Ga0097620_100566826 | Ga0097620_1005668262 | 263 |
| 291 | 3300007076 | Ga0075435_100004980 | Ga0075435_1000049805 | 263 |
| 292 | 3300009093 | Ga0105240_10017120 | Ga0105240_100171204 | 263 |
| 293 | 3300009098 | Ga0105245_10044220 | Ga0105245_100442203 | 263 |
| 294 | 3300009101 | Ga0105247_10002386 | Ga0105247_100023861 | 263 |
| 295 | 3300009101 | Ga0105247_10196378 | Ga0105247_101963782 | 263 |
| 296 | 3300009147 | Ga0114129_10003812 | Ga0114129_100038126 | 263 |
| 297 | 3300009147 | Ga0114129_10008750 | Ga0114129_100087507 | 263 |
| 298 | 3300009147 | Ga0114129_10066845 | Ga0114129_100668451 | 263 |
| 299 | 3300009148 | Ga0105243_10375938 | Ga0105243_103759382 | 263 |
| 300 | 3300009176 | Ga0105242_10128458 | Ga0105242_101284582 | 263 |
| 301 | 3300009176 | Ga0105242_10714701 | Ga0105242_107147012 | 263 |
| 302 | 3300009177 | Ga0105248_10004005 | Ga0105248_100040059 | 263 |
| 303 | 3300009177 | Ga0105248_10053353 | Ga0105248_100533532 | 263 |
| 304 | 3300009177 | Ga0105248_10139208 | Ga0105248_101392082 | 263 |
| 305 | 3300009177 | Ga0105248_10172496 | Ga0105248_101724962 | 263 |
| 306 | 3300009177 | Ga0105248_10764480 | Ga0105248_107644801 | 263 |
| 307 | 3300009545 | Ga0105237_10465478 | Ga0105237_104654782 | 263 |
| 308 | 3300013297 | Ga0157378_10630835 | Ga0157378_106308351 | 263 |
| 309 | 3300013297 | Ga0157378_10849033 | Ga0157378_108490331 | 263 |
| 310 | 3300013308 | Ga0157375_10073949 | Ga0157375_100739493 | 263 |
| 311 | 3300013308 | Ga0157375_10633748 | Ga0157375_106337482 | 263 |
| 312 | 3300014325 | Ga0163163_10036126 | Ga0163163_100361264 | 263 |
| 313 | 3300014326 | Ga0157380_10668318 | Ga0157380_106683181 | 263 |
| 314 | 3300014968 | Ga0157379_10079608 | Ga0157379_100796083 | 263 |
| 315 | 3300014968 | Ga0157379_10131682 | Ga0157379_101316822 | 263 |
| 316 | 3300014969 | Ga0157376_10004135 | Ga0157376_100041359 | 263 |
| 317 | 3300014969 | Ga0157376_10156950 | Ga0157376_101569502 | 263 |
| 318 | 3300025899 | Ga0207642_10090128 | Ga0207642_100901282 | 263 |
| 319 | 3300025907 | Ga0207645_10057285 | Ga0207645_100572853 | 263 |
| 320 | 3300025912 | Ga0207707_10083559 | Ga0207707_100835593 | 263 |
| 321 | 3300025917 | Ga0207660_10082272 | Ga0207660_100822722 | 263 |
| 322 | 3300025919 | Ga0207657_10119585 | Ga0207657_101195852 | 263 |
| 323 | 3300025921 | Ga0207652_10463580 | Ga0207652_104635802 | 263 |
| 324 | 3300025922 | Ga0207646_10425005 | Ga0207646_104250051 | 263 |
| 325 | 3300025923 | Ga0207681_10151045 | Ga0207681_101510452 | 263 |
| 326 | 3300025926 | Ga0207659_10091502 | Ga0207659_100915022 | 263 |
| 327 | 3300025932 | Ga0207690_10297155 | Ga0207690_102971552 | 263 |
| 328 | 3300025933 | Ga0207706_10130589 | Ga0207706_101305892 | 263 |
| 329 | 3300025933 | Ga0207706_10347139 | Ga0207706_103471391 | 263 |
| 330 | 3300025934 | Ga0207686_10336129 | Ga0207686_103361292 | 263 |
| 331 | 3300025934 | Ga0207686_10548616 | Ga0207686_105486161 | 263 |
| 332 | 3300025937 | Ga0207669_10095277 | Ga0207669_100952772 | 263 |
| 333 | 3300025938 | Ga0207704_10102171 | Ga0207704_101021713 | 263 |
| 334 | 3300025941 | Ga0207711_10023199 | Ga0207711_100231994 | 263 |
| 335 | 3300025941 | Ga0207711_10318220 | Ga0207711_103182202 | 263 |
| 336 | 3300025942 | Ga0207689_10070467 | Ga0207689_100704674 | 263 |
| 337 | 3300025945 | Ga0207679_10750783 | Ga0207679_107507831 | 263 |
| 338 | 3300025949 | Ga0207667_10876940 | Ga0207667_108769401 | 263 |
| 339 | 3300025960 | Ga0207651_10006484 | Ga0207651_100064845 | 263 |
| 340 | 3300025960 | Ga0207651_10239837 | Ga0207651_102398371 | 263 |
| 341 | 3300026023 | Ga0207677_10605277 | Ga0207677_106052772 | 263 |
| 342 | 3300026035 | Ga0207703_10242892 | Ga0207703_102428922 | 263 |
| 343 | 3300026035 | Ga0207703_10935250 | Ga0207703_109352501 | 263 |
| 344 | 3300026075 | Ga0207708_10175554 | Ga0207708_101755541 | 263 |
| 345 | 3300026088 | Ga0207641_10251413 | Ga0207641_102514132 | 263 |
| 346 | 3300026088 | Ga0207641_10416857 | Ga0207641_104168571 | 263 |
| 347 | 3300026088 | Ga0207641_10533023 | Ga0207641_105330231 | 263 |
| 348 | 3300026089 | Ga0207648_10115526 | Ga0207648_101155261 | 263 |
| 349 | 3300026089 | Ga0207648_10708425 | Ga0207648_107084251 | 263 |
| 350 | 3300026095 | Ga0207676_10016334 | Ga0207676_100163344 | 263 |
| 351 | 3300026118 | Ga0207675_100003564 | Ga0207675_1000035649 | 263 |
| 352 | 3300026118 | Ga0207675_100064733 | Ga0207675_1000647332 | 263 |
| 353 | 3300026121 | Ga0207683_10195712 | Ga0207683_101957122 | 263 |
| 354 | 3300028379 | Ga0268266_10203955 | Ga0268266_102039552 | 263 |
| 355 | 3300028379 | Ga0268266_10298376 | Ga0268266_102983762 | 263 |
| 356 | 3300028380 | Ga0268265_10096738 | Ga0268265_100967382 | 263 |
| 357 | 3300028380 | Ga0268265_10265068 | Ga0268265_102650682 | 263 |
| 358 | 3300028380 | Ga0268265_10555111 | Ga0268265_105551112 | 263 |
| 359 | 3300028381 | Ga0268264_10708771 | Ga0268264_107087712 | 263 |
| 360 | 3300031456 | Ga0307513_10547502 | Ga0307513_105475021 | 263 |
| 361 | 3300032002 | Ga0307416_100182350 | Ga0307416_1001823502 | 263 |
| 362 | 3300035086 | Ga0373934_0037848 | Ga0373934_0037848_56_847 | 263 |
| 363 | 3300035086 | Ga0373934_0074023 | Ga0373934_0074023_307_1107 | 263 |
| 364 | 3300035116 | Ga0373945_0022207 | Ga0373945_0022207_869_1660 | 263 |
| 365 | 3300035117 | Ga0373953_0030439 | Ga0373953_0030439_330_1130 | 263 |
| 366 | 3300035170 | Ga0373943_0031772 | Ga0373943_0031772_969_1769 | 263 |
| 367 | 3300035170 | Ga0373943_0270547 | Ga0373943_0270547_94_885 | 263 |
| 368 | 3300035171 | Ga0373946_0010185 | Ga0373946_0010185_1707_2507 | 263 |
| 369 | 3300035171 | Ga0373946_0056744 | Ga0373946_0056744_689_1480 | 263 |
| 370 | 3300035171 | Ga0373946_0214062 | Ga0373946_0214062_103_903 | 263 |
| 371 | 3300035172 | Ga0373955_0037650 | Ga0373955_0037650_162_953 | 263 |
| 372 | 3300035172 | Ga0373955_0092149 | Ga0373955_0092149_658_1458 | 263 |
| 373 | 3300035172 | Ga0373955_0230022 | Ga0373955_0230022_163_960 | 263 |
| 374 | 3300035410 | Ga0373924_0002742 | Ga0373924_0002742_3547_4347 | 263 |
| 375 | 3300035695 | Ga0373927_0080617 | Ga0373927_0080617_636_1436 | 263 |
| 376 | 3300035725 | Ga0373947_0091904 | Ga0373947_0091904_498_1289 | 263 |
| 377 | 3300036401 | Ga0373937_0057140 | Ga0373937_0057140_1201_2001 | 263 |
| 378 | 3300036401 | Ga0373937_0243982 | Ga0373937_0243982_59_850 | 263 |
| 379 | 3300037068 | Ga0373925_0003479 | Ga0373925_0003479_1251_2051 | 263 |
| 380 | 3300037068 | Ga0373925_0543968 | Ga0373925_0543968_132_923 | 263 |
| 381 | 3300041999 | Ga0439433_0033950 | Ga0439433_0033950_309_1112 | 263 |
| 382 | 3300042014 | Ga0439457_014388 | Ga0439457_014388_286_1089 | 263 |
| 383 | 3300042876 | Ga0451577_0012810 | Ga0451577_0012810_3686_4477 | 263 |
| 384 | 3300042876 | Ga0451577_0664002 | Ga0451577_0664002_25_816 | 263 |
| 385 | 3300044712 | Ga0453684_0124671 | Ga0453684_0124671_708_1499 | 263 |
| 386 | 3300046454 | Ga0495592_0306915 | Ga0495592_0306915_98_889 | 263 |
| 387 | 3300046459 | Ga0495629_0233023 | Ga0495629_0233023_432_1232 | 263 |
| 388 | 3300046473 | Ga0495582_0080216 | Ga0495582_0080216_573_1373 | 263 |
| 389 | 3300046511 | Ga0495608_0008013 | Ga0495608_0008013_1416_2216 | 263 |
| 390 | 3300046516 | Ga0495628_0002852 | Ga0495628_0002852_9196_9996 | 263 |
| 391 | 3300046517 | Ga0495630_0009226 | Ga0495630_0009226_3009_3809 | 263 |
| 392 | 3300046529 | Ga0495652_0470402 | Ga0495652_0470402_12_812 | 263 |
| 393 | 3300046536 | Ga0495587_0047900 | Ga0495587_0047900_381_1181 | 263 |
| 394 | 3300046642 | Ga0495634_0208798 | Ga0495634_0208798_79_870 | 263 |
| 395 | 3300046678 | Ga0495599_0136612 | Ga0495599_0136612_603_1394 | 263 |
| 396 | 3300046681 | Ga0495647_0106873 | Ga0495647_0106873_47_838 | 263 |
| 397 | 3300046683 | Ga0495658_0192801 | Ga0495658_0192801_305_1105 | 263 |
| 398 | 3300046689 | Ga0495613_0003890 | Ga0495613_0003890_4100_4900 | 263 |
| 399 | 3300047317 | Ga0495604_0031490 | Ga0495604_0031490_518_1318 | 263 |
| 400 | 3300047317 | Ga0495604_0130531 | Ga0495604_0130531_464_1255 | 263 |
| 401 | 3300047317 | Ga0495604_0255119 | Ga0495604_0255119_385_1176 | 263 |
| 402 | 3300047319 | Ga0495674_0008199 | Ga0495674_0008199_1077_1877 | 263 |
| 403 | 3300047322 | Ga0495680_0319320 | Ga0495680_0319320_57_848 | 263 |
| 404 | 3300047444 | Ga0495675_0220553 | Ga0495675_0220553_156_947 | 263 |
| 405 | 3300047471 | Ga0495684_0017049 | Ga0495684_0017049_2636_3436 | 263 |
| 406 | 3300048088 | Ga0495602_0218847 | Ga0495602_0218847_578_1369 | 263 |
| 407 | 3300048903 | Ga0496100_0000818 | Ga0496100_0000818_9203_10003 | 263 |
| 408 | 3300048904 | Ga0496101_0001661 | Ga0496101_0001661_3502_4302 | 263 |
| 409 | 3300048905 | Ga0496102_0010055 | Ga0496102_0010055_794_1594 | 263 |
| 410 | 3300048905 | Ga0496102_0173353 | Ga0496102_0173353_702_1493 | 263 |
| 411 | 3300048907 | Ga0496104_0003527 | Ga0496104_0003527_1793_2593 | 263 |
| 412 | 3300048907 | Ga0496104_0030167 | Ga0496104_0030167_845_1636 | 263 |
| 413 | 3300048907 | Ga0496104_0116293 | Ga0496104_0116293_431_1222 | 263 |
| 414 | 3300048908 | Ga0496105_0056566 | Ga0496105_0056566_1392_2192 | 263 |
| 415 | 3300048909 | Ga0496106_0011246 | Ga0496106_0011246_1366_2166 | 263 |
| 416 | 3300048910 | Ga0496107_0225137 | Ga0496107_0225137_13_813 | 263 |
| 417 | 3300048911 | Ga0496108_0246200 | Ga0496108_0246200_172_972 | 263 |
| 418 | 3300048912 | Ga0496109_0229569 | Ga0496109_0229569_916_1707 | 263 |
| 419 | 3300048912 | Ga0496109_0343137 | Ga0496109_0343137_72_872 | 263 |
| 420 | 3300048913 | Ga0496110_0303874 | Ga0496110_0303874_71_862 | 263 |
| 421 | 3300048914 | Ga0496111_0057054 | Ga0496111_0057054_373_1164 | 263 |
| 422 | 3300048915 | Ga0496112_0010102 | Ga0496112_0010102_2486_3277 | 263 |
| 423 | 3300048917 | Ga0496114_0000958 | Ga0496114_0000958_16464_17264 | 263 |
| 424 | 3300048918 | Ga0496115_0065821 | Ga0496115_0065821_681_1481 | 263 |
| 425 | 3300049571 | Ga0501034_0009079 | Ga0501034_0009079_6486_7277 | 263 |
| 426 | 3300049592 | Ga0501076_0136981 | Ga0501076_0136981_55_846 | 263 |
| 427 | 3300049593 | Ga0501077_0359841 | Ga0501077_0359841_45_836 | 263 |
| 428 | 3300049743 | Ga0501081_0028362 | Ga0501081_0028362_381_1172 | 263 |
| 429 | 3300049823 | Ga0501044_0005862 | Ga0501044_0005862_6913_7704 | 263 |
| 430 | 3300049824 | Ga0501045_0358456 | Ga0501045_0358456_16_807 | 263 |
| 431 | 3300050507 | nmdc:mga05p37_17662_c1 | nmdc:mga05p37_17662_c1_7406_8197 | 263 |
| 432 | 3300050507 | nmdc:mga05p37_24585_c1 | nmdc:mga05p37_24585_c1_1895_2686 | 263 |
| 433 | 3300050509 | nmdc:mga0qj67_68163_c1 | nmdc:mga0qj67_68163_c1_130_921 | 263 |
| 434 | 3300050510 | nmdc:mga06r32_402227_c1 | nmdc:mga06r32_402227_c1_34_825 | 263 |
| 435 | 3300050512 | nmdc:mga0n895_23759_c1 | nmdc:mga0n895_23759_c1_863_1654 | 263 |
| 436 | 3300050513 | nmdc:mga0rr50_14702_c1 | nmdc:mga0rr50_14702_c1_853_1644 | 263 |
| 437 | 3300050514 | nmdc:mga08x19_41891_c1 | nmdc:mga08x19_41891_c1_1597_2388 | 263 |
| 438 | 3300050515 | nmdc:mga0a205_197897_c2 | nmdc:mga0a205_197897_c2_739_1530 | 263 |
| 439 | 3300053077 | Ga0495601_0009584 | Ga0495601_0009584_4219_5019 | 263 |
| 440 | 3300053077 | Ga0495601_0335179 | Ga0495601_0335179_46_837 | 263 |
| 441 | 3300053085 | Ga0495619_0002018 | Ga0495619_0002018_6896_7696 | 263 |
| 442 | 3300053085 | Ga0495619_0086299 | Ga0495619_0086299_661_1452 | 263 |
| 443 | 3300053085 | Ga0495619_0096362 | Ga0495619_0096362_567_1358 | 263 |
| 444 | 3300053085 | Ga0495619_0303285 | Ga0495619_0303285_210_1010 | 263 |
| 445 | 3300053104 | Ga0500556_0077228 | Ga0500556_0077228_303_1094 | 263 |
| 446 | 3300054114 | Ga0501084_0249946 | Ga0501084_0249946_212_1003 | 263 |
| 447 | 3300059424 | Ga0590075_049921 | Ga0590075_049921_82_885 | 263 |
| 448 | 3300059426 | Ga0590077_021269 | Ga0590077_021269_313_1116 | 263 |
| 449 | 3300060353 | Ga0501082_0062927 | Ga0501082_0062927_1854_2645 | 263 |
| 450 | 3300060353 | Ga0501082_0104346 | Ga0501082_0104346_1473_2264 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u82-assembly1.cif.gz_A | structure of s. aureus undecaprenyl diphosphate synthase in complex with fspp and sulfate | 0.9683 | 23 | 253 |
| 5hc8-assembly1.cif.gz_A | crystal structure of lavandulyl diphosphate synthase from lavandula x intermedia in complex with dimethylallyl diphosphate | 0.9623 | 28 | 251 |
| 1x07-assembly1.cif.gz_A | crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp | 0.9578 | 29 | 247 |
| 1x09-assembly1.cif.gz_A | crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate | 0.9541 | 27 | 246 |
| 4u82-assembly1.cif.gz_A | structure of s. aureus undecaprenyl diphosphate synthase in complex with fspp and sulfate | 0.9443 | 23 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hc7A00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9625 | 28 | 246 | 3.40.1180.10 |
| af_K7KA63_68_310_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.954 | 22 | 253 | 3.40.1180.10 |
| 2dtnB00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9426 | 30 | 251 | 3.40.1180.10 |
| af_Q58767_31_280_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9399 | 16 | 251 | 3.40.1180.10 |
| 2vg2A01 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.938 | 23 | 246 | 3.40.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B2ZBN4-F1-model_v4 | UDP pyrophosphate synthase | 0.9904 | 27 | 144 |
GO:0016094
GO:0045547 |
| AF-X1FLT0-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.9877 | 27 | 173 |
GO:0000287
GO:0005829 GO:0008834 GO:0016094 GO:0045547 |
| AF-A0A202DGC7-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.9847 | 27 | 157 |
GO:0016094
GO:0045547 |
| AF-A0A6B1DH71-F1-model_v4 | Isoprenyl transferase (EC 2.5.1.-) | 0.9846 | 1 | 253 |
GO:0000287
GO:0005829 GO:0008834 GO:0016094 GO:0045547 |
| AF-A0A258EU35-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.975 | 21 | 235 |
GO:0016094
GO:0045547 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar