F446548

General Info

Members Datasets Scaffolds Average Seq Length
450 237 449 261

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100300494|Ga0070698_1003004942
Length 284
Sequence VRAGLRLRRTITLSTIGCSVSKSLDRLLAWLPAESADRELARRVNPERLPRHVAIIMDGNGRWAGKRHLPRVEGHRAGIEAVRAVVETSARLGLDVLTLYAFSVENWKRPAAEVSTLMLLLKRYLRSELSTLLENDIRFNVIGRAEELAPDILQELRAAEQKTAKSSGMLFNIALNYGGRSEIIDAARRAIEAGIPADALDERRFGELLYTAGQPDPDLLIRTSGEMRVSNFLLWQIAYAEIWVTDTLWPDFRCRDLLEAILAYQKRDRRYGGIASAHVAAGAK

Samples

Sample ID Description Type Environment
1 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
152 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 4.44
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10039260 3300005290 Bacteria 1148
2 Ga0065712_10239246 3300005290 Bacteria 989
3 Ga0065715_10409685 3300005293 Bacteria 871
4 Ga0070670_100059476 3300005331 Bacteria 3280
5 Ga0068869_100278026 3300005334 Bacteria 1346
6 Ga0070666_10072574 3300005335 Bacteria 2343
7 Ga0070666_10087235 3300005335 Bacteria 2139
8 Ga0070682_100245426 3300005337 Bacteria 1288
9 Ga0070692_10043816 3300005345 Bacteria 2303
10 Ga0070668_100006636 3300005347 Bacteria 8578
11 Ga0070668_100070147 3300005347 Bacteria 2728
12 Ga0070669_100043411 3300005353 Bacteria 3274
13 Ga0070669_100105149 3300005353 Bacteria 2135
14 Ga0070675_100524120 3300005354 Bacteria 1069
15 Ga0070675_100542900 3300005354 Bacteria 1051
16 Ga0070671_100090311 3300005355 Bacteria 2564
17 Ga0070674_100033558 3300005356 Bacteria 3418
18 Ga0070674_100085165 3300005356 Bacteria 2268
19 Ga0070673_100026814 3300005364 Bacteria 4261
20 Ga0070659_100098075 3300005366 Bacteria 2356
21 Ga0070659_100129725 3300005366 Bacteria 2047
22 Ga0070667_100101921 3300005367 Bacteria 2480
23 Ga0070709_10368880 3300005434 Bacteria 1065
24 Ga0070713_100004300 3300005436 Bacteria 9545
25 Ga0070711_100069949 3300005439 Bacteria 2470
26 Ga0070705_100055922 3300005440 Bacteria 2321
27 Ga0070705_100348680 3300005440 Bacteria 1079
28 Ga0070662_100157840 3300005457 Bacteria 1772
29 Ga0070662_100195523 3300005457 Bacteria 1602
30 Ga0070662_100285510 3300005457 Bacteria 1337
31 Ga0070681_10003693 3300005458 Bacteria 14358
32 Ga0068867_100074656 3300005459 Bacteria 2542
33 Ga0070707_100125144 3300005468 Bacteria 2497
34 Ga0070698_100133526 3300005471 Bacteria 2437
35 Ga0070698_100159625 3300005471 Bacteria 2199
36 Ga0070698_100300494 3300005471 Bacteria 1536
37 Ga0070698_100410225 3300005471 Bacteria 1288
38 Ga0070679_100080150 3300005530 Bacteria 3254
39 Ga0070672_100160747 3300005543 Bacteria 1863
40 Ga0070672_100317365 3300005543 Bacteria 1324
41 Ga0070695_100191896 3300005545 Bacteria 1454
42 Ga0070696_100019487 3300005546 Bacteria 4593
43 Ga0070665_100001879 3300005548 Bacteria 23848
44 Ga0070665_100233467 3300005548 Bacteria 1840
45 Ga0070704_100019719 3300005549 Bacteria 4338
46 Ga0070704_100071006 3300005549 Bacteria 2528
47 Ga0070664_100144108 3300005564 Bacteria 2100
48 Ga0070664_100444122 3300005564 Bacteria 1190
49 Ga0068857_100315828 3300005577 Bacteria 1442
50 Ga0070702_100010325 3300005615 Bacteria 4593
51 Ga0068852_100054353 3300005616 Bacteria 3451
52 Ga0068859_100540531 3300005617 Bacteria 1260
53 Ga0068859_100566826 3300005617 Bacteria 1230
54 Ga0068866_10041048 3300005718 Bacteria 2294
55 Ga0068861_100012368 3300005719 Bacteria 5951
56 Ga0068851_10184555 3300005834 Bacteria 1157
57 Ga0068863_100025860 3300005841 Bacteria 5600
58 Ga0068863_100325393 3300005841 Bacteria 1494
59 Ga0068858_100012178 3300005842 Bacteria 8109
60 Ga0068860_100241626 3300005843 Bacteria 1757
61 Ga0068860_100415101 3300005843 Bacteria 1333
62 Ga0068862_100012037 3300005844 Bacteria 7149
63 Ga0068862_100538314 3300005844 Bacteria 1114
64 Ga0068862_100548568 3300005844 Bacteria 1103
65 Ga0068862_100659791 3300005844 Bacteria 1010
66 Ga0081455_10187638 3300005937 Bacteria 1560
67 Ga0075368_10019907 3300006042 Bacteria 2537
68 Ga0075367_10007865 3300006178 Bacteria 5487
69 Ga0075366_10240951 3300006195 Bacteria 1102
70 Ga0097621_100008625 3300006237 Bacteria 7353
71 Ga0097621_100057255 3300006237 Bacteria 3187
72 Ga0068871_100024332 3300006358 Bacteria 4695
73 Ga0068871_100178172 3300006358 Bacteria 1826
74 Ga0075428_100000995 3300006844 Bacteria 29993
75 Ga0075428_100025242 3300006844 Bacteria 6577
76 Ga0075428_100063291 3300006844 Bacteria 4050
77 Ga0075428_100068382 3300006844 Bacteria 3885
78 Ga0075428_100816357 3300006844 Bacteria 991
79 Ga0075430_100003143 3300006846 Bacteria 13813
80 Ga0075430_100003168 3300006846 Bacteria 13771
81 Ga0075430_100179339 3300006846 Bacteria 1762
82 Ga0075430_100185525 3300006846 Bacteria 1730
83 Ga0075430_100297844 3300006846 Bacteria 1334
84 Ga0075431_100009084 3300006847 Bacteria 9964
85 Ga0075431_100011342 3300006847 Bacteria 8979
86 Ga0075431_100014869 3300006847 Bacteria 7880
87 Ga0075431_100015000 3300006847 Bacteria 7844
88 Ga0075431_100021584 3300006847 Bacteria 6586
89 Ga0075431_100035152 3300006847 Bacteria 5160
90 Ga0075431_100096381 3300006847 Bacteria 3054
91 Ga0075431_100171089 3300006847 Bacteria 2232
92 Ga0075431_100182583 3300006847 Bacteria 2153
93 Ga0075431_100237155 3300006847 Bacteria 1857
94 Ga0075431_100400283 3300006847 Bacteria 1374
95 Ga0075433_10008838 3300006852 Bacteria 8038
96 Ga0075433_10021567 3300006852 Bacteria 5403
97 Ga0075433_10053906 3300006852 Bacteria 3507
98 Ga0075433_10077673 3300006852 Bacteria 2924
99 Ga0075433_10126984 3300006852 Bacteria 2265
100 Ga0075433_10176061 3300006852 Bacteria 1904
101 Ga0075434_100086563 3300006871 Bacteria 3133
102 Ga0075429_100001657 3300006880 Bacteria 18416
103 Ga0075429_100046262 3300006880 Bacteria 3787
104 Ga0068865_100136772 3300006881 Bacteria 1842
105 Ga0068865_100283461 3300006881 Bacteria 1320
106 Ga0075436_100050954 3300006914 Bacteria 2857
107 Ga0097620_100540538 3300006931 Bacteria 1260
108 Ga0097620_100566826 3300006931 Bacteria 1230
109 Ga0075435_100004980 3300007076 Bacteria 9220
110 Ga0075435_100019332 3300007076 Bacteria 5201
111 Ga0105240_10017120 3300009093 Bacteria 9785
112 Ga0111539_10000201 3300009094 Bacteria 70327
113 Ga0111539_10098969 3300009094 Bacteria 3425
114 Ga0111539_10156632 3300009094 Bacteria 2665
115 Ga0111539_10211645 3300009094 Bacteria 2259
116 Ga0111539_10428899 3300009094 Bacteria 1540
117 Ga0105245_10044220 3300009098 Bacteria 3974
118 Ga0105247_10002386 3300009101 Bacteria 12782
119 Ga0105247_10196378 3300009101 Bacteria 1353
120 Ga0114129_10000751 3300009147 Bacteria 41232
121 Ga0114129_10001134 3300009147 Bacteria 35181
122 Ga0114129_10001999 3300009147 Bacteria 27921
123 Ga0114129_10003812 3300009147 Bacteria 21254
124 Ga0114129_10005506 3300009147 Bacteria 17904
125 Ga0114129_10008750 3300009147 Bacteria 14437
126 Ga0114129_10035177 3300009147 Bacteria 7077
127 Ga0114129_10042024 3300009147 Bacteria 6437
128 Ga0114129_10066845 3300009147 Bacteria 5013
129 Ga0114129_10155160 3300009147 Bacteria 3131
130 Ga0114129_10347217 3300009147 Bacteria 1967
131 Ga0105243_10375938 3300009148 Bacteria 1312
132 Ga0105241_10174158 3300009174 Bacteria 1779
133 Ga0105242_10067202 3300009176 Bacteria 2963
134 Ga0105242_10128458 3300009176 Bacteria 2184
135 Ga0105242_10714701 3300009176 Bacteria 982
136 Ga0105248_10004005 3300009177 Bacteria 16285
137 Ga0105248_10053353 3300009177 Bacteria 4537
138 Ga0105248_10066354 3300009177 Bacteria 4052
139 Ga0105248_10139208 3300009177 Bacteria 2737
140 Ga0105248_10172496 3300009177 Bacteria 2438
141 Ga0105248_10764480 3300009177 Bacteria 1090
142 Ga0105237_10465478 3300009545 Bacteria 1270
143 Ga0105239_10089908 3300010375 Bacteria 3387
144 Ga0157378_10630835 3300013297 Bacteria 1086
145 Ga0157378_10849033 3300013297 Bacteria 941
146 Ga0157375_10073949 3300013308 Bacteria 3428
147 Ga0157375_10221390 3300013308 Bacteria 2051
148 Ga0157375_10633748 3300013308 Bacteria 1226
149 Ga0163163_10036126 3300014325 Bacteria 4797
150 Ga0157380_10668318 3300014326 Bacteria 1039
151 Ga0157379_10079608 3300014968 Bacteria 2934
152 Ga0157379_10131682 3300014968 Bacteria 2251
153 Ga0157376_10004135 3300014969 Bacteria 10058
154 Ga0157376_10156950 3300014969 Bacteria 2058
155 Ga0163161_10315553 3300017792 Bacteria 1234
156 Ga0207642_10018052 3300025899 Bacteria 2699
157 Ga0207642_10090128 3300025899 Bacteria 1512
158 Ga0207680_10150851 3300025903 Bacteria 1549
159 Ga0207699_10046271 3300025906 Bacteria 2544
160 Ga0207645_10002511 3300025907 Bacteria 14376
161 Ga0207645_10057285 3300025907 Bacteria 2488
162 Ga0207654_10109300 3300025911 Bacteria 1717
163 Ga0207707_10083559 3300025912 Bacteria 2788
164 Ga0207660_10082272 3300025917 Bacteria 2368
165 Ga0207662_10010044 3300025918 Bacteria 5219
166 Ga0207657_10119585 3300025919 Bacteria 2168
167 Ga0207652_10463580 3300025921 Bacteria 1142
168 Ga0207646_10425005 3300025922 Bacteria 1199
169 Ga0207681_10151045 3300025923 Bacteria 1741
170 Ga0207650_10094438 3300025925 Bacteria 2291
171 Ga0207659_10091502 3300025926 Bacteria 2272
172 Ga0207700_10133593 3300025928 Bacteria 2029
173 Ga0207644_10081279 3300025931 Bacteria 2394
174 Ga0207690_10038420 3300025932 Bacteria 3116
175 Ga0207690_10297155 3300025932 Bacteria 1262
176 Ga0207706_10130589 3300025933 Bacteria 2210
177 Ga0207706_10347139 3300025933 Bacteria 1290
178 Ga0207706_10573120 3300025933 Bacteria 971
179 Ga0207686_10336129 3300025934 Bacteria 1133
180 Ga0207686_10548616 3300025934 Bacteria 903
181 Ga0207669_10095277 3300025937 Bacteria 1951
182 Ga0207704_10102171 3300025938 Bacteria 1914
183 Ga0207691_10061874 3300025940 Bacteria 3399
184 Ga0207711_10023199 3300025941 Bacteria 5193
185 Ga0207711_10318220 3300025941 Bacteria 1437
186 Ga0207689_10014199 3300025942 Bacteria 6776
187 Ga0207689_10070467 3300025942 Bacteria 2872
188 Ga0207679_10750783 3300025945 Bacteria 887
189 Ga0207667_10876940 3300025949 Bacteria 890
190 Ga0207651_10006484 3300025960 Bacteria 6134
191 Ga0207651_10013471 3300025960 Bacteria 4681
192 Ga0207651_10239837 3300025960 Bacteria 1477
193 Ga0207677_10605277 3300026023 Bacteria 962
194 Ga0207703_10116728 3300026035 Bacteria 2285
195 Ga0207703_10242892 3300026035 Bacteria 1620
196 Ga0207703_10891737 3300026035 Bacteria 851
197 Ga0207703_10935250 3300026035 Bacteria 831
198 Ga0207708_10018403 3300026075 Bacteria 5260
199 Ga0207708_10107833 3300026075 Bacteria 2160
200 Ga0207708_10175554 3300026075 Bacteria 1699
201 Ga0207641_10251413 3300026088 Bacteria 1651
202 Ga0207641_10416857 3300026088 Bacteria 1292
203 Ga0207641_10533023 3300026088 Bacteria 1143
204 Ga0207648_10093742 3300026089 Bacteria 2626
205 Ga0207648_10115526 3300026089 Bacteria 2358
206 Ga0207648_10708425 3300026089 Bacteria 933
207 Ga0207676_10016334 3300026095 Bacteria 5375
208 Ga0207675_100003564 3300026118 Bacteria 15160
209 Ga0207675_100064733 3300026118 Bacteria 3417
210 Ga0207683_10195712 3300026121 Bacteria 1837
211 Ga0207683_10513953 3300026121 Bacteria 1107
212 Ga0209813_10014211 3300027866 Bacteria 2141
213 Ga0207428_10000445 3300027907 Bacteria 50527
214 Ga0207428_10002413 3300027907 Bacteria 18659
215 Ga0207428_10179209 3300027907 Bacteria 1602
216 Ga0207428_10347185 3300027907 Bacteria 1092
217 Ga0268266_10203955 3300028379 Bacteria 1811
218 Ga0268266_10298376 3300028379 Bacteria 1502
219 Ga0268265_10096738 3300028380 Bacteria 2373
220 Ga0268265_10265068 3300028380 Bacteria 1529
221 Ga0268265_10555111 3300028380 Bacteria 1091
222 Ga0268264_10150083 3300028381 Bacteria 2089
223 Ga0268264_10708771 3300028381 Bacteria 1000
224 Ga0307513_10547502 3300031456 Bacteria 870
225 Ga0307408_100005759 3300031548 Bacteria 8254
226 Ga0307408_100095422 3300031548 Bacteria 2254
227 Ga0307408_100189122 3300031548 Bacteria 1657
228 Ga0316578_10066203 3300031728 Bacteria 2134
229 Ga0307410_10084721 3300031852 Bacteria 2235
230 Ga0307410_10232206 3300031852 Bacteria 1425
231 Ga0307410_10479431 3300031852 Bacteria 1020
232 Ga0307406_10075346 3300031901 Bacteria 2226
233 Ga0307406_10106325 3300031901 Bacteria 1922
234 Ga0307406_10668662 3300031901 Bacteria 864
235 Ga0307412_10552741 3300031911 Bacteria 967
236 Ga0307416_100040297 3300032002 Bacteria 3627
237 Ga0307416_100076446 3300032002 Bacteria 2806
238 Ga0307416_100138570 3300032002 Bacteria 2206
239 Ga0307416_100151899 3300032002 Bacteria 2125
240 Ga0307416_100182350 3300032002 Bacteria 1969
241 Ga0307411_10100466 3300032005 Bacteria 2044
242 Ga0307415_100048304 3300032126 Bacteria 2871
243 Ga0316580_10028413 3300032139 Bacteria 1729
244 Ga0373934_0037848 3300035086 Bacteria 1899
245 Ga0373934_0074023 3300035086 Bacteria 1364
246 Ga0373951_0035804 3300035091 Bacteria 1183
247 Ga0373945_0022207 3300035116 Bacteria 2184
248 Ga0373945_0038785 3300035116 Bacteria 1715
249 Ga0373953_0030439 3300035117 Bacteria 2093
250 Ga0373954_0091942 3300035118 Bacteria 1458
251 Ga0373943_0031772 3300035170 Bacteria 2506
252 Ga0373943_0168899 3300035170 Bacteria 1196
253 Ga0373943_0270547 3300035170 Bacteria 958
254 Ga0373946_0010185 3300035171 Bacteria 3476
255 Ga0373946_0056744 3300035171 Bacteria 1655
256 Ga0373946_0214062 3300035171 Bacteria 928
257 Ga0373955_0037650 3300035172 Bacteria 2573
258 Ga0373955_0092149 3300035172 Bacteria 1728
259 Ga0373955_0230022 3300035172 Bacteria 1109
260 Ga0316574_0183873 3300035398 Bacteria 1344
261 Ga0373924_0002742 3300035410 Bacteria 5949
262 Ga0373931_0169563 3300035691 Bacteria 1285
263 Ga0373927_0080617 3300035695 Bacteria 2109
264 Ga0373947_0091904 3300035725 Bacteria 1894
265 Ga0373937_0000513 3300036401 Bacteria 35017
266 Ga0373937_0057140 3300036401 Bacteria 3584
267 Ga0373937_0243982 3300036401 Bacteria 1693
268 Ga0316584_0081934 3300036712 Bacteria 2417
269 Ga0373925_0003323 3300037068 Bacteria 12500
270 Ga0373925_0003479 3300037068 Bacteria 12183
271 Ga0373925_0543968 3300037068 Bacteria 955
272 Ga0436365_0589265 3300039437 Bacteria 3362
273 Ga0439461_0036812 3300041410 Bacteria 1043
274 Ga0439461_0082316 3300041410 Bacteria 761
275 Ga0439433_0033950 3300041999 Bacteria 1173
276 Ga0439441_020618 3300042001 Bacteria 1209
277 Ga0439445_0031255 3300042004 Bacteria 1383
278 Ga0439449_0022696 3300042007 Bacteria 2350
279 Ga0439457_014388 3300042014 Bacteria 1771
280 Ga0450888_012300 3300042126 Bacteria 1013
281 Ga0450895_004607 3300042132 Bacteria 1091
282 Ga0439446_0130586 3300042156 Bacteria 814
283 Ga0439434_0001238 3300042435 Bacteria 7351
284 Ga0439435_0003326 3300042436 Bacteria 3331
285 Ga0439464_0006098 3300042439 Bacteria 3134
286 Ga0439464_0025314 3300042439 Bacteria 1643
287 Ga0439460_0016107 3300042461 Bacteria 1988
288 Ga0439460_0058392 3300042461 Bacteria 1172
289 Ga0439460_0083519 3300042461 Bacteria 1005
290 Ga0451577_0012810 3300042876 Bacteria 7870
291 Ga0451577_0664002 3300042876 Bacteria 945
292 Ga0439440_0016925 3300042993 Bacteria 1601
293 Ga0453684_0124671 3300044712 Bacteria 3103
294 Ga0453684_0863226 3300044712 Bacteria 972
295 Ga0495592_0306915 3300046454 Bacteria 1030
296 Ga0495629_0233023 3300046459 Bacteria 1269
297 Ga0495582_0080216 3300046473 Bacteria 1812
298 Ga0495608_0008013 3300046511 Bacteria 7428
299 Ga0495628_0002852 3300046516 Bacteria 15494
300 Ga0495628_0364169 3300046516 Bacteria 1061
301 Ga0495630_0009226 3300046517 Bacteria 7092
302 Ga0495630_0024883 3300046517 Bacteria 4426
303 Ga0495652_0470402 3300046529 Bacteria 876
304 Ga0495587_0047900 3300046536 Bacteria 2533
305 Ga0495634_0208798 3300046642 Bacteria 1210
306 Ga0495599_0136612 3300046678 Bacteria 1522
307 Ga0495646_0290419 3300046680 Bacteria 867
308 Ga0495647_0106873 3300046681 Bacteria 1164
309 Ga0495658_0192801 3300046683 Bacteria 1268
310 Ga0495613_0003890 3300046689 Bacteria 11176
311 Ga0495613_0443950 3300046689 Bacteria 880
312 Ga0495604_0031490 3300047317 Bacteria 4206
313 Ga0495604_0130531 3300047317 Bacteria 1807
314 Ga0495604_0255119 3300047317 Bacteria 1194
315 Ga0495674_0008199 3300047319 Bacteria 9969
316 Ga0495680_0319320 3300047322 Bacteria 1087
317 Ga0495675_0220553 3300047444 Bacteria 1148
318 Ga0495684_0017049 3300047471 Bacteria 5594
319 Ga0495602_0218847 3300048088 Bacteria 1439
320 Ga0496100_0000818 3300048903 Bacteria 14930
321 Ga0496101_0001661 3300048904 Bacteria 13342
322 Ga0496102_0010055 3300048905 Bacteria 8138
323 Ga0496102_0173353 3300048905 Bacteria 2031
324 Ga0496104_0003527 3300048907 Bacteria 13490
325 Ga0496104_0030167 3300048907 Bacteria 5037
326 Ga0496104_0116293 3300048907 Bacteria 2566
327 Ga0496105_0056566 3300048908 Bacteria 3238
328 Ga0496106_0011246 3300048909 Bacteria 6623
329 Ga0496107_0225137 3300048910 Bacteria 1395
330 Ga0496108_0246200 3300048911 Bacteria 1555
331 Ga0496108_0727049 3300048911 Bacteria 860
332 Ga0496109_0229569 3300048912 Bacteria 1746
333 Ga0496109_0343137 3300048912 Bacteria 1410
334 Ga0496110_0303874 3300048913 Bacteria 1453
335 Ga0496111_0057054 3300048914 Bacteria 2827
336 Ga0496112_0010102 3300048915 Bacteria 8546
337 Ga0496113_0265775 3300048916 Bacteria 1371
338 Ga0496114_0000958 3300048917 Bacteria 21594
339 Ga0496115_0065821 3300048918 Bacteria 2928
340 Ga0496117_0000079 3300048920 Bacteria 226960
341 Ga0501031_0088367 3300049568 Bacteria 2021
342 Ga0501034_0009079 3300049571 Bacteria 10442
343 Ga0501038_0287785 3300049574 Bacteria 1292
344 Ga0501038_0684501 3300049574 Bacteria 770
345 Ga0501039_0046708 3300049575 Bacteria 3346
346 Ga0501039_0078906 3300049575 Bacteria 2561
347 Ga0501039_0437031 3300049575 Bacteria 1028
348 Ga0501040_0031302 3300049576 Bacteria 3595
349 Ga0501040_0070246 3300049576 Bacteria 2416
350 Ga0501042_0059731 3300049578 Bacteria 2723
351 Ga0501042_0235950 3300049578 Bacteria 1320
352 Ga0501042_0316276 3300049578 Bacteria 1128
353 Ga0501046_0237003 3300049580 Bacteria 1347
354 Ga0501048_0213897 3300049582 Bacteria 1367
355 Ga0501048_0309266 3300049582 Bacteria 1125
356 Ga0501068_0276809 3300049584 Bacteria 1072
357 Ga0501071_0228613 3300049587 Bacteria 1401
358 Ga0501072_0066874 3300049588 Bacteria 2835
359 Ga0501072_0111471 3300049588 Bacteria 2178
360 Ga0501073_0018855 3300049589 Bacteria 4986
361 Ga0501073_0323958 3300049589 Bacteria 1064
362 Ga0501075_0059639 3300049591 Bacteria 2874
363 Ga0501076_0012889 3300049592 Bacteria 6257
364 Ga0501076_0022893 3300049592 Bacteria 4807
365 Ga0501076_0038905 3300049592 Bacteria 3733
366 Ga0501076_0060409 3300049592 Bacteria 3016
367 Ga0501076_0136981 3300049592 Bacteria 1988
368 Ga0501076_0343459 3300049592 Bacteria 1225
369 Ga0501077_0359841 3300049593 Bacteria 929
370 Ga0501077_0375248 3300049593 Bacteria 908
371 Ga0501077_0380277 3300049593 Bacteria 902
372 Ga0501079_0106001 3300049741 Bacteria 2181
373 Ga0501079_0182038 3300049741 Bacteria 1640
374 Ga0501080_0370117 3300049742 Bacteria 1292
375 Ga0501081_0028362 3300049743 Bacteria 3778
376 Ga0501081_0064578 3300049743 Bacteria 2543
377 Ga0501081_0137400 3300049743 Bacteria 1750
378 Ga0501275_007175 3300049772 Bacteria 1115
379 Ga0501044_0005862 3300049823 Bacteria 13610
380 Ga0501045_0264565 3300049824 Bacteria 1280
381 Ga0501045_0358456 3300049824 Bacteria 1085
382 nmdc:mga0k408_399725_c1 3300050493 Bacteria 818
383 nmdc:mga06z11_99953_c1 3300050494 Bacteria 1590
384 nmdc:mga05p37_1089_c2 3300050507 Bacteria 22817
385 nmdc:mga05p37_13248_c1 3300050507 Bacteria 9872
386 nmdc:mga05p37_17662_c1 3300050507 Bacteria 8608
387 nmdc:mga05p37_24585_c1 3300050507 Bacteria 7323
388 nmdc:mga05p37_3190_c1 3300050507 Bacteria 19076
389 nmdc:mga05p37_406677_c1 3300050507 Bacteria 1588
390 nmdc:mga05p37_48699_c1 3300050507 Bacteria 5212
391 nmdc:mga05p37_638_c1 3300050507 Bacteria 38795
392 nmdc:mga05p37_7289_c1 3300050507 Bacteria 13048
393 nmdc:mga09592_201795_c1 3300050508 Bacteria 1722
394 nmdc:mga09592_2104_c1 3300050508 Bacteria 16079
395 nmdc:mga09592_574513_c1 3300050508 Bacteria 967
396 nmdc:mga09592_98413_c1 3300050508 Bacteria 2504
397 nmdc:mga0qj67_1418_c1 3300050509 Bacteria 16781
398 nmdc:mga0qj67_16753_c1 3300050509 Bacteria 1778
399 nmdc:mga0qj67_191129_c1 3300050509 Bacteria 1664
400 nmdc:mga0qj67_26156_c1 3300050509 Bacteria 4516
401 nmdc:mga0qj67_462470_c1 3300050509 Bacteria 1021
402 nmdc:mga0qj67_68163_c1 3300050509 Bacteria 2835
403 nmdc:mga0qj67_84767_c1 3300050509 Bacteria 2541
404 nmdc:mga06r32_116222_c1 3300050510 Bacteria 2636
405 nmdc:mga06r32_171214_c1 3300050510 Bacteria 2155
406 nmdc:mga06r32_18246_c1 3300050510 Bacteria 6422
407 nmdc:mga06r32_256112_c1 3300050510 Bacteria 1738
408 nmdc:mga06r32_330202_c1 3300050510 Bacteria 1510
409 nmdc:mga06r32_402227_c1 3300050510 Bacteria 1351
410 nmdc:mga06r32_420285_c1 3300050510 Bacteria 1318
411 nmdc:mga06r32_531038_c1 3300050510 Bacteria 1152
412 nmdc:mga06r32_635494_c1 3300050510 Bacteria 1036
413 nmdc:mga06r32_640784_c1 3300050510 Bacteria 1031
414 nmdc:mga06r32_7742_c1 3300050510 Bacteria 9661
415 nmdc:mga08y16_11526_c1 3300050511 Bacteria 9290
416 nmdc:mga08y16_134943_c1 3300050511 Bacteria 2565
417 nmdc:mga08y16_22957_c1 3300050511 Bacteria 6586
418 nmdc:mga08y16_240936_c1 3300050511 Bacteria 1870
419 nmdc:mga08y16_422576_c1 3300050511 Bacteria 1362
420 nmdc:mga08y16_4743_c1 3300050511 Bacteria 14177
421 nmdc:mga0n895_23759_c1 3300050512 Bacteria 5767
422 nmdc:mga0n895_948488_c1 3300050512 Bacteria 844
423 nmdc:mga0rr50_14702_c1 3300050513 Bacteria 5145
424 nmdc:mga0rr50_172872_c1 3300050513 Bacteria 1762
425 nmdc:mga08x19_198661_c1 3300050514 Bacteria 1374
426 nmdc:mga08x19_41891_c1 3300050514 Bacteria 2917
427 nmdc:mga0a205_189664_c1 3300050515 Bacteria 1948
428 nmdc:mga0a205_197897_c2 3300050515 Bacteria 1604
429 nmdc:mga0a205_30478_c1 3300050515 Bacteria 5165
430 nmdc:mga0a205_42661_c1 3300050515 Bacteria 4371
431 nmdc:mga0a205_7790_c1 3300050515 Bacteria 9724
432 Ga0495601_0009584 3300053077 Bacteria 5735
433 Ga0495601_0335179 3300053077 Bacteria 984
434 Ga0495595_0138976 3300053084 Bacteria 1191
435 Ga0495619_0002018 3300053085 Bacteria 13495
436 Ga0495619_0051374 3300053085 Bacteria 2724
437 Ga0495619_0086299 3300053085 Bacteria 2121
438 Ga0495619_0096362 3300053085 Bacteria 2008
439 Ga0495619_0303285 3300053085 Bacteria 1106
440 Ga0500556_0077228 3300053104 Bacteria 1253
441 Ga0501084_0035846 3300054114 Bacteria 4147
442 Ga0501084_0062718 3300054114 Bacteria 3112
443 Ga0501084_0168936 3300054114 Bacteria 1846
444 Ga0501084_0249946 3300054114 Bacteria 1497
445 Ga0590075_049921 3300059424 Bacteria 1073
446 Ga0590077_021269 3300059426 Bacteria 1380
447 Ga0501082_0062927 3300060353 Bacteria 3195
448 Ga0501082_0104346 3300060353 Bacteria 2452
449 Ga0530510_0142745 3300061734 Bacteria 1765

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035118 Ga0373954_0091942 Ga0373954_0091942_18_698 222
2 3300026035 Ga0207703_10891737 Ga0207703_108917371 228
3 3300026075 Ga0207708_10107833 Ga0207708_101078332 228
4 3300046689 Ga0495613_0443950 Ga0495613_0443950_21_716 228
5 3300050514 nmdc:mga08x19_198661_c1 nmdc:mga08x19_198661_c1_678_1364 228
6 3300041410 Ga0439461_0082316 Ga0439461_0082316_53_745 230
7 3300049574 Ga0501038_0684501 Ga0501038_0684501_17_709 230
8 3300044712 Ga0453684_0863226 Ga0453684_0863226_11_709 232
9 3300048911 Ga0496108_0727049 Ga0496108_0727049_10_708 232
10 3300049592 Ga0501076_0012889 Ga0501076_0012889_121_912 233
11 3300017792 Ga0163161_10315553 Ga0163161_103155532 235
12 3300048920 Ga0496117_0000079 Ga0496117_0000079_13615_14349 236
13 3300049772 Ga0501275_007175 Ga0501275_007175_87_797 236
14 iso_pu_bacteria 2939615513 2939617208 236
15 3300005440 Ga0070705_100348680 Ga0070705_1003486802 239
16 3300005468 Ga0070707_100125144 Ga0070707_1001251442 239
17 3300005471 Ga0070698_100410225 Ga0070698_1004102252 239
18 3300006844 Ga0075428_100816357 Ga0075428_1008163571 239
19 3300006852 Ga0075433_10126984 Ga0075433_101269842 239
20 3300039437 Ga0436365_0589265 Ga0436365_0589265_1073_1804 239
21 3300046516 Ga0495628_0364169 Ga0495628_0364169_255_986 239
22 3300046517 Ga0495630_0024883 Ga0495630_0024883_2219_2950 239
23 3300050515 nmdc:mga0a205_42661_c1 nmdc:mga0a205_42661_c1_2262_2993 239
24 3300035091 Ga0373951_0035804 Ga0373951_0035804_376_1125 245
25 3300035116 Ga0373945_0038785 Ga0373945_0038785_613_1359 248
26 3300005937 Ga0081455_10187638 Ga0081455_101876382 250
27 3300050511 nmdc:mga08y16_22957_c1 nmdc:mga08y16_22957_c1_414_1178 251
28 3300005471 Ga0070698_100159625 Ga0070698_1001596252 255
29 3300006844 Ga0075428_100068382 Ga0075428_1000683824 255
30 3300006847 Ga0075431_100009084 Ga0075431_1000090848 255
31 3300006847 Ga0075431_100400283 Ga0075431_1004002832 255
32 3300006852 Ga0075433_10176061 Ga0075433_101760612 255
33 3300009094 Ga0111539_10098969 Ga0111539_100989694 255
34 3300009094 Ga0111539_10428899 Ga0111539_104288992 255
35 3300009147 Ga0114129_10347217 Ga0114129_103472172 255
36 3300013308 Ga0157375_10221390 Ga0157375_102213902 255
37 3300027907 Ga0207428_10179209 Ga0207428_101792092 255
38 3300027907 Ga0207428_10347185 Ga0207428_103471852 255
39 3300042132 Ga0450895_004607 Ga0450895_004607_52_822 255
40 3300050510 nmdc:mga06r32_531038_c1 nmdc:mga06r32_531038_c1_320_1120 255
41 3300050511 nmdc:mga08y16_134943_c1 nmdc:mga08y16_134943_c1_111_911 255
42 3300050511 nmdc:mga08y16_240936_c1 nmdc:mga08y16_240936_c1_673_1473 255
43 3300050515 nmdc:mga0a205_189664_c1 nmdc:mga0a205_189664_c1_113_913 255
44 3300031728 Ga0316578_10066203 Ga0316578_100662032 256
45 3300032139 Ga0316580_10028413 Ga0316580_100284132 256
46 3300035398 Ga0316574_0183873 Ga0316574_0183873_327_1112 256
47 3300036712 Ga0316584_0081934 Ga0316584_0081934_580_1365 256
48 3300006847 Ga0075431_100014869 Ga0075431_1000148693 260
49 3300041410 Ga0439461_0036812 Ga0439461_0036812_78_860 260
50 3300042004 Ga0439445_0031255 Ga0439445_0031255_110_892 260
51 3300042007 Ga0439449_0022696 Ga0439449_0022696_926_1708 260
52 3300042156 Ga0439446_0130586 Ga0439446_0130586_11_793 260
53 3300042435 Ga0439434_0001238 Ga0439434_0001238_3519_4301 260
54 3300050510 nmdc:mga06r32_420285_c1 nmdc:mga06r32_420285_c1_344_1126 260
55 3300005331 Ga0070670_100059476 Ga0070670_1000594763 261
56 3300005335 Ga0070666_10072574 Ga0070666_100725742 261
57 3300005345 Ga0070692_10043816 Ga0070692_100438162 261
58 3300005353 Ga0070669_100043411 Ga0070669_1000434112 261
59 3300005355 Ga0070671_100090311 Ga0070671_1000903113 261
60 3300005364 Ga0070673_100026814 Ga0070673_1000268142 261
61 3300005366 Ga0070659_100129725 Ga0070659_1001297252 261
62 3300005367 Ga0070667_100101921 Ga0070667_1001019211 261
63 3300005434 Ga0070709_10368880 Ga0070709_103688802 261
64 3300005436 Ga0070713_100004300 Ga0070713_1000043007 261
65 3300005440 Ga0070705_100055922 Ga0070705_1000559222 261
66 3300005457 Ga0070662_100285510 Ga0070662_1002855102 261
67 3300005459 Ga0068867_100074656 Ga0068867_1000746563 261
68 3300005543 Ga0070672_100160747 Ga0070672_1001607471 261
69 3300005545 Ga0070695_100191896 Ga0070695_1001918962 261
70 3300005549 Ga0070704_100071006 Ga0070704_1000710062 261
71 3300005615 Ga0070702_100010325 Ga0070702_1000103253 261
72 3300005616 Ga0068852_100054353 Ga0068852_1000543533 261
73 3300005718 Ga0068866_10041048 Ga0068866_100410482 261
74 3300005844 Ga0068862_100659791 Ga0068862_1006597912 261
75 3300006042 Ga0075368_10019907 Ga0075368_100199073 261
76 3300006178 Ga0075367_10007865 Ga0075367_100078652 261
77 3300006195 Ga0075366_10240951 Ga0075366_102409512 261
78 3300006358 Ga0068871_100178172 Ga0068871_1001781722 261
79 3300006844 Ga0075428_100000995 Ga0075428_1000009955 261
80 3300006844 Ga0075428_100025242 Ga0075428_1000252424 261
81 3300006844 Ga0075428_100063291 Ga0075428_1000632913 261
82 3300006846 Ga0075430_100003143 Ga0075430_10000314313 261
83 3300006846 Ga0075430_100003168 Ga0075430_1000031687 261
84 3300006846 Ga0075430_100179339 Ga0075430_1001793392 261
85 3300006846 Ga0075430_100297844 Ga0075430_1002978442 261
86 3300006847 Ga0075431_100011342 Ga0075431_1000113426 261
87 3300006847 Ga0075431_100015000 Ga0075431_1000150004 261
88 3300006847 Ga0075431_100021584 Ga0075431_1000215844 261
89 3300006847 Ga0075431_100171089 Ga0075431_1001710892 261
90 3300006847 Ga0075431_100182583 Ga0075431_1001825831 261
91 3300006847 Ga0075431_100237155 Ga0075431_1002371552 261
92 3300006852 Ga0075433_10008838 Ga0075433_100088385 261
93 3300006852 Ga0075433_10053906 Ga0075433_100539062 261
94 3300006880 Ga0075429_100001657 Ga0075429_10000165710 261
95 3300006880 Ga0075429_100046262 Ga0075429_1000462622 261
96 3300006881 Ga0068865_100283461 Ga0068865_1002834612 261
97 3300007076 Ga0075435_100019332 Ga0075435_1000193325 261
98 3300009094 Ga0111539_10000201 Ga0111539_1000020122 261
99 3300009094 Ga0111539_10156632 Ga0111539_101566322 261
100 3300009147 Ga0114129_10000751 Ga0114129_100007517 261
101 3300009147 Ga0114129_10001134 Ga0114129_1000113412 261
102 3300009147 Ga0114129_10005506 Ga0114129_1000550613 261
103 3300009147 Ga0114129_10035177 Ga0114129_100351774 261
104 3300009147 Ga0114129_10042024 Ga0114129_100420246 261
105 3300009147 Ga0114129_10155160 Ga0114129_101551603 261
106 3300009174 Ga0105241_10174158 Ga0105241_101741582 261
107 3300009176 Ga0105242_10067202 Ga0105242_100672022 261
108 3300009177 Ga0105248_10066354 Ga0105248_100663542 261
109 3300010375 Ga0105239_10089908 Ga0105239_100899084 261
110 3300025899 Ga0207642_10018052 Ga0207642_100180522 261
111 3300025903 Ga0207680_10150851 Ga0207680_101508512 261
112 3300025906 Ga0207699_10046271 Ga0207699_100462712 261
113 3300025907 Ga0207645_10002511 Ga0207645_100025116 261
114 3300025911 Ga0207654_10109300 Ga0207654_101093002 261
115 3300025918 Ga0207662_10010044 Ga0207662_100100442 261
116 3300025925 Ga0207650_10094438 Ga0207650_100944382 261
117 3300025928 Ga0207700_10133593 Ga0207700_101335932 261
118 3300025931 Ga0207644_10081279 Ga0207644_100812792 261
119 3300025932 Ga0207690_10038420 Ga0207690_100384201 261
120 3300025933 Ga0207706_10573120 Ga0207706_105731202 261
121 3300025940 Ga0207691_10061874 Ga0207691_100618744 261
122 3300025942 Ga0207689_10014199 Ga0207689_100141994 261
123 3300025960 Ga0207651_10013471 Ga0207651_100134715 261
124 3300026075 Ga0207708_10018403 Ga0207708_100184033 261
125 3300026089 Ga0207648_10093742 Ga0207648_100937423 261
126 3300026121 Ga0207683_10513953 Ga0207683_105139531 261
127 3300027866 Ga0209813_10014211 Ga0209813_100142112 261
128 3300027907 Ga0207428_10000445 Ga0207428_1000044528 261
129 3300028381 Ga0268264_10150083 Ga0268264_101500832 261
130 3300031548 Ga0307408_100005759 Ga0307408_1000057596 261
131 3300031548 Ga0307408_100095422 Ga0307408_1000954222 261
132 3300031548 Ga0307408_100189122 Ga0307408_1001891222 261
133 3300031852 Ga0307410_10232206 Ga0307410_102322062 261
134 3300031852 Ga0307410_10479431 Ga0307410_104794311 261
135 3300031901 Ga0307406_10075346 Ga0307406_100753462 261
136 3300031901 Ga0307406_10106325 Ga0307406_101063252 261
137 3300031901 Ga0307406_10668662 Ga0307406_106686621 261
138 3300031911 Ga0307412_10552741 Ga0307412_105527411 261
139 3300032002 Ga0307416_100040297 Ga0307416_1000402971 261
140 3300032002 Ga0307416_100076446 Ga0307416_1000764462 261
141 3300032002 Ga0307416_100151899 Ga0307416_1001518992 261
142 3300032005 Ga0307411_10100466 Ga0307411_101004662 261
143 3300032126 Ga0307415_100048304 Ga0307415_1000483042 261
144 3300035170 Ga0373943_0168899 Ga0373943_0168899_30_815 261
145 3300035691 Ga0373931_0169563 Ga0373931_0169563_346_1131 261
146 3300036401 Ga0373937_0000513 Ga0373937_0000513_7286_8071 261
147 3300037068 Ga0373925_0003323 Ga0373925_0003323_39_824 261
148 3300042001 Ga0439441_020618 Ga0439441_020618_78_863 261
149 3300042126 Ga0450888_012300 Ga0450888_012300_129_914 261
150 3300042436 Ga0439435_0003326 Ga0439435_0003326_1531_2316 261
151 3300042439 Ga0439464_0006098 Ga0439464_0006098_2297_3082 261
152 3300042439 Ga0439464_0025314 Ga0439464_0025314_760_1545 261
153 3300042461 Ga0439460_0016107 Ga0439460_0016107_1037_1822 261
154 3300042461 Ga0439460_0058392 Ga0439460_0058392_129_914 261
155 3300042461 Ga0439460_0083519 Ga0439460_0083519_175_960 261
156 3300042993 Ga0439440_0016925 Ga0439440_0016925_436_1221 261
157 3300046680 Ga0495646_0290419 Ga0495646_0290419_28_813 261
158 3300048916 Ga0496113_0265775 Ga0496113_0265775_327_1112 261
159 3300049568 Ga0501031_0088367 Ga0501031_0088367_996_1781 261
160 3300049575 Ga0501039_0046708 Ga0501039_0046708_1102_1887 261
161 3300049575 Ga0501039_0437031 Ga0501039_0437031_79_864 261
162 3300049576 Ga0501040_0031302 Ga0501040_0031302_2195_2980 261
163 3300049576 Ga0501040_0070246 Ga0501040_0070246_331_1116 261
164 3300049578 Ga0501042_0059731 Ga0501042_0059731_1699_2484 261
165 3300049578 Ga0501042_0316276 Ga0501042_0316276_309_1094 261
166 3300049582 Ga0501048_0213897 Ga0501048_0213897_388_1173 261
167 3300049582 Ga0501048_0309266 Ga0501048_0309266_19_804 261
168 3300049584 Ga0501068_0276809 Ga0501068_0276809_74_859 261
169 3300049587 Ga0501071_0228613 Ga0501071_0228613_415_1200 261
170 3300049588 Ga0501072_0066874 Ga0501072_0066874_34_819 261
171 3300049588 Ga0501072_0111471 Ga0501072_0111471_1179_1964 261
172 3300049589 Ga0501073_0018855 Ga0501073_0018855_2678_3463 261
173 3300049589 Ga0501073_0323958 Ga0501073_0323958_94_879 261
174 3300049591 Ga0501075_0059639 Ga0501075_0059639_179_964 261
175 3300049592 Ga0501076_0022893 Ga0501076_0022893_871_1656 261
176 3300049592 Ga0501076_0038905 Ga0501076_0038905_1014_1799 261
177 3300049592 Ga0501076_0060409 Ga0501076_0060409_1931_2716 261
178 3300049593 Ga0501077_0375248 Ga0501077_0375248_18_803 261
179 3300049593 Ga0501077_0380277 Ga0501077_0380277_92_877 261
180 3300049741 Ga0501079_0106001 Ga0501079_0106001_535_1320 261
181 3300049742 Ga0501080_0370117 Ga0501080_0370117_195_980 261
182 3300049743 Ga0501081_0064578 Ga0501081_0064578_1330_2115 261
183 3300049743 Ga0501081_0137400 Ga0501081_0137400_28_813 261
184 3300049824 Ga0501045_0264565 Ga0501045_0264565_244_1029 261
185 3300050493 nmdc:mga0k408_399725_c1 nmdc:mga0k408_399725_c1_17_802 261
186 3300050494 nmdc:mga06z11_99953_c1 nmdc:mga06z11_99953_c1_566_1351 261
187 3300050507 nmdc:mga05p37_1089_c2 nmdc:mga05p37_1089_c2_7198_7983 261
188 3300050507 nmdc:mga05p37_13248_c1 nmdc:mga05p37_13248_c1_6959_7744 261
189 3300050507 nmdc:mga05p37_406677_c1 nmdc:mga05p37_406677_c1_785_1570 261
190 3300050507 nmdc:mga05p37_48699_c1 nmdc:mga05p37_48699_c1_2686_3471 261
191 3300050507 nmdc:mga05p37_638_c1 nmdc:mga05p37_638_c1_6027_6812 261
192 3300050507 nmdc:mga05p37_7289_c1 nmdc:mga05p37_7289_c1_7555_8340 261
193 3300050508 nmdc:mga09592_201795_c1 nmdc:mga09592_201795_c1_134_919 261
194 3300050508 nmdc:mga09592_2104_c1 nmdc:mga09592_2104_c1_3788_4573 261
195 3300050508 nmdc:mga09592_574513_c1 nmdc:mga09592_574513_c1_32_817 261
196 3300050508 nmdc:mga09592_98413_c1 nmdc:mga09592_98413_c1_1706_2491 261
197 3300050509 nmdc:mga0qj67_1418_c1 nmdc:mga0qj67_1418_c1_5050_5835 261
198 3300050509 nmdc:mga0qj67_16753_c1 nmdc:mga0qj67_16753_c1_558_1343 261
199 3300050509 nmdc:mga0qj67_191129_c1 nmdc:mga0qj67_191129_c1_768_1553 261
200 3300050509 nmdc:mga0qj67_26156_c1 nmdc:mga0qj67_26156_c1_199_984 261
201 3300050509 nmdc:mga0qj67_84767_c1 nmdc:mga0qj67_84767_c1_579_1364 261
202 3300050510 nmdc:mga06r32_116222_c1 nmdc:mga06r32_116222_c1_1205_1990 261
203 3300050510 nmdc:mga06r32_171214_c1 nmdc:mga06r32_171214_c1_896_1681 261
204 3300050510 nmdc:mga06r32_18246_c1 nmdc:mga06r32_18246_c1_4770_5555 261
205 3300050510 nmdc:mga06r32_256112_c1 nmdc:mga06r32_256112_c1_543_1328 261
206 3300050510 nmdc:mga06r32_7742_c1 nmdc:mga06r32_7742_c1_3158_3943 261
207 3300050511 nmdc:mga08y16_422576_c1 nmdc:mga08y16_422576_c1_438_1223 261
208 3300050511 nmdc:mga08y16_4743_c1 nmdc:mga08y16_4743_c1_5293_6078 261
209 3300050512 nmdc:mga0n895_948488_c1 nmdc:mga0n895_948488_c1_14_799 261
210 3300050513 nmdc:mga0rr50_172872_c1 nmdc:mga0rr50_172872_c1_39_824 261
211 3300050515 nmdc:mga0a205_7790_c1 nmdc:mga0a205_7790_c1_286_1071 261
212 3300053084 Ga0495595_0138976 Ga0495595_0138976_175_960 261
213 3300053085 Ga0495619_0051374 Ga0495619_0051374_1211_1996 261
214 3300054114 Ga0501084_0035846 Ga0501084_0035846_2106_2891 261
215 3300054114 Ga0501084_0168936 Ga0501084_0168936_246_1031 261
216 3300061734 Ga0530510_0142745 Ga0530510_0142745_786_1571 261
217 3300006847 Ga0075431_100096381 Ga0075431_1000963813 262
218 3300006852 Ga0075433_10021567 Ga0075433_100215672 262
219 3300009094 Ga0111539_10211645 Ga0111539_102116452 262
220 3300009147 Ga0114129_10001999 Ga0114129_1000199925 262
221 3300026035 Ga0207703_10116728 Ga0207703_101167282 262
222 3300027907 Ga0207428_10002413 Ga0207428_1000241314 262
223 3300031852 Ga0307410_10084721 Ga0307410_100847212 262
224 3300032002 Ga0307416_100138570 Ga0307416_1001385702 262
225 3300049574 Ga0501038_0287785 Ga0501038_0287785_149_937 262
226 3300049575 Ga0501039_0078906 Ga0501039_0078906_1710_2498 262
227 3300049578 Ga0501042_0235950 Ga0501042_0235950_433_1221 262
228 3300049580 Ga0501046_0237003 Ga0501046_0237003_449_1258 262
229 3300049592 Ga0501076_0343459 Ga0501076_0343459_133_921 262
230 3300049741 Ga0501079_0182038 Ga0501079_0182038_35_823 262
231 3300050507 nmdc:mga05p37_3190_c1 nmdc:mga05p37_3190_c1_10518_11318 262
232 3300050509 nmdc:mga0qj67_462470_c1 nmdc:mga0qj67_462470_c1_81_869 262
233 3300050510 nmdc:mga06r32_330202_c1 nmdc:mga06r32_330202_c1_600_1388 262
234 3300050510 nmdc:mga06r32_635494_c1 nmdc:mga06r32_635494_c1_20_808 262
235 3300050510 nmdc:mga06r32_640784_c1 nmdc:mga06r32_640784_c1_82_870 262
236 3300050511 nmdc:mga08y16_11526_c1 nmdc:mga08y16_11526_c1_2307_3095 262
237 3300050515 nmdc:mga0a205_30478_c1 nmdc:mga0a205_30478_c1_810_1610 262
238 3300054114 Ga0501084_0062718 Ga0501084_0062718_2220_3008 262
239 3300005290 Ga0065712_10039260 Ga0065712_100392602 263
240 3300005290 Ga0065712_10239246 Ga0065712_102392461 263
241 3300005293 Ga0065715_10409685 Ga0065715_104096851 263
242 3300005334 Ga0068869_100278026 Ga0068869_1002780262 263
243 3300005335 Ga0070666_10087235 Ga0070666_100872353 263
244 3300005337 Ga0070682_100245426 Ga0070682_1002454262 263
245 3300005347 Ga0070668_100006636 Ga0070668_1000066364 263
246 3300005347 Ga0070668_100070147 Ga0070668_1000701472 263
247 3300005353 Ga0070669_100105149 Ga0070669_1001051492 263
248 3300005354 Ga0070675_100524120 Ga0070675_1005241201 263
249 3300005354 Ga0070675_100542900 Ga0070675_1005429002 263
250 3300005356 Ga0070674_100033558 Ga0070674_1000335584 263
251 3300005356 Ga0070674_100085165 Ga0070674_1000851652 263
252 3300005366 Ga0070659_100098075 Ga0070659_1000980752 263
253 3300005439 Ga0070711_100069949 Ga0070711_1000699493 263
254 3300005457 Ga0070662_100157840 Ga0070662_1001578402 263
255 3300005457 Ga0070662_100195523 Ga0070662_1001955232 263
256 3300005458 Ga0070681_10003693 Ga0070681_100036936 263
257 3300005471 Ga0070698_100133526 Ga0070698_1001335263 263
258 3300005471 Ga0070698_100300494 Ga0070698_1003004942 263
259 3300005530 Ga0070679_100080150 Ga0070679_1000801502 263
260 3300005543 Ga0070672_100317365 Ga0070672_1003173652 263
261 3300005546 Ga0070696_100019487 Ga0070696_1000194872 263
262 3300005548 Ga0070665_100001879 Ga0070665_10000187917 263
263 3300005548 Ga0070665_100233467 Ga0070665_1002334672 263
264 3300005549 Ga0070704_100019719 Ga0070704_1000197194 263
265 3300005564 Ga0070664_100144108 Ga0070664_1001441082 263
266 3300005564 Ga0070664_100444122 Ga0070664_1004441221 263
267 3300005577 Ga0068857_100315828 Ga0068857_1003158282 263
268 3300005617 Ga0068859_100540531 Ga0068859_1005405312 263
269 3300005617 Ga0068859_100566826 Ga0068859_1005668262 263
270 3300005719 Ga0068861_100012368 Ga0068861_1000123684 263
271 3300005834 Ga0068851_10184555 Ga0068851_101845552 263
272 3300005841 Ga0068863_100025860 Ga0068863_1000258601 263
273 3300005841 Ga0068863_100325393 Ga0068863_1003253932 263
274 3300005842 Ga0068858_100012178 Ga0068858_1000121787 263
275 3300005843 Ga0068860_100241626 Ga0068860_1002416261 263
276 3300005843 Ga0068860_100415101 Ga0068860_1004151011 263
277 3300005844 Ga0068862_100012037 Ga0068862_1000120376 263
278 3300005844 Ga0068862_100538314 Ga0068862_1005383142 263
279 3300005844 Ga0068862_100548568 Ga0068862_1005485681 263
280 3300006237 Ga0097621_100008625 Ga0097621_1000086254 263
281 3300006237 Ga0097621_100057255 Ga0097621_1000572554 263
282 3300006358 Ga0068871_100024332 Ga0068871_1000243323 263
283 3300006846 Ga0075430_100185525 Ga0075430_1001855252 263
284 3300006847 Ga0075431_100035152 Ga0075431_1000351521 263
285 3300006852 Ga0075433_10077673 Ga0075433_100776733 263
286 3300006871 Ga0075434_100086563 Ga0075434_1000865632 263
287 3300006881 Ga0068865_100136772 Ga0068865_1001367723 263
288 3300006914 Ga0075436_100050954 Ga0075436_1000509541 263
289 3300006931 Ga0097620_100540538 Ga0097620_1005405382 263
290 3300006931 Ga0097620_100566826 Ga0097620_1005668262 263
291 3300007076 Ga0075435_100004980 Ga0075435_1000049805 263
292 3300009093 Ga0105240_10017120 Ga0105240_100171204 263
293 3300009098 Ga0105245_10044220 Ga0105245_100442203 263
294 3300009101 Ga0105247_10002386 Ga0105247_100023861 263
295 3300009101 Ga0105247_10196378 Ga0105247_101963782 263
296 3300009147 Ga0114129_10003812 Ga0114129_100038126 263
297 3300009147 Ga0114129_10008750 Ga0114129_100087507 263
298 3300009147 Ga0114129_10066845 Ga0114129_100668451 263
299 3300009148 Ga0105243_10375938 Ga0105243_103759382 263
300 3300009176 Ga0105242_10128458 Ga0105242_101284582 263
301 3300009176 Ga0105242_10714701 Ga0105242_107147012 263
302 3300009177 Ga0105248_10004005 Ga0105248_100040059 263
303 3300009177 Ga0105248_10053353 Ga0105248_100533532 263
304 3300009177 Ga0105248_10139208 Ga0105248_101392082 263
305 3300009177 Ga0105248_10172496 Ga0105248_101724962 263
306 3300009177 Ga0105248_10764480 Ga0105248_107644801 263
307 3300009545 Ga0105237_10465478 Ga0105237_104654782 263
308 3300013297 Ga0157378_10630835 Ga0157378_106308351 263
309 3300013297 Ga0157378_10849033 Ga0157378_108490331 263
310 3300013308 Ga0157375_10073949 Ga0157375_100739493 263
311 3300013308 Ga0157375_10633748 Ga0157375_106337482 263
312 3300014325 Ga0163163_10036126 Ga0163163_100361264 263
313 3300014326 Ga0157380_10668318 Ga0157380_106683181 263
314 3300014968 Ga0157379_10079608 Ga0157379_100796083 263
315 3300014968 Ga0157379_10131682 Ga0157379_101316822 263
316 3300014969 Ga0157376_10004135 Ga0157376_100041359 263
317 3300014969 Ga0157376_10156950 Ga0157376_101569502 263
318 3300025899 Ga0207642_10090128 Ga0207642_100901282 263
319 3300025907 Ga0207645_10057285 Ga0207645_100572853 263
320 3300025912 Ga0207707_10083559 Ga0207707_100835593 263
321 3300025917 Ga0207660_10082272 Ga0207660_100822722 263
322 3300025919 Ga0207657_10119585 Ga0207657_101195852 263
323 3300025921 Ga0207652_10463580 Ga0207652_104635802 263
324 3300025922 Ga0207646_10425005 Ga0207646_104250051 263
325 3300025923 Ga0207681_10151045 Ga0207681_101510452 263
326 3300025926 Ga0207659_10091502 Ga0207659_100915022 263
327 3300025932 Ga0207690_10297155 Ga0207690_102971552 263
328 3300025933 Ga0207706_10130589 Ga0207706_101305892 263
329 3300025933 Ga0207706_10347139 Ga0207706_103471391 263
330 3300025934 Ga0207686_10336129 Ga0207686_103361292 263
331 3300025934 Ga0207686_10548616 Ga0207686_105486161 263
332 3300025937 Ga0207669_10095277 Ga0207669_100952772 263
333 3300025938 Ga0207704_10102171 Ga0207704_101021713 263
334 3300025941 Ga0207711_10023199 Ga0207711_100231994 263
335 3300025941 Ga0207711_10318220 Ga0207711_103182202 263
336 3300025942 Ga0207689_10070467 Ga0207689_100704674 263
337 3300025945 Ga0207679_10750783 Ga0207679_107507831 263
338 3300025949 Ga0207667_10876940 Ga0207667_108769401 263
339 3300025960 Ga0207651_10006484 Ga0207651_100064845 263
340 3300025960 Ga0207651_10239837 Ga0207651_102398371 263
341 3300026023 Ga0207677_10605277 Ga0207677_106052772 263
342 3300026035 Ga0207703_10242892 Ga0207703_102428922 263
343 3300026035 Ga0207703_10935250 Ga0207703_109352501 263
344 3300026075 Ga0207708_10175554 Ga0207708_101755541 263
345 3300026088 Ga0207641_10251413 Ga0207641_102514132 263
346 3300026088 Ga0207641_10416857 Ga0207641_104168571 263
347 3300026088 Ga0207641_10533023 Ga0207641_105330231 263
348 3300026089 Ga0207648_10115526 Ga0207648_101155261 263
349 3300026089 Ga0207648_10708425 Ga0207648_107084251 263
350 3300026095 Ga0207676_10016334 Ga0207676_100163344 263
351 3300026118 Ga0207675_100003564 Ga0207675_1000035649 263
352 3300026118 Ga0207675_100064733 Ga0207675_1000647332 263
353 3300026121 Ga0207683_10195712 Ga0207683_101957122 263
354 3300028379 Ga0268266_10203955 Ga0268266_102039552 263
355 3300028379 Ga0268266_10298376 Ga0268266_102983762 263
356 3300028380 Ga0268265_10096738 Ga0268265_100967382 263
357 3300028380 Ga0268265_10265068 Ga0268265_102650682 263
358 3300028380 Ga0268265_10555111 Ga0268265_105551112 263
359 3300028381 Ga0268264_10708771 Ga0268264_107087712 263
360 3300031456 Ga0307513_10547502 Ga0307513_105475021 263
361 3300032002 Ga0307416_100182350 Ga0307416_1001823502 263
362 3300035086 Ga0373934_0037848 Ga0373934_0037848_56_847 263
363 3300035086 Ga0373934_0074023 Ga0373934_0074023_307_1107 263
364 3300035116 Ga0373945_0022207 Ga0373945_0022207_869_1660 263
365 3300035117 Ga0373953_0030439 Ga0373953_0030439_330_1130 263
366 3300035170 Ga0373943_0031772 Ga0373943_0031772_969_1769 263
367 3300035170 Ga0373943_0270547 Ga0373943_0270547_94_885 263
368 3300035171 Ga0373946_0010185 Ga0373946_0010185_1707_2507 263
369 3300035171 Ga0373946_0056744 Ga0373946_0056744_689_1480 263
370 3300035171 Ga0373946_0214062 Ga0373946_0214062_103_903 263
371 3300035172 Ga0373955_0037650 Ga0373955_0037650_162_953 263
372 3300035172 Ga0373955_0092149 Ga0373955_0092149_658_1458 263
373 3300035172 Ga0373955_0230022 Ga0373955_0230022_163_960 263
374 3300035410 Ga0373924_0002742 Ga0373924_0002742_3547_4347 263
375 3300035695 Ga0373927_0080617 Ga0373927_0080617_636_1436 263
376 3300035725 Ga0373947_0091904 Ga0373947_0091904_498_1289 263
377 3300036401 Ga0373937_0057140 Ga0373937_0057140_1201_2001 263
378 3300036401 Ga0373937_0243982 Ga0373937_0243982_59_850 263
379 3300037068 Ga0373925_0003479 Ga0373925_0003479_1251_2051 263
380 3300037068 Ga0373925_0543968 Ga0373925_0543968_132_923 263
381 3300041999 Ga0439433_0033950 Ga0439433_0033950_309_1112 263
382 3300042014 Ga0439457_014388 Ga0439457_014388_286_1089 263
383 3300042876 Ga0451577_0012810 Ga0451577_0012810_3686_4477 263
384 3300042876 Ga0451577_0664002 Ga0451577_0664002_25_816 263
385 3300044712 Ga0453684_0124671 Ga0453684_0124671_708_1499 263
386 3300046454 Ga0495592_0306915 Ga0495592_0306915_98_889 263
387 3300046459 Ga0495629_0233023 Ga0495629_0233023_432_1232 263
388 3300046473 Ga0495582_0080216 Ga0495582_0080216_573_1373 263
389 3300046511 Ga0495608_0008013 Ga0495608_0008013_1416_2216 263
390 3300046516 Ga0495628_0002852 Ga0495628_0002852_9196_9996 263
391 3300046517 Ga0495630_0009226 Ga0495630_0009226_3009_3809 263
392 3300046529 Ga0495652_0470402 Ga0495652_0470402_12_812 263
393 3300046536 Ga0495587_0047900 Ga0495587_0047900_381_1181 263
394 3300046642 Ga0495634_0208798 Ga0495634_0208798_79_870 263
395 3300046678 Ga0495599_0136612 Ga0495599_0136612_603_1394 263
396 3300046681 Ga0495647_0106873 Ga0495647_0106873_47_838 263
397 3300046683 Ga0495658_0192801 Ga0495658_0192801_305_1105 263
398 3300046689 Ga0495613_0003890 Ga0495613_0003890_4100_4900 263
399 3300047317 Ga0495604_0031490 Ga0495604_0031490_518_1318 263
400 3300047317 Ga0495604_0130531 Ga0495604_0130531_464_1255 263
401 3300047317 Ga0495604_0255119 Ga0495604_0255119_385_1176 263
402 3300047319 Ga0495674_0008199 Ga0495674_0008199_1077_1877 263
403 3300047322 Ga0495680_0319320 Ga0495680_0319320_57_848 263
404 3300047444 Ga0495675_0220553 Ga0495675_0220553_156_947 263
405 3300047471 Ga0495684_0017049 Ga0495684_0017049_2636_3436 263
406 3300048088 Ga0495602_0218847 Ga0495602_0218847_578_1369 263
407 3300048903 Ga0496100_0000818 Ga0496100_0000818_9203_10003 263
408 3300048904 Ga0496101_0001661 Ga0496101_0001661_3502_4302 263
409 3300048905 Ga0496102_0010055 Ga0496102_0010055_794_1594 263
410 3300048905 Ga0496102_0173353 Ga0496102_0173353_702_1493 263
411 3300048907 Ga0496104_0003527 Ga0496104_0003527_1793_2593 263
412 3300048907 Ga0496104_0030167 Ga0496104_0030167_845_1636 263
413 3300048907 Ga0496104_0116293 Ga0496104_0116293_431_1222 263
414 3300048908 Ga0496105_0056566 Ga0496105_0056566_1392_2192 263
415 3300048909 Ga0496106_0011246 Ga0496106_0011246_1366_2166 263
416 3300048910 Ga0496107_0225137 Ga0496107_0225137_13_813 263
417 3300048911 Ga0496108_0246200 Ga0496108_0246200_172_972 263
418 3300048912 Ga0496109_0229569 Ga0496109_0229569_916_1707 263
419 3300048912 Ga0496109_0343137 Ga0496109_0343137_72_872 263
420 3300048913 Ga0496110_0303874 Ga0496110_0303874_71_862 263
421 3300048914 Ga0496111_0057054 Ga0496111_0057054_373_1164 263
422 3300048915 Ga0496112_0010102 Ga0496112_0010102_2486_3277 263
423 3300048917 Ga0496114_0000958 Ga0496114_0000958_16464_17264 263
424 3300048918 Ga0496115_0065821 Ga0496115_0065821_681_1481 263
425 3300049571 Ga0501034_0009079 Ga0501034_0009079_6486_7277 263
426 3300049592 Ga0501076_0136981 Ga0501076_0136981_55_846 263
427 3300049593 Ga0501077_0359841 Ga0501077_0359841_45_836 263
428 3300049743 Ga0501081_0028362 Ga0501081_0028362_381_1172 263
429 3300049823 Ga0501044_0005862 Ga0501044_0005862_6913_7704 263
430 3300049824 Ga0501045_0358456 Ga0501045_0358456_16_807 263
431 3300050507 nmdc:mga05p37_17662_c1 nmdc:mga05p37_17662_c1_7406_8197 263
432 3300050507 nmdc:mga05p37_24585_c1 nmdc:mga05p37_24585_c1_1895_2686 263
433 3300050509 nmdc:mga0qj67_68163_c1 nmdc:mga0qj67_68163_c1_130_921 263
434 3300050510 nmdc:mga06r32_402227_c1 nmdc:mga06r32_402227_c1_34_825 263
435 3300050512 nmdc:mga0n895_23759_c1 nmdc:mga0n895_23759_c1_863_1654 263
436 3300050513 nmdc:mga0rr50_14702_c1 nmdc:mga0rr50_14702_c1_853_1644 263
437 3300050514 nmdc:mga08x19_41891_c1 nmdc:mga08x19_41891_c1_1597_2388 263
438 3300050515 nmdc:mga0a205_197897_c2 nmdc:mga0a205_197897_c2_739_1530 263
439 3300053077 Ga0495601_0009584 Ga0495601_0009584_4219_5019 263
440 3300053077 Ga0495601_0335179 Ga0495601_0335179_46_837 263
441 3300053085 Ga0495619_0002018 Ga0495619_0002018_6896_7696 263
442 3300053085 Ga0495619_0086299 Ga0495619_0086299_661_1452 263
443 3300053085 Ga0495619_0096362 Ga0495619_0096362_567_1358 263
444 3300053085 Ga0495619_0303285 Ga0495619_0303285_210_1010 263
445 3300053104 Ga0500556_0077228 Ga0500556_0077228_303_1094 263
446 3300054114 Ga0501084_0249946 Ga0501084_0249946_212_1003 263
447 3300059424 Ga0590075_049921 Ga0590075_049921_82_885 263
448 3300059426 Ga0590077_021269 Ga0590077_021269_313_1116 263
449 3300060353 Ga0501082_0062927 Ga0501082_0062927_1854_2645 263
450 3300060353 Ga0501082_0104346 Ga0501082_0104346_1473_2264 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

56

272

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u82-assembly1.cif.gz_A structure of s. aureus undecaprenyl diphosphate synthase in complex with fspp and sulfate 0.9683 23 253
5hc8-assembly1.cif.gz_A crystal structure of lavandulyl diphosphate synthase from lavandula x intermedia in complex with dimethylallyl diphosphate 0.9623 28 251
1x07-assembly1.cif.gz_A crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp 0.9578 29 247
1x09-assembly1.cif.gz_A crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate 0.9541 27 246
4u82-assembly1.cif.gz_A structure of s. aureus undecaprenyl diphosphate synthase in complex with fspp and sulfate 0.9443 23 253
ID Description Score Start End Superfamily
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9625 28 246 3.40.1180.10
af_K7KA63_68_310_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.954 22 253 3.40.1180.10
2dtnB00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9426 30 251 3.40.1180.10
af_Q58767_31_280_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9399 16 251 3.40.1180.10
2vg2A01 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.938 23 246 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A1B2ZBN4-F1-model_v4 UDP pyrophosphate synthase 0.9904 27 144 GO:0016094
GO:0045547
AF-X1FLT0-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9877 27 173 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A202DGC7-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9847 27 157 GO:0016094
GO:0045547
AF-A0A6B1DH71-F1-model_v4 Isoprenyl transferase (EC 2.5.1.-) 0.9846 1 253 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A258EU35-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.975 21 235 GO:0016094
GO:0045547
GO:0046872

Feature Viewer

pLDDT pTM Quality
87.75 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map