F446595

General Info

Members Datasets Scaffolds Average Seq Length
450 238 900 155

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10384643|Ga0207671_103846432
Length 182
Sequence MTVEEFKIFLPTIPGQPGVYRFIDKREIPIYVGKAKDLRKRLTAAGHDIVDFGANRLEPGDDYPDFVTPLARAVAAGTLERGIAVCGSGVGASVCANKVPGVHAGLINDHFSARQGVEDDHMNVICLGGRVMGTMVAWDLVESFLAAEFSQEERHLRRLSKVAALETKAANEVGAEASTIPA

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 20.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10384643 3300025914 Unclassified 1115
2 Ga0065715_10106546 3300005293 Bacteria 2822
3 Ga0065715_10166791 3300005293 Bacteria 1570
4 Ga0065715_10632172 3300005293 Bacteria 682
5 Ga0065707_10015971 3300005295 Bacteria 2054
6 Ga0065707_10347906 3300005295 Bacteria 923
7 Ga0070676_10041866 3300005328 Bacteria 2657
8 Ga0070683_100039824 3300005329 Bacteria 4317
9 Ga0070690_100033878 3300005330 Bacteria 3199
10 Ga0068869_100006864 3300005334 Bacteria 7242
11 Ga0068869_100123206 3300005334 Bacteria 1985
12 Ga0070666_10001715 3300005335 Bacteria 13364
13 Ga0070666_10591432 3300005335 Unclassified 809
14 Ga0070680_100618153 3300005336 Unclassified 930
15 Ga0070682_100389553 3300005337 Unclassified 1051
16 Ga0068868_100008872 3300005338 Bacteria 7204
17 Ga0070660_100028197 3300005339 Bacteria 4199
18 Ga0070687_100170545 3300005343 Bacteria 1295
19 Ga0070668_100220091 3300005347 Unclassified 1565
20 Ga0070669_100023750 3300005353 Bacteria 4393
21 Ga0070669_101544751 3300005353 Unclassified 577
22 Ga0070675_100236178 3300005354 Unclassified 1596
23 Ga0070671_100003755 3300005355 Bacteria 11927
24 Ga0070674_100368152 3300005356 Bacteria 1166
25 Ga0070673_100245584 3300005364 Bacteria 1558
26 Ga0070673_100500486 3300005364 Unclassified 1099
27 Ga0070659_100113469 3300005366 Bacteria 2189
28 Ga0070667_100004703 3300005367 Bacteria 11448
29 Ga0070667_100539678 3300005367 Unclassified 1071
30 Ga0070709_10010814 3300005434 Bacteria 5065
31 Ga0070709_10021636 3300005434 Bacteria 3748
32 Ga0070709_10047885 3300005434 Bacteria 2665
33 Ga0070709_11206972 3300005434 Bacteria 608
34 Ga0070714_100161808 3300005435 Unclassified 2026
35 Ga0070714_100293323 3300005435 Bacteria 1514
36 Ga0070713_100001526 3300005436 Bacteria 14773
37 Ga0070713_100533146 3300005436 Bacteria 1110
38 Ga0070713_100550048 3300005436 Bacteria 1093
39 Ga0070713_100662443 3300005436 Bacteria 995
40 Ga0070710_11422605 3300005437 Bacteria 519
41 Ga0070701_10029136 3300005438 Bacteria 2720
42 Ga0070711_100027812 3300005439 Bacteria 3715
43 Ga0070711_100143925 3300005439 Unclassified 1791
44 Ga0070711_100165485 3300005439 Unclassified 1680
45 Ga0070711_100724290 3300005439 Bacteria 839
46 Ga0070711_101167462 3300005439 Unclassified 665
47 Ga0070705_100055548 3300005440 Unclassified 2328
48 Ga0070705_100307024 3300005440 Bacteria 1139
49 Ga0070700_100365841 3300005441 Bacteria 1074
50 Ga0070694_100000274 3300005444 Bacteria 27377
51 Ga0070708_100000460 3300005445 Bacteria 30625
52 Ga0070708_100011652 3300005445 Bacteria 7155
53 Ga0070678_100007607 3300005456 Bacteria 6437
54 Ga0070678_100106091 3300005456 Bacteria 2188
55 Ga0070662_100051507 3300005457 Bacteria 2973
56 Ga0070662_100962832 3300005457 Unclassified 730
57 Ga0070681_10037936 3300005458 Bacteria 4832
58 Ga0070681_10208626 3300005458 Bacteria 1870
59 Ga0068867_100011563 3300005459 Bacteria 6231
60 Ga0068867_100587487 3300005459 Bacteria 969
61 Ga0070706_100058150 3300005467 Bacteria 3568
62 Ga0070706_100067456 3300005467 Bacteria 3309
63 Ga0070706_100799857 3300005467 Bacteria 873
64 Ga0070707_100008282 3300005468 Bacteria 9648
65 Ga0070707_100021828 3300005468 Bacteria 6052
66 Ga0070707_100026419 3300005468 Bacteria 5512
67 Ga0070707_100206770 3300005468 Bacteria 1913
68 Ga0070698_100002476 3300005471 Bacteria 20366
69 Ga0070698_100475316 3300005471 Bacteria 1186
70 Ga0070699_100000738 3300005518 Bacteria 30317
71 Ga0070699_100028933 3300005518 Bacteria 4777
72 Ga0070699_100104232 3300005518 Bacteria 2488
73 Ga0070679_100032040 3300005530 Bacteria 5197
74 Ga0070684_100225020 3300005535 Bacteria 1712
75 Ga0070697_100081515 3300005536 Unclassified 2666
76 Ga0068853_100370865 3300005539 Bacteria 1335
77 Ga0068853_100954443 3300005539 Bacteria 825
78 Ga0070672_101280690 3300005543 Unclassified 654
79 Ga0070686_100060182 3300005544 Bacteria 2450
80 Ga0070686_100272257 3300005544 Bacteria 1245
81 Ga0070686_100916403 3300005544 Unclassified 714
82 Ga0070695_100055650 3300005545 Bacteria 2550
83 Ga0070695_100062695 3300005545 Bacteria 2415
84 Ga0070695_100067486 3300005545 Bacteria 2333
85 Ga0070695_100242445 3300005545 Unclassified 1308
86 Ga0070696_100179830 3300005546 Bacteria 1568
87 Ga0070693_100024503 3300005547 Bacteria 3237
88 Ga0070693_100592163 3300005547 Unclassified 799
89 Ga0070665_101521467 3300005548 Unclassified 677
90 Ga0070704_100046421 3300005549 Bacteria 3029
91 Ga0070704_100176924 3300005549 Bacteria 1703
92 Ga0068855_100321513 3300005563 Bacteria 1710
93 Ga0068855_100942747 3300005563 Bacteria 910
94 Ga0070664_100118891 3300005564 Bacteria 2312
95 Ga0070664_100228315 3300005564 Bacteria 1668
96 Ga0068857_100002970 3300005577 Bacteria 13970
97 Ga0068854_100212769 3300005578 Bacteria 1526
98 Ga0068856_100039123 3300005614 Bacteria 4656
99 Ga0068856_100440799 3300005614 Bacteria 1323
100 Ga0068856_102022221 3300005614 Unclassified 586
101 Ga0070702_100420185 3300005615 Unclassified 962
102 Ga0068859_100220624 3300005617 Bacteria 1984
103 Ga0068866_10002078 3300005718 Bacteria 8323
104 Ga0068861_100064426 3300005719 Bacteria 2820
105 Ga0068861_102437905 3300005719 Unclassified 526
106 Ga0068863_100209583 3300005841 Bacteria 1876
107 Ga0068863_100303054 3300005841 Bacteria 1550
108 Ga0068863_100595298 3300005841 Bacteria 1094
109 Ga0068858_100022629 3300005842 Bacteria 5861
110 Ga0068858_100050888 3300005842 Bacteria 3834
111 Ga0068858_100224168 3300005842 Bacteria 1781
112 Ga0068860_100018177 3300005843 Bacteria 6843
113 Ga0068860_100048112 3300005843 Bacteria 4065
114 Ga0068860_100098532 3300005843 Bacteria 2787
115 Ga0068862_100058468 3300005844 Bacteria 3307
116 Ga0068862_100367938 3300005844 Bacteria 1337
117 Ga0070717_11516831 3300006028 Unclassified 608
118 Ga0070715_10002149 3300006163 Bacteria 5973
119 Ga0070716_100001260 3300006173 Bacteria 11149
120 Ga0070716_100068889 3300006173 Bacteria 2072
121 Ga0070716_100155807 3300006173 Bacteria 1475
122 Ga0070716_100392254 3300006173 Bacteria 996
123 Ga0070712_100000101 3300006175 Bacteria 43677
124 Ga0070712_100629087 3300006175 Unclassified 910
125 Ga0070712_101245128 3300006175 Unclassified 648
126 Ga0097621_100093154 3300006237 Bacteria 2524
127 Ga0097621_100561100 3300006237 Bacteria 1040
128 Ga0097621_100734479 3300006237 Bacteria 911
129 Ga0097621_101656228 3300006237 Unclassified 609
130 Ga0068871_100011641 3300006358 Bacteria 6458
131 Ga0068871_100306238 3300006358 Bacteria 1396
132 Ga0068871_100407400 3300006358 Unclassified 1212
133 Ga0068871_100862836 3300006358 Unclassified 837
134 Ga0075428_100269570 3300006844 Bacteria 1832
135 Ga0075433_10002499 3300006852 Bacteria 13989
136 Ga0075433_10509491 3300006852 Bacteria 1059
137 Ga0075434_100001045 3300006871 Bacteria 22585
138 Ga0075434_100111228 3300006871 Bacteria 2750
139 Ga0075434_101177993 3300006871 Bacteria 779
140 Ga0075434_101228024 3300006871 Bacteria 761
141 Ga0075429_100055711 3300006880 Bacteria 3440
142 Ga0068865_100009086 3300006881 Bacteria 6150
143 Ga0068865_100092055 3300006881 Bacteria 2202
144 Ga0068865_101141826 3300006881 Unclassified 688
145 Ga0075436_100021131 3300006914 Bacteria 4466
146 Ga0075436_100255455 3300006914 Unclassified 1249
147 Ga0097620_100220627 3300006931 Bacteria 1984
148 Ga0075435_100002717 3300007076 Bacteria 11814
149 Ga0075435_100085392 3300007076 Bacteria 2598
150 Ga0075435_100346839 3300007076 Bacteria 1272
151 Ga0111539_10098845 3300009094 Bacteria 3427
152 Ga0105245_10056336 3300009098 Bacteria 3533
153 Ga0105245_10065624 3300009098 Bacteria 3283
154 Ga0105245_10242426 3300009098 Bacteria 1748
155 Ga0105245_10612523 3300009098 Bacteria 1116
156 Ga0114129_10038495 3300009147 Bacteria 6745
157 Ga0114129_10127678 3300009147 Bacteria 3495
158 Ga0114129_10428847 3300009147 Bacteria 1738
159 Ga0114129_10749899 3300009147 Bacteria 1250
160 Ga0114129_11622730 3300009147 Bacteria 791
161 Ga0105243_10033564 3300009148 Bacteria 3969
162 Ga0105243_10725843 3300009148 Bacteria 971
163 Ga0105241_10005346 3300009174 Bacteria 9487
164 Ga0105241_10128295 3300009174 Bacteria 2050
165 Ga0105241_10404595 3300009174 Bacteria 1198
166 Ga0105242_10062813 3300009176 Bacteria 3057
167 Ga0105242_10224326 3300009176 Bacteria 1681
168 Ga0105242_10235384 3300009176 Bacteria 1643
169 Ga0105242_10695564 3300009176 Unclassified 994
170 Ga0105248_10016667 3300009177 Bacteria 8087
171 Ga0105248_10036882 3300009177 Bacteria 5468
172 Ga0105248_10107503 3300009177 Unclassified 3146
173 Ga0105248_10357966 3300009177 Bacteria 1643
174 Ga0105248_11895006 3300009177 Unclassified 677
175 Ga0105237_11044359 3300009545 Unclassified 824
176 Ga0105238_10177380 3300009551 Bacteria 2107
177 Ga0105238_10653646 3300009551 Bacteria 1061
178 Ga0105249_10392952 3300009553 Bacteria 1415
179 Ga0105249_11606619 3300009553 Bacteria 723
180 Ga0105249_12153503 3300009553 Unclassified 630
181 Ga0099796_10035380 3300010159 Bacteria 1656
182 Ga0105239_10011627 3300010375 Bacteria 9821
183 Ga0105239_10085771 3300010375 Bacteria 3471
184 Ga0105239_11515349 3300010375 Unclassified 775
185 Ga0157371_10300641 3300013102 Unclassified 1162
186 Ga0157371_10693707 3300013102 Unclassified 762
187 Ga0157374_10000377 3300013296 Bacteria 41023
188 Ga0157374_10016314 3300013296 Bacteria 6524
189 Ga0157374_10358781 3300013296 Bacteria 1449
190 Ga0157378_10095327 3300013297 Bacteria 2710
191 Ga0157378_10138070 3300013297 Bacteria 2262
192 Ga0157378_10252647 3300013297 Bacteria 1688
193 Ga0157378_11279824 3300013297 Unclassified 774
194 Ga0157378_11380959 3300013297 Bacteria 747
195 Ga0163162_10001545 3300013306 Bacteria 21498
196 Ga0163162_10010209 3300013306 Bacteria 9123
197 Ga0163162_10104064 3300013306 Bacteria 2933
198 Ga0163162_10663243 3300013306 Bacteria 1166
199 Ga0163162_10774869 3300013306 Unclassified 1078
200 Ga0163162_11887329 3300013306 Unclassified 684
201 Ga0157372_10346555 3300013307 Bacteria 1731
202 Ga0157375_10131042 3300013308 Bacteria 2627
203 Ga0157375_12750627 3300013308 Unclassified 588
204 Ga0163163_11459019 3300014325 Unclassified 746
205 Ga0157380_10534719 3300014326 Bacteria 1146
206 Ga0157380_12159399 3300014326 Unclassified 620
207 Ga0157379_10074022 3300014968 Bacteria 3049
208 Ga0157379_10109045 3300014968 Bacteria 2486
209 Ga0157379_10182568 3300014968 Bacteria 1895
210 Ga0157376_10067517 3300014969 Bacteria 3025
211 Ga0157376_10178178 3300014969 Bacteria 1941
212 Ga0163161_10003925 3300017792 Bacteria 10432
213 Ga0213872_10178444 3300021361 Unclassified 918
214 Ga0213872_10204747 3300021361 Bacteria 845
215 Ga0213875_10048613 3300021388 Bacteria 1990
216 Ga0224569_114424 3300022732 Bacteria 552
217 Ga0207642_10049755 3300025899 Bacteria 1886
218 Ga0207642_10281045 3300025899 Bacteria 957
219 Ga0207680_10001385 3300025903 Bacteria 11453
220 Ga0207680_10572327 3300025903 Unclassified 807
221 Ga0207647_10189229 3300025904 Bacteria 1193
222 Ga0207699_10047858 3300025906 Unclassified 2509
223 Ga0207699_10060568 3300025906 Bacteria 2274
224 Ga0207645_10013377 3300025907 Bacteria 5531
225 Ga0207645_10187976 3300025907 Bacteria 1356
226 Ga0207684_10001945 3300025910 Bacteria 21405
227 Ga0207684_10222588 3300025910 Unclassified 1628
228 Ga0207684_10900001 3300025910 Bacteria 744
229 Ga0207684_11547747 3300025910 Unclassified 538
230 Ga0207654_10223122 3300025911 Bacteria 1251
231 Ga0207654_10412841 3300025911 Bacteria 941
232 Ga0207707_10022584 3300025912 Bacteria 5499
233 Ga0207671_10257585 3300025914 Bacteria 1372
234 Ga0207671_10292854 3300025914 Bacteria 1285
235 Ga0207693_10000124 3300025915 Bacteria 69213
236 Ga0207693_10079986 3300025915 Bacteria 2558
237 Ga0207693_10460575 3300025915 Bacteria 993
238 Ga0207663_10043595 3300025916 Bacteria 2748
239 Ga0207663_10055534 3300025916 Bacteria 2485
240 Ga0207663_10091224 3300025916 Unclassified 2022
241 Ga0207663_10296978 3300025916 Bacteria 1205
242 Ga0207662_10002895 3300025918 Bacteria 8701
243 Ga0207649_10165334 3300025920 Bacteria 1536
244 Ga0207652_11147405 3300025921 Unclassified 678
245 Ga0207646_10003115 3300025922 Bacteria 19043
246 Ga0207646_10009119 3300025922 Bacteria 9846
247 Ga0207646_10041964 3300025922 Bacteria 4110
248 Ga0207646_10253483 3300025922 Bacteria 1590
249 Ga0207681_10127345 3300025923 Bacteria 1877
250 Ga0207681_10186892 3300025923 Bacteria 1582
251 Ga0207681_10289088 3300025923 Bacteria 1293
252 Ga0207694_10188519 3300025924 Bacteria 1675
253 Ga0207687_10034284 3300025927 Bacteria 3446
254 Ga0207687_10122018 3300025927 Bacteria 1950
255 Ga0207700_10007287 3300025928 Bacteria 6749
256 Ga0207664_10411310 3300025929 Bacteria 1204
257 Ga0207644_10015295 3300025931 Bacteria 5147
258 Ga0207706_10002401 3300025933 Bacteria 18268
259 Ga0207706_10011251 3300025933 Bacteria 8159
260 Ga0207686_10599046 3300025934 Unclassified 867
261 Ga0207686_11060857 3300025934 Unclassified 659
262 Ga0207709_10124058 3300025935 Bacteria 1749
263 Ga0207669_10339957 3300025937 Unclassified 1156
264 Ga0207704_10080341 3300025938 Bacteria 2105
265 Ga0207704_10880733 3300025938 Unclassified 752
266 Ga0207665_10001677 3300025939 Bacteria 14902
267 Ga0207665_10006349 3300025939 Bacteria 7839
268 Ga0207665_10015541 3300025939 Bacteria 4996
269 Ga0207665_10042759 3300025939 Unclassified 3029
270 Ga0207665_10144972 3300025939 Bacteria 1696
271 Ga0207711_10682365 3300025941 Bacteria 958
272 Ga0207711_11149225 3300025941 Unclassified 717
273 Ga0207689_10001367 3300025942 Bacteria 23390
274 Ga0207689_10210681 3300025942 Bacteria 1606
275 Ga0207661_10012931 3300025944 Bacteria 6088
276 Ga0207679_10084189 3300025945 Bacteria 2440
277 Ga0207679_10172787 3300025945 Bacteria 1781
278 Ga0207667_10079596 3300025949 Bacteria 3396
279 Ga0207667_10134569 3300025949 Bacteria 2545
280 Ga0207712_10480551 3300025961 Unclassified 1059
281 Ga0207668_10688611 3300025972 Unclassified 897
282 Ga0207640_10175842 3300025981 Bacteria 1600
283 Ga0207658_11415222 3300025986 Unclassified 636
284 Ga0207703_10030135 3300026035 Bacteria 4286
285 Ga0207703_10892257 3300026035 Unclassified 851
286 Ga0207639_10217944 3300026041 Bacteria 1647
287 Ga0207639_11360643 3300026041 Unclassified 666
288 Ga0207678_10088375 3300026067 Bacteria 2648
289 Ga0207708_10087432 3300026075 Bacteria 2400
290 Ga0207702_10280177 3300026078 Bacteria 1576
291 Ga0207702_10431438 3300026078 Bacteria 1276
292 Ga0207641_10080777 3300026088 Bacteria 2822
293 Ga0207641_10250859 3300026088 Bacteria 1653
294 Ga0207641_10447223 3300026088 Bacteria 1248
295 Ga0207641_10557045 3300026088 Bacteria 1118
296 Ga0207641_10700618 3300026088 Unclassified 997
297 Ga0207648_10013759 3300026089 Bacteria 7510
298 Ga0207648_10013933 3300026089 Bacteria 7455
299 Ga0207648_10057018 3300026089 Bacteria 3408
300 Ga0207674_10004517 3300026116 Bacteria 16711
301 Ga0207675_100016104 3300026118 Bacteria 6983
302 Ga0207675_100058993 3300026118 Bacteria 3582
303 Ga0207675_100293407 3300026118 Bacteria 1582
304 Ga0207675_100750929 3300026118 Unclassified 987
305 Ga0207675_102303598 3300026118 Unclassified 552
306 Ga0207683_10007606 3300026121 Bacteria 9281
307 Ga0207683_10116177 3300026121 Bacteria 2399
308 Ga0207428_10042309 3300027907 Bacteria 3684
309 Ga0207428_10450273 3300027907 Bacteria 939
310 Ga0268266_10001863 3300028379 Bacteria 23829
311 Ga0268265_10364961 3300028380 Unclassified 1323
312 Ga0268264_10109600 3300028381 Bacteria 2416
313 Ga0268264_10163536 3300028381 Bacteria 2007
314 Ga0268264_10656643 3300028381 Unclassified 1038
315 Ga0268264_10956037 3300028381 Bacteria 862
316 Ga0265337_1005118 3300028556 Bacteria 5276
317 Ga0265336_10173352 3300028666 Unclassified 641
318 Ga0265338_10481903 3300028800 Bacteria 875
319 Ga0265320_10000566 3300031240 Bacteria 28582
320 Ga0373938_0031388 3300034957 Bacteria 1139
321 Ga0373954_0169551 3300035118 Unclassified 1069
322 Ga0373931_0307888 3300035691 Bacteria 980
323 Ga0373927_0404176 3300035695 Bacteria 901
324 Ga0373927_0625606 3300035695 Bacteria 712
325 Ga0373947_0148624 3300035725 Bacteria 1508
326 Ga0373947_0203528 3300035725 Bacteria 1296
327 Ga0316582_0654955 3300036647 Bacteria 722
328 Ga0373925_0042100 3300037068 Bacteria 3388
329 Ga0373925_0217581 3300037068 Unclassified 1524
330 Ga0395900_0227648 3300037418 Bacteria 1877
331 Ga0395900_0888325 3300037418 Bacteria 815
332 Ga0395898_0702278 3300037466 Bacteria 953
333 Ga0395898_1165701 3300037466 Bacteria 702
334 Ga0395898_1471053 3300037466 Unclassified 608
335 Ga0395905_0038392 3300037471 Bacteria 4494
336 Ga0395905_0079656 3300037471 Bacteria 3071
337 Ga0395905_0147061 3300037471 Bacteria 2217
338 Ga0395905_0155463 3300037471 Bacteria 2151
339 Ga0395905_1035144 3300037471 Bacteria 724
340 Ga0436364_0897119 3300037853 Bacteria 4903
341 Ga0395901_1059919 3300038443 Unclassified 783
342 Ga0395901_1338498 3300038443 Unclassified 677
343 Ga0436365_0197260 3300039437 Bacteria 27939
344 Ga0436360_0142918 3300039438 Bacteria 2666
345 Ga0436361_0008440 3300039447 Bacteria 5180
346 Ga0436361_0205323 3300039447 Unclassified 1489
347 Ga0436361_0704747 3300039447 Unclassified 1387
348 Ga0436361_0890240 3300039447 Bacteria 1472
349 Ga0436363_0139442 3300039450 Bacteria 1319
350 Ga0436363_0333474 3300039450 Bacteria 1228
351 Ga0436363_0531043 3300039450 Unclassified 1021
352 Ga0436362_0774554 3300039453 Bacteria 989
353 Ga0439455_0094101 3300042012 Bacteria 824
354 Ga0439460_0082915 3300042461 Bacteria 1009
355 Ga0451577_0036129 3300042876 Bacteria 4449
356 Ga0451577_0138762 3300042876 Bacteria 2184
357 Ga0453683_0003011 3300044673 Bacteria 12616
358 Ga0453684_0034236 3300044712 Bacteria 7056
359 Ga0453684_0323151 3300044712 Bacteria 1747
360 Ga0451576_0019885 3300045051 Bacteria 7323
361 Ga0495629_0439701 3300046459 Bacteria 884
362 Ga0495653_0562202 3300046463 Bacteria 705
363 Ga0495580_0364433 3300046472 Bacteria 978
364 Ga0495608_0012034 3300046511 Bacteria 6016
365 Ga0495618_0003435 3300046514 Bacteria 9850
366 Ga0495628_0245463 3300046516 Unclassified 1338
367 Ga0495630_0021228 3300046517 Bacteria 4795
368 Ga0495652_0010360 3300046529 Bacteria 8447
369 Ga0495640_0185072 3300046533 Bacteria 1326
370 Ga0495586_0028430 3300046535 Bacteria 2992
371 Ga0495587_0053707 3300046536 Bacteria 2375
372 Ga0495587_0773909 3300046536 Unclassified 525
373 Ga0495645_0000454 3300046543 Bacteria 28172
374 Ga0495645_0576456 3300046543 Bacteria 695
375 Ga0495667_0149074 3300046559 Bacteria 1506
376 Ga0495634_0018033 3300046642 Bacteria 5030
377 Ga0495635_0056724 3300046663 Bacteria 2696
378 Ga0495599_0147259 3300046678 Unclassified 1459
379 Ga0495646_0022599 3300046680 Bacteria 3966
380 Ga0495647_0047342 3300046681 Bacteria 1659
381 Ga0495658_0409776 3300046683 Bacteria 864
382 Ga0495613_0010278 3300046689 Bacteria 6952
383 Ga0495624_0075577 3300046690 Bacteria 2092
384 Ga0495670_0038933 3300046691 Bacteria 2371
385 Ga0495600_0221116 3300046809 Bacteria 1211
386 Ga0495581_0459844 3300047315 Unclassified 741
387 Ga0495674_0038443 3300047319 Bacteria 4295
388 Ga0495674_0310015 3300047319 Bacteria 1288
389 Ga0495676_0931995 3300047321 Unclassified 556
390 Ga0495680_0024622 3300047322 Bacteria 4992
391 Ga0495680_0797620 3300047322 Bacteria 617
392 Ga0495675_0012257 3300047444 Bacteria 5395
393 Ga0495675_0176061 3300047444 Unclassified 1312
394 Ga0495684_0000635 3300047471 Bacteria 28267
395 Ga0495602_0013807 3300048088 Bacteria 8236
396 Ga0495602_0376094 3300048088 Bacteria 1019
397 Ga0496100_0093366 3300048903 Unclassified 2059
398 Ga0496101_0436426 3300048904 Bacteria 1033
399 Ga0496102_0004151 3300048905 Bacteria 12273
400 Ga0496102_0629925 3300048905 Bacteria 996
401 Ga0496103_0060343 3300048906 Bacteria 2357
402 Ga0496103_0306357 3300048906 Bacteria 1022
403 Ga0496104_0028538 3300048907 Bacteria 5172
404 Ga0496104_0124897 3300048907 Bacteria 2471
405 Ga0496106_0737840 3300048909 Unclassified 783
406 Ga0496107_0082071 3300048910 Bacteria 2351
407 Ga0496107_0241292 3300048910 Bacteria 1345
408 Ga0496107_0296836 3300048910 Bacteria 1203
409 Ga0496112_0055928 3300048915 Bacteria 3882
410 Ga0496112_0125100 3300048915 Bacteria 2542
411 Ga0496112_0290841 3300048915 Unclassified 1580
412 Ga0496112_0342648 3300048915 Bacteria 1438
413 Ga0496113_0125774 3300048916 Bacteria 2008
414 Ga0496113_1371378 3300048916 Unclassified 548
415 Ga0501034_0244960 3300049571 Bacteria 1738
416 Ga0501037_0022688 3300049573 Bacteria 4640
417 Ga0501040_0131418 3300049576 Bacteria 1761
418 Ga0501041_0043065 3300049577 Bacteria 2744
419 Ga0501041_0174857 3300049577 Bacteria 1344
420 Ga0501042_0249548 3300049578 Bacteria 1280
421 Ga0501043_0137630 3300049579 Bacteria 1913
422 Ga0501072_0363772 3300049588 Unclassified 1148
423 Ga0501073_0140096 3300049589 Bacteria 1676
424 Ga0501075_0574354 3300049591 Bacteria 860
425 Ga0501076_0256988 3300049592 Bacteria 1430
426 Ga0501079_0237568 3300049741 Bacteria 1424
427 Ga0501079_0282117 3300049741 Bacteria 1299
428 Ga0501035_0064996 3300049822 Bacteria 3241
429 Ga0501035_0677470 3300049822 Bacteria 834
430 Ga0501045_0080697 3300049824 Bacteria 2399
431 nmdc:mga05p37_1168375_c1 3300050507 Unclassified 799
432 nmdc:mga05p37_450266_c1 3300050507 Bacteria 1490
433 nmdc:mga05p37_5636_c1 3300050507 Bacteria 14719
434 nmdc:mga05p37_702169_c1 3300050507 Unclassified 1123
435 nmdc:mga08y16_402394_c1 3300050511 Bacteria 1401
436 nmdc:mga0n895_101298_c1 3300050512 Bacteria 2890
437 nmdc:mga0n895_1083_c1 3300050512 Bacteria 19897
438 nmdc:mga0n895_112759_c1 3300050512 Bacteria 2736
439 nmdc:mga0n895_1445519_c1 3300050512 Bacteria 655
440 nmdc:mga0n895_21782_c1 3300050512 Bacteria 5999
441 nmdc:mga0rr50_19936_c1 3300050513 Bacteria 4540
442 nmdc:mga0rr50_23174_c1 3300050513 Bacteria 4275
443 nmdc:mga0rr50_464870_c1 3300050513 Bacteria 1073
444 nmdc:mga08x19_17553_c1 3300050514 Bacteria 4380
445 nmdc:mga08x19_28278_c1 3300050514 Bacteria 3511
446 nmdc:mga08x19_484309_c1 3300050514 Bacteria 872
447 nmdc:mga0a205_1094376_c1 3300050515 Unclassified 644
448 nmdc:mga0a205_18702_c1 3300050515 Bacteria 6520
449 nmdc:mga0a205_6176_c1 3300050515 Bacteria 10809
450 Ga0501082_1307218 3300060353 Unclassified 633
451 Ga0207671_10384643
452 Ga0065715_10106546
453 Ga0065715_10166791
454 Ga0065715_10632172
455 Ga0065707_10015971
456 Ga0065707_10347906
457 Ga0070676_10041866
458 Ga0070683_100039824
459 Ga0070690_100033878
460 Ga0068869_100006864
461 Ga0068869_100123206
462 Ga0070666_10001715
463 Ga0070666_10591432
464 Ga0070680_100618153
465 Ga0070682_100389553
466 Ga0068868_100008872
467 Ga0070660_100028197
468 Ga0070687_100170545
469 Ga0070668_100220091
470 Ga0070669_100023750
471 Ga0070669_101544751
472 Ga0070675_100236178
473 Ga0070671_100003755
474 Ga0070674_100368152
475 Ga0070673_100245584
476 Ga0070673_100500486
477 Ga0070659_100113469
478 Ga0070667_100004703
479 Ga0070667_100539678
480 Ga0070709_10010814
481 Ga0070709_10021636
482 Ga0070709_10047885
483 Ga0070709_11206972
484 Ga0070714_100161808
485 Ga0070714_100293323
486 Ga0070713_100001526
487 Ga0070713_100533146
488 Ga0070713_100550048
489 Ga0070713_100662443
490 Ga0070710_11422605
491 Ga0070701_10029136
492 Ga0070711_100027812
493 Ga0070711_100143925
494 Ga0070711_100165485
495 Ga0070711_100724290
496 Ga0070711_101167462
497 Ga0070705_100055548
498 Ga0070705_100307024
499 Ga0070700_100365841
500 Ga0070694_100000274
501 Ga0070708_100000460
502 Ga0070708_100011652
503 Ga0070678_100007607
504 Ga0070678_100106091
505 Ga0070662_100051507
506 Ga0070662_100962832
507 Ga0070681_10037936
508 Ga0070681_10208626
509 Ga0068867_100011563
510 Ga0068867_100587487
511 Ga0070706_100058150
512 Ga0070706_100067456
513 Ga0070706_100799857
514 Ga0070707_100008282
515 Ga0070707_100021828
516 Ga0070707_100026419
517 Ga0070707_100206770
518 Ga0070698_100002476
519 Ga0070698_100475316
520 Ga0070699_100000738
521 Ga0070699_100028933
522 Ga0070699_100104232
523 Ga0070679_100032040
524 Ga0070684_100225020
525 Ga0070697_100081515
526 Ga0068853_100370865
527 Ga0068853_100954443
528 Ga0070672_101280690
529 Ga0070686_100060182
530 Ga0070686_100272257
531 Ga0070686_100916403
532 Ga0070695_100055650
533 Ga0070695_100062695
534 Ga0070695_100067486
535 Ga0070695_100242445
536 Ga0070696_100179830
537 Ga0070693_100024503
538 Ga0070693_100592163
539 Ga0070665_101521467
540 Ga0070704_100046421
541 Ga0070704_100176924
542 Ga0068855_100321513
543 Ga0068855_100942747
544 Ga0070664_100118891
545 Ga0070664_100228315
546 Ga0068857_100002970
547 Ga0068854_100212769
548 Ga0068856_100039123
549 Ga0068856_100440799
550 Ga0068856_102022221
551 Ga0070702_100420185
552 Ga0068859_100220624
553 Ga0068866_10002078
554 Ga0068861_100064426
555 Ga0068861_102437905
556 Ga0068863_100209583
557 Ga0068863_100303054
558 Ga0068863_100595298
559 Ga0068858_100022629
560 Ga0068858_100050888
561 Ga0068858_100224168
562 Ga0068860_100018177
563 Ga0068860_100048112
564 Ga0068860_100098532
565 Ga0068862_100058468
566 Ga0068862_100367938
567 Ga0070717_11516831
568 Ga0070715_10002149
569 Ga0070716_100001260
570 Ga0070716_100068889
571 Ga0070716_100155807
572 Ga0070716_100392254
573 Ga0070712_100000101
574 Ga0070712_100629087
575 Ga0070712_101245128
576 Ga0097621_100093154
577 Ga0097621_100561100
578 Ga0097621_100734479
579 Ga0097621_101656228
580 Ga0068871_100011641
581 Ga0068871_100306238
582 Ga0068871_100407400
583 Ga0068871_100862836
584 Ga0075428_100269570
585 Ga0075433_10002499
586 Ga0075433_10509491
587 Ga0075434_100001045
588 Ga0075434_100111228
589 Ga0075434_101177993
590 Ga0075434_101228024
591 Ga0075429_100055711
592 Ga0068865_100009086
593 Ga0068865_100092055
594 Ga0068865_101141826
595 Ga0075436_100021131
596 Ga0075436_100255455
597 Ga0097620_100220627
598 Ga0075435_100002717
599 Ga0075435_100085392
600 Ga0075435_100346839
601 Ga0111539_10098845
602 Ga0105245_10056336
603 Ga0105245_10065624
604 Ga0105245_10242426
605 Ga0105245_10612523
606 Ga0114129_10038495
607 Ga0114129_10127678
608 Ga0114129_10428847
609 Ga0114129_10749899
610 Ga0114129_11622730
611 Ga0105243_10033564
612 Ga0105243_10725843
613 Ga0105241_10005346
614 Ga0105241_10128295
615 Ga0105241_10404595
616 Ga0105242_10062813
617 Ga0105242_10224326
618 Ga0105242_10235384
619 Ga0105242_10695564
620 Ga0105248_10016667
621 Ga0105248_10036882
622 Ga0105248_10107503
623 Ga0105248_10357966
624 Ga0105248_11895006
625 Ga0105237_11044359
626 Ga0105238_10177380
627 Ga0105238_10653646
628 Ga0105249_10392952
629 Ga0105249_11606619
630 Ga0105249_12153503
631 Ga0099796_10035380
632 Ga0105239_10011627
633 Ga0105239_10085771
634 Ga0105239_11515349
635 Ga0157371_10300641
636 Ga0157371_10693707
637 Ga0157374_10000377
638 Ga0157374_10016314
639 Ga0157374_10358781
640 Ga0157378_10095327
641 Ga0157378_10138070
642 Ga0157378_10252647
643 Ga0157378_11279824
644 Ga0157378_11380959
645 Ga0163162_10001545
646 Ga0163162_10010209
647 Ga0163162_10104064
648 Ga0163162_10663243
649 Ga0163162_10774869
650 Ga0163162_11887329
651 Ga0157372_10346555
652 Ga0157375_10131042
653 Ga0157375_12750627
654 Ga0163163_11459019
655 Ga0157380_10534719
656 Ga0157380_12159399
657 Ga0157379_10074022
658 Ga0157379_10109045
659 Ga0157379_10182568
660 Ga0157376_10067517
661 Ga0157376_10178178
662 Ga0163161_10003925
663 Ga0213872_10178444
664 Ga0213872_10204747
665 Ga0213875_10048613
666 Ga0224569_114424
667 Ga0207642_10049755
668 Ga0207642_10281045
669 Ga0207680_10001385
670 Ga0207680_10572327
671 Ga0207647_10189229
672 Ga0207699_10047858
673 Ga0207699_10060568
674 Ga0207645_10013377
675 Ga0207645_10187976
676 Ga0207684_10001945
677 Ga0207684_10222588
678 Ga0207684_10900001
679 Ga0207684_11547747
680 Ga0207654_10223122
681 Ga0207654_10412841
682 Ga0207707_10022584
683 Ga0207671_10257585
684 Ga0207671_10292854
685 Ga0207693_10000124
686 Ga0207693_10079986
687 Ga0207693_10460575
688 Ga0207663_10043595
689 Ga0207663_10055534
690 Ga0207663_10091224
691 Ga0207663_10296978
692 Ga0207662_10002895
693 Ga0207649_10165334
694 Ga0207652_11147405
695 Ga0207646_10003115
696 Ga0207646_10009119
697 Ga0207646_10041964
698 Ga0207646_10253483
699 Ga0207681_10127345
700 Ga0207681_10186892
701 Ga0207681_10289088
702 Ga0207694_10188519
703 Ga0207687_10034284
704 Ga0207687_10122018
705 Ga0207700_10007287
706 Ga0207664_10411310
707 Ga0207644_10015295
708 Ga0207706_10002401
709 Ga0207706_10011251
710 Ga0207686_10599046
711 Ga0207686_11060857
712 Ga0207709_10124058
713 Ga0207669_10339957
714 Ga0207704_10080341
715 Ga0207704_10880733
716 Ga0207665_10001677
717 Ga0207665_10006349
718 Ga0207665_10015541
719 Ga0207665_10042759
720 Ga0207665_10144972
721 Ga0207711_10682365
722 Ga0207711_11149225
723 Ga0207689_10001367
724 Ga0207689_10210681
725 Ga0207661_10012931
726 Ga0207679_10084189
727 Ga0207679_10172787
728 Ga0207667_10079596
729 Ga0207667_10134569
730 Ga0207712_10480551
731 Ga0207668_10688611
732 Ga0207640_10175842
733 Ga0207658_11415222
734 Ga0207703_10030135
735 Ga0207703_10892257
736 Ga0207639_10217944
737 Ga0207639_11360643
738 Ga0207678_10088375
739 Ga0207708_10087432
740 Ga0207702_10280177
741 Ga0207702_10431438
742 Ga0207641_10080777
743 Ga0207641_10250859
744 Ga0207641_10447223
745 Ga0207641_10557045
746 Ga0207641_10700618
747 Ga0207648_10013759
748 Ga0207648_10013933
749 Ga0207648_10057018
750 Ga0207674_10004517
751 Ga0207675_100016104
752 Ga0207675_100058993
753 Ga0207675_100293407
754 Ga0207675_100750929
755 Ga0207675_102303598
756 Ga0207683_10007606
757 Ga0207683_10116177
758 Ga0207428_10042309
759 Ga0207428_10450273
760 Ga0268266_10001863
761 Ga0268265_10364961
762 Ga0268264_10109600
763 Ga0268264_10163536
764 Ga0268264_10656643
765 Ga0268264_10956037
766 Ga0265337_1005118
767 Ga0265336_10173352
768 Ga0265338_10481903
769 Ga0265320_10000566
770 Ga0373938_0031388
771 Ga0373954_0169551
772 Ga0373931_0307888
773 Ga0373927_0404176
774 Ga0373927_0625606
775 Ga0373947_0148624
776 Ga0373947_0203528
777 Ga0316582_0654955
778 Ga0373925_0042100
779 Ga0373925_0217581
780 Ga0395900_0227648
781 Ga0395900_0888325
782 Ga0395898_0702278
783 Ga0395898_1165701
784 Ga0395898_1471053
785 Ga0395905_0038392
786 Ga0395905_0079656
787 Ga0395905_0147061
788 Ga0395905_0155463
789 Ga0395905_1035144
790 Ga0436364_0897119
791 Ga0395901_1059919
792 Ga0395901_1338498
793 Ga0436365_0197260
794 Ga0436360_0142918
795 Ga0436361_0008440
796 Ga0436361_0205323
797 Ga0436361_0704747
798 Ga0436361_0890240
799 Ga0436363_0139442
800 Ga0436363_0333474
801 Ga0436363_0531043
802 Ga0436362_0774554
803 Ga0439455_0094101
804 Ga0439460_0082915
805 Ga0451577_0036129
806 Ga0451577_0138762
807 Ga0453683_0003011
808 Ga0453684_0034236
809 Ga0453684_0323151
810 Ga0451576_0019885
811 Ga0495629_0439701
812 Ga0495653_0562202
813 Ga0495580_0364433
814 Ga0495608_0012034
815 Ga0495618_0003435
816 Ga0495628_0245463
817 Ga0495630_0021228
818 Ga0495652_0010360
819 Ga0495640_0185072
820 Ga0495586_0028430
821 Ga0495587_0053707
822 Ga0495587_0773909
823 Ga0495645_0000454
824 Ga0495645_0576456
825 Ga0495667_0149074
826 Ga0495634_0018033
827 Ga0495635_0056724
828 Ga0495599_0147259
829 Ga0495646_0022599
830 Ga0495647_0047342
831 Ga0495658_0409776
832 Ga0495613_0010278
833 Ga0495624_0075577
834 Ga0495670_0038933
835 Ga0495600_0221116
836 Ga0495581_0459844
837 Ga0495674_0038443
838 Ga0495674_0310015
839 Ga0495676_0931995
840 Ga0495680_0024622
841 Ga0495680_0797620
842 Ga0495675_0012257
843 Ga0495675_0176061
844 Ga0495684_0000635
845 Ga0495602_0013807
846 Ga0495602_0376094
847 Ga0496100_0093366
848 Ga0496101_0436426
849 Ga0496102_0004151
850 Ga0496102_0629925
851 Ga0496103_0060343
852 Ga0496103_0306357
853 Ga0496104_0028538
854 Ga0496104_0124897
855 Ga0496106_0737840
856 Ga0496107_0082071
857 Ga0496107_0241292
858 Ga0496107_0296836
859 Ga0496112_0055928
860 Ga0496112_0125100
861 Ga0496112_0290841
862 Ga0496112_0342648
863 Ga0496113_0125774
864 Ga0496113_1371378
865 Ga0501034_0244960
866 Ga0501037_0022688
867 Ga0501040_0131418
868 Ga0501041_0043065
869 Ga0501041_0174857
870 Ga0501042_0249548
871 Ga0501043_0137630
872 Ga0501072_0363772
873 Ga0501073_0140096
874 Ga0501075_0574354
875 Ga0501076_0256988
876 Ga0501079_0237568
877 Ga0501079_0282117
878 Ga0501035_0064996
879 Ga0501035_0677470
880 Ga0501045_0080697
881 nmdc:mga05p37_1168375_c1
882 nmdc:mga05p37_450266_c1
883 nmdc:mga05p37_5636_c1
884 nmdc:mga05p37_702169_c1
885 nmdc:mga08y16_402394_c1
886 nmdc:mga0n895_101298_c1
887 nmdc:mga0n895_1083_c1
888 nmdc:mga0n895_112759_c1
889 nmdc:mga0n895_1445519_c1
890 nmdc:mga0n895_21782_c1
891 nmdc:mga0rr50_19936_c1
892 nmdc:mga0rr50_23174_c1
893 nmdc:mga0rr50_464870_c1
894 nmdc:mga08x19_17553_c1
895 nmdc:mga08x19_28278_c1
896 nmdc:mga08x19_484309_c1
897 nmdc:mga0a205_1094376_c1
898 nmdc:mga0a205_18702_c1
899 nmdc:mga0a205_6176_c1
900 Ga0501082_1307218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

32

162

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9655 1 142
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9616 2 146
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.961 2 142
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.96 2 147
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9593 1 147
ID Description Score Start End Superfamily
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9655 1 142 3.40.1400.10
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9605 2 147 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9545 2 142 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9543 1 130 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9504 1 129 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A7V7VPN7-F1-model_v4 6-phosphogluconolactonase (EC 3.1.1.31) 0.9946 2 142 GO:0005975
GO:0006098
GO:0016861
GO:0017057
AF-A0A518D8V1-F1-model_v4 6-phosphogluconolactonase (EC 3.1.1.31) 0.9885 1 146 GO:0005975
GO:0006098
GO:0016861
GO:0017057
AF-A0A5C6D3P3-F1-model_v4 Putative sugar phosphate isomerase YwlF (EC 5.3.1.-) 0.988 2 146 GO:0005975
GO:0016861
AF-A0A1G3ZJR7-F1-model_v4 Ribose-5-phosphate isomerase 0.987 1 146 GO:0005975
GO:0016861
AF-A0A3A4VMN2-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9863 1 138 GO:0004751
GO:0005975

Map