F446629

General Info

Members Datasets Scaffolds Average Seq Length
450 248 900 259

Family's Representative Sequence

Representative Sequence 3300035171|Ga0373946_0060297|Ga0373946_0060297_667_1548
Length 293
Sequence MAGRTDTQAAPKVTLWTNPAAPRPFRLWRGEGCGKGLKMSGHAAAIFRHPIKGFTPEALTSVRLAPGEGFPHDRIWAVENGPSGFDPAHPAFVPKQKFTVLALIAQVARIATRYDAATGVLRASAPGADDLLADLMQEAGRDAFAAWLTEQLGEDVRGTLKVVAAPGQHRFTDHPQGQVSIINLASVADLGRRMGAELDPRRFRANVYVEGWPAWAENQWTGQRLMLGSAQAQVFKSIVRCAATHVDPATAERDLDVTKALFDNFGHMFCGVYAQVTKPGALSLGDAVTRAPA

Samples

Sample ID Description Type Environment
1 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
201 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
206 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
215 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
223 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
228 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
229 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
230 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
231 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
232 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
233 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
234 2643221583 Caulobacter sp. Root655 Isolate Unclassified
235 2643221584 Caulobacter sp. Root656 Isolate Unclassified
236 2643221640 Caulobacter sp. Root342 Isolate Unclassified
237 2643221642 Caulobacter sp. Root343 Isolate Unclassified
238 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
239 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
240 2818991435 Caulobacter henricii 536 Isolate Unclassified
241 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
242 2849560528 Caulobacter zeae 410 Isolate Unclassified
243 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
244 2851153111 Caulobacter radicis 736 Isolate Unclassified
245 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
246 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
247 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
248 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0
Isolates 4.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22
Nodule 0
Rhizoplane 2.89
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373946_0060297 3300035171 Bacteria 1612
2 rootL2_10140596 3300003322 Bacteria 1320
3 Ga0055537_1001546 3300003773 Bacteria 8804
4 Ga0055536_1000911 3300003781 Bacteria 19115
5 Ga0055536_1001435 3300003781 Bacteria 14368
6 Ga0055530_10001800 3300003791 Bacteria 14862
7 Ga0055530_10007239 3300003791 Bacteria 4723
8 Ga0055530_10008847 3300003791 Bacteria 3963
9 Ga0055531_10001288 3300003794 Bacteria 18893
10 Ga0055531_10003395 3300003794 Bacteria 10179
11 Ga0055531_10009045 3300003794 Bacteria 5146
12 Ga0065165_1000413 3300005262 Bacteria 67911
13 Ga0065165_1000731 3300005262 Bacteria 45776
14 Ga0065165_1051739 3300005262 Bacteria 1163
15 Ga0070658_10301601 3300005327 Bacteria 1366
16 Ga0070670_100000020 3300005331 Bacteria 215458
17 Ga0070670_100016359 3300005331 Bacteria 6370
18 Ga0070670_100123994 3300005331 Bacteria 2229
19 Ga0070680_100023268 3300005336 Bacteria 4940
20 Ga0070680_100297814 3300005336 Bacteria 1367
21 Ga0068868_100102934 3300005338 Bacteria 2313
22 Ga0070668_100000108 3300005347 Bacteria 50828
23 Ga0070668_100001618 3300005347 Bacteria 16282
24 Ga0070668_100004507 3300005347 Bacteria 10328
25 Ga0070669_100008310 3300005353 Bacteria 7412
26 Ga0070669_100440131 3300005353 Unclassified 1073
27 Ga0070671_100022027 3300005355 Bacteria 5205
28 Ga0070671_100046265 3300005355 Bacteria 3618
29 Ga0070671_100065165 3300005355 Bacteria 3034
30 Ga0070659_100002556 3300005366 Bacteria 12935
31 Ga0070659_100031441 3300005366 Bacteria 4111
32 Ga0070667_100000163 3300005367 Bacteria 83059
33 Ga0070667_100004064 3300005367 Bacteria 12375
34 Ga0070667_100015105 3300005367 Bacteria 6378
35 Ga0070667_100138431 3300005367 Bacteria 2130
36 Ga0070667_100194123 3300005367 Bacteria 1800
37 Ga0070663_100101532 3300005455 Bacteria 2147
38 Ga0070678_100533362 3300005456 Bacteria 1040
39 Ga0070681_10022275 3300005458 Bacteria 6360
40 Ga0070679_100883726 3300005530 Bacteria 837
41 Ga0068853_100157667 3300005539 Unclassified 2046
42 Ga0068853_100226859 3300005539 Bacteria 1708
43 Ga0070665_100000015 3300005548 Bacteria 462744
44 Ga0070665_100000441 3300005548 Bacteria 60634
45 Ga0070665_100032944 3300005548 Bacteria 5212
46 Ga0068855_100070276 3300005563 Bacteria 4074
47 Ga0068855_100288579 3300005563 Bacteria 1820
48 Ga0068856_100183225 3300005614 Bacteria 2108
49 Ga0068852_100038996 3300005616 Bacteria 3996
50 Ga0068859_100000671 3300005617 Bacteria 34266
51 Ga0068859_100009336 3300005617 Bacteria 9902
52 Ga0068859_100107525 3300005617 Bacteria 2850
53 Ga0068859_100360275 3300005617 Bacteria 1549
54 Ga0068864_100000071 3300005618 Bacteria 111481
55 Ga0068864_100008464 3300005618 Bacteria 8490
56 Ga0068864_100031006 3300005618 Bacteria 4534
57 Ga0068861_100122735 3300005719 Bacteria 2098
58 Ga0068861_100408969 3300005719 Bacteria 1206
59 Ga0068851_10195253 3300005834 Bacteria 1127
60 Ga0068863_100000037 3300005841 Bacteria 162638
61 Ga0068863_100000451 3300005841 Bacteria 41841
62 Ga0068863_100021083 3300005841 Bacteria 6224
63 Ga0068863_100064681 3300005841 Bacteria 3459
64 Ga0068858_100000029 3300005842 Bacteria 144691
65 Ga0068858_100002275 3300005842 Bacteria 19425
66 Ga0068858_100006867 3300005842 Bacteria 11061
67 Ga0068858_100422474 3300005842 Bacteria 1282
68 Ga0068860_100001003 3300005843 Bacteria 31241
69 Ga0068860_100002441 3300005843 Bacteria 19525
70 Ga0068860_100009413 3300005843 Bacteria 9710
71 Ga0068860_100247428 3300005843 Bacteria 1735
72 Ga0068862_100000057 3300005844 Bacteria 140795
73 Ga0068862_100030882 3300005844 Bacteria 4517
74 Ga0068862_100091482 3300005844 Bacteria 2650
75 Ga0070717_10017847 3300006028 Bacteria 5532
76 Ga0070717_10111695 3300006028 Bacteria 2332
77 Ga0075368_10006829 3300006042 Bacteria 4009
78 Ga0075364_10009664 3300006051 Bacteria 5795
79 Ga0070712_100587260 3300006175 Bacteria 942
80 Ga0075367_10006951 3300006178 Bacteria 5762
81 Ga0075366_10009937 3300006195 Bacteria 5327
82 Ga0075366_10082445 3300006195 Bacteria 1921
83 Ga0075370_10050624 3300006353 Bacteria 2356
84 Ga0068865_100082273 3300006881 Bacteria 2314
85 Ga0068865_100304506 3300006881 Bacteria 1277
86 Ga0097620_100000671 3300006931 Bacteria 34266
87 Ga0097620_100009336 3300006931 Bacteria 9902
88 Ga0097620_100107524 3300006931 Bacteria 2850
89 Ga0097620_100360309 3300006931 Bacteria 1549
90 Ga0105240_10001340 3300009093 Bacteria 42221
91 Ga0105240_10010073 3300009093 Bacteria 13307
92 Ga0105240_10056843 3300009093 Bacteria 4894
93 Ga0105240_10121559 3300009093 Bacteria 3143
94 Ga0105240_10131977 3300009093 Bacteria 2995
95 Ga0105240_10183351 3300009093 Bacteria 2469
96 Ga0105240_10192658 3300009093 Bacteria 2396
97 Ga0105240_10593350 3300009093 Bacteria 1220
98 Ga0105247_10108879 3300009101 Bacteria 1781
99 Ga0105241_10439633 3300009174 Bacteria 1152
100 Ga0105248_10001636 3300009177 Bacteria 24907
101 Ga0105248_10003631 3300009177 Bacteria 17121
102 Ga0105248_10009715 3300009177 Bacteria 10596
103 Ga0105248_10010680 3300009177 Bacteria 10131
104 Ga0105248_10128381 3300009177 Bacteria 2860
105 Ga0105248_10239489 3300009177 Bacteria 2042
106 Ga0105237_10265465 3300009545 Bacteria 1719
107 Ga0105238_10002006 3300009551 Bacteria 20530
108 Ga0105238_10012701 3300009551 Bacteria 8500
109 Ga0105238_10032595 3300009551 Bacteria 5302
110 Ga0105249_10000792 3300009553 Bacteria 28363
111 Ga0105239_10252943 3300010375 Bacteria 1979
112 Ga0105239_10293309 3300010375 Bacteria 1831
113 Ga0157370_10367339 3300013104 Bacteria 1326
114 Ga0163162_10097670 3300013306 Bacteria 3026
115 Ga0157372_10015498 3300013307 Bacteria 8172
116 Ga0163163_10002745 3300014325 Bacteria 14860
117 Ga0163163_10060815 3300014325 Bacteria 3741
118 Ga0163163_10088102 3300014325 Bacteria 3115
119 Ga0163163_10187454 3300014325 Bacteria 2116
120 Ga0163163_10283556 3300014325 Bacteria 1708
121 Ga0157379_10000579 3300014968 Bacteria 29639
122 Ga0157379_10066106 3300014968 Bacteria 3232
123 Ga0157379_10220033 3300014968 Bacteria 1720
124 Ga0157379_10269652 3300014968 Bacteria 1548
125 Ga0213876_10020698 3300021384 Bacteria 3478
126 Ga0213875_10000182 3300021388 Bacteria 64147
127 Ga0209026_1000474 3300025250 Bacteria 30684
128 Ga0209673_1000979 3300025273 Bacteria 35212
129 Ga0209676_1000289 3300025292 Bacteria 103078
130 Ga0209676_1000799 3300025292 Bacteria 41601
131 Ga0209564_1008743 3300025295 Bacteria 4938
132 Ga0209564_1024742 3300025295 Bacteria 2044
133 Ga0209758_1003978 3300025297 Bacteria 12794
134 Ga0209758_1004642 3300025297 Bacteria 11249
135 Ga0209050_1000029 3300025298 Bacteria 465801
136 Ga0209050_1000724 3300025298 Bacteria 48231
137 Ga0209050_1001015 3300025298 Bacteria 35056
138 Ga0209050_1022828 3300025298 Bacteria 2227
139 Ga0209256_1004199 3300025299 Bacteria 9263
140 Ga0209256_1005763 3300025299 Bacteria 6919
141 Ga0209256_1011476 3300025299 Bacteria 3536
142 Ga0209051_1015403 3300025303 Bacteria 3517
143 Ga0209257_1000036 3300025304 Bacteria 616006
144 Ga0209257_1000152 3300025304 Bacteria 189432
145 Ga0209257_1000660 3300025304 Bacteria 54233
146 Ga0209257_1000903 3300025304 Bacteria 41596
147 Ga0209257_1007400 3300025304 Bacteria 6640
148 Ga0207699_10050355 3300025906 Bacteria 2456
149 Ga0207705_10032288 3300025909 Bacteria 3740
150 Ga0207705_10077770 3300025909 Bacteria 2414
151 Ga0207707_10073062 3300025912 Bacteria 2990
152 Ga0207707_10120574 3300025912 Bacteria 2293
153 Ga0207707_10123541 3300025912 Bacteria 2263
154 Ga0207695_10003819 3300025913 Bacteria 20878
155 Ga0207695_10008153 3300025913 Bacteria 13172
156 Ga0207695_10009530 3300025913 Bacteria 12008
157 Ga0207695_10100087 3300025913 Bacteria 2895
158 Ga0207660_10064231 3300025917 Bacteria 2649
159 Ga0207660_10100216 3300025917 Bacteria 2163
160 Ga0207657_10042708 3300025919 Bacteria 3998
161 Ga0207681_10142510 3300025923 Bacteria 1786
162 Ga0207694_10072099 3300025924 Bacteria 2700
163 Ga0207694_10096463 3300025924 Bacteria 2338
164 Ga0207694_10180483 3300025924 Bacteria 1712
165 Ga0207650_10000175 3300025925 Bacteria 75521
166 Ga0207650_10037016 3300025925 Bacteria 3553
167 Ga0207650_10068515 3300025925 Bacteria 2665
168 Ga0207664_10071807 3300025929 Bacteria 2789
169 Ga0207644_10161317 3300025931 Bacteria 1743
170 Ga0207690_10000887 3300025932 Bacteria 19086
171 Ga0207706_10088356 3300025933 Bacteria 2725
172 Ga0207704_10022695 3300025938 Bacteria 3368
173 Ga0207665_10111864 3300025939 Bacteria 1920
174 Ga0207711_10000978 3300025941 Bacteria 27393
175 Ga0207711_10001642 3300025941 Bacteria 20636
176 Ga0207711_10003500 3300025941 Bacteria 13594
177 Ga0207711_10013054 3300025941 Bacteria 6900
178 Ga0207667_10006902 3300025949 Bacteria 13714
179 Ga0207667_10110139 3300025949 Bacteria 2841
180 Ga0207712_10000376 3300025961 Bacteria 39304
181 Ga0207668_10000123 3300025972 Bacteria 54467
182 Ga0207668_10005201 3300025972 Bacteria 7654
183 Ga0207668_10006771 3300025972 Bacteria 6784
184 Ga0207668_10071587 3300025972 Bacteria 2477
185 Ga0207640_10261139 3300025981 Bacteria 1349
186 Ga0207658_10000118 3300025986 Bacteria 87228
187 Ga0207658_10014560 3300025986 Bacteria 5385
188 Ga0207658_10060628 3300025986 Bacteria 2824
189 Ga0207658_10384224 3300025986 Bacteria 1230
190 Ga0207703_10000079 3300026035 Bacteria 112451
191 Ga0207703_10002470 3300026035 Bacteria 16035
192 Ga0207703_10071077 3300026035 Bacteria 2874
193 Ga0207639_10401635 3300026041 Bacteria 1235
194 Ga0207702_10208367 3300026078 Bacteria 1816
195 Ga0207641_10000034 3300026088 Bacteria 217752
196 Ga0207641_10001419 3300026088 Bacteria 23630
197 Ga0207641_10027912 3300026088 Bacteria 4662
198 Ga0207641_10147610 3300026088 Bacteria 2128
199 Ga0207641_10707482 3300026088 Bacteria 992
200 Ga0207676_10000376 3300026095 Bacteria 38031
201 Ga0207676_10000506 3300026095 Bacteria 32940
202 Ga0207676_10068455 3300026095 Bacteria 2839
203 Ga0207676_10185947 3300026095 Bacteria 1824
204 Ga0207675_100065311 3300026118 Bacteria 3401
205 Ga0207683_10092016 3300026121 Bacteria 2702
206 Ga0207698_10063564 3300026142 Bacteria 2889
207 Ga0209999_1004916 3300027543 Bacteria 2404
208 Ga0209983_1015060 3300027665 Bacteria 1595
209 Ga0268266_10000005 3300028379 Bacteria 1448194
210 Ga0268266_10008699 3300028379 Bacteria 9000
211 Ga0268266_10050966 3300028379 Bacteria 3552
212 Ga0268266_10214048 3300028379 Bacteria 1768
213 Ga0268265_10001925 3300028380 Bacteria 16493
214 Ga0268265_10004919 3300028380 Bacteria 9186
215 Ga0268264_10000029 3300028381 Bacteria 419246
216 Ga0268264_10000481 3300028381 Bacteria 53088
217 Ga0268264_10024684 3300028381 Bacteria 4910
218 Ga0307517_10016140 3300028786 Bacteria 9843
219 Ga0307517_10030072 3300028786 Bacteria 6385
220 Ga0307517_10035496 3300028786 Bacteria 5642
221 Ga0307515_10023896 3300028794 Bacteria 10684
222 Ga0307515_10084117 3300028794 Bacteria 4091
223 Ga0307515_10135120 3300028794 Bacteria 2687
224 Ga0307511_10022238 3300030521 Bacteria 5945
225 Ga0265320_10000445 3300031240 Bacteria 32340
226 Ga0265325_10038582 3300031241 Bacteria 2520
227 Ga0265327_10002690 3300031251 Bacteria 18258
228 Ga0265327_10063743 3300031251 Bacteria 1870
229 Ga0307513_10000348 3300031456 Bacteria 67217
230 Ga0307513_10004937 3300031456 Bacteria 17710
231 Ga0307513_10006527 3300031456 Bacteria 15241
232 Ga0307513_10354469 3300031456 Bacteria 1214
233 Ga0265314_10032676 3300031711 Bacteria 3825
234 Ga0307414_10064669 3300032004 Bacteria 2605
235 Ga0307510_10012622 3300033180 Bacteria 10019
236 Ga0373936_0002059 3300035113 Bacteria 7453
237 Ga0373927_0000622 3300035695 Bacteria 26882
238 Ga0373937_0043521 3300036401 Bacteria 4099
239 Ga0373925_0000067 3300037068 Bacteria 110348
240 Ga0395899_0000095 3300037312 Bacteria 152790
241 Ga0395900_0000006 3300037418 Bacteria 495364
242 Ga0395900_0033761 3300037418 Bacteria 5265
243 Ga0395898_0026222 3300037466 Bacteria 5867
244 Ga0395905_0003726 3300037471 Bacteria 16150
245 Ga0395905_0056563 3300037471 Bacteria 3669
246 Ga0395905_0089611 3300037471 Bacteria 2883
247 Ga0395905_0137107 3300037471 Bacteria 2302
248 Ga0395905_0161474 3300037471 Bacteria 2106
249 Ga0395905_0225847 3300037471 Bacteria 1752
250 Ga0395905_0248456 3300037471 Bacteria 1662
251 Ga0436364_0276897 3300037853 Bacteria 48262
252 Ga0436364_0474573 3300037853 Bacteria 1511
253 Ga0436364_1241179 3300037853 Bacteria 1014
254 Ga0395901_0000001 3300038443 Bacteria 800383
255 Ga0436365_0041576 3300039437 Bacteria 7684
256 Ga0436362_0122513 3300039453 Bacteria 2365
257 Ga0466970_0061464 3300044765 Bacteria 2013
258 Ga0495627_000321 3300046453 Bacteria 47021
259 Ga0495590_0001458 3300046457 Bacteria 10201
260 Ga0495638_0000900 3300046460 Bacteria 30396
261 Ga0495638_0001500 3300046460 Bacteria 21035
262 Ga0495638_0002395 3300046460 Bacteria 15355
263 Ga0495638_0050853 3300046460 Bacteria 2587
264 Ga0495638_0068867 3300046460 Bacteria 2169
265 Ga0495638_0115792 3300046460 Bacteria 1588
266 Ga0495650_0000068 3300046471 Bacteria 266671
267 Ga0495650_0083534 3300046471 Bacteria 1227
268 Ga0495585_0107453 3300046492 Bacteria 1487
269 Ga0495607_0116861 3300046501 Bacteria 1406
270 Ga0495583_0000002 3300046506 Bacteria 782521
271 Ga0495583_0023347 3300046506 Bacteria 3131
272 Ga0495606_0002435 3300046507 Bacteria 21634
273 Ga0495606_0030353 3300046507 Bacteria 3778
274 Ga0495610_0000260 3300046512 Bacteria 55537
275 Ga0495610_0000813 3300046512 Bacteria 29272
276 Ga0495610_0012390 3300046512 Bacteria 5136
277 Ga0495616_0000317 3300046513 Bacteria 38524
278 Ga0495620_0115249 3300046515 Bacteria 1062
279 Ga0495620_0155373 3300046515 Bacteria 890
280 Ga0495631_0007131 3300046518 Bacteria 5712
281 Ga0495632_0003901 3300046519 Bacteria 10362
282 Ga0495632_0020819 3300046519 Bacteria 3544
283 Ga0495637_0031739 3300046520 Bacteria 2333
284 Ga0495637_0050877 3300046520 Bacteria 1737
285 Ga0495648_0000067 3300046524 Bacteria 140250
286 Ga0495648_0029110 3300046524 Bacteria 3670
287 Ga0495642_0013931 3300046528 Bacteria 3114
288 Ga0495642_0096129 3300046528 Bacteria 1257
289 Ga0495654_0000042 3300046530 Bacteria 164346
290 Ga0495654_0039074 3300046530 Bacteria 2370
291 Ga0495665_0121018 3300046531 Bacteria 1371
292 Ga0495609_0027049 3300046538 Bacteria 2623
293 Ga0495609_0076376 3300046538 Bacteria 1468
294 Ga0495621_0117051 3300046539 Bacteria 1027
295 Ga0495597_0002477 3300046542 Bacteria 11654
296 Ga0495597_0015465 3300046542 Bacteria 3613
297 Ga0495668_0000026 3300046616 Bacteria 297287
298 Ga0495668_0001967 3300046616 Bacteria 18099
299 Ga0495668_0013362 3300046616 Bacteria 4847
300 Ga0495611_0043225 3300046648 Bacteria 2014
301 Ga0495625_0000127 3300046660 Bacteria 118526
302 Ga0495625_0018903 3300046660 Bacteria 5363
303 Ga0495625_0026427 3300046660 Bacteria 4386
304 Ga0495625_0057806 3300046660 Bacteria 2757
305 Ga0495625_0057893 3300046660 Bacteria 2754
306 Ga0495625_0099312 3300046660 Bacteria 2001
307 Ga0495625_0146712 3300046660 Bacteria 1588
308 Ga0495659_0066593 3300046664 Bacteria 1342
309 Ga0495623_0343177 3300046679 Bacteria 815
310 Ga0495669_0065510 3300046684 Bacteria 1649
311 Ga0495613_0001327 3300046689 Bacteria 18911
312 Ga0495671_0035677 3300046692 Bacteria 2524
313 Ga0495649_0000048 3300046694 Bacteria 118180
314 Ga0495589_0010353 3300046794 Bacteria 4842
315 Ga0495660_0001869 3300046810 Bacteria 13827
316 Ga0495660_0158927 3300046810 Bacteria 1110
317 Ga0495672_0003400 3300047320 Bacteria 13661
318 Ga0495683_0060009 3300047323 Bacteria 1886
319 Ga0495687_099777 3300047443 Bacteria 1092
320 Ga0495679_024475 3300047446 Bacteria 2033
321 Ga0495673_0000208 3300047469 Bacteria 88985
322 Ga0495673_0000293 3300047469 Bacteria 67070
323 Ga0495673_0002253 3300047469 Bacteria 13844
324 Ga0495681_0141429 3300047470 Bacteria 1016
325 Ga0495686_0001397 3300047472 Bacteria 26707
326 Ga0495686_0002164 3300047472 Bacteria 19143
327 Ga0495686_0008686 3300047472 Bacteria 7416
328 Ga0495686_0012327 3300047472 Bacteria 5984
329 Ga0496102_0152475 3300048905 Bacteria 2172
330 Ga0496102_0230738 3300048905 Bacteria 1745
331 Ga0496102_0629574 3300048905 Bacteria 996
332 Ga0496103_0172229 3300048906 Bacteria 1390
333 Ga0496107_0100456 3300048910 Bacteria 2121
334 Ga0496109_0439652 3300048912 Bacteria 1232
335 Ga0496112_0054527 3300048915 Bacteria 3928
336 Ga0496112_0173091 3300048915 Bacteria 2124
337 Ga0496112_0339236 3300048915 Bacteria 1446
338 Ga0496115_0001146 3300048918 Bacteria 19143
339 Ga0496115_0009027 3300048918 Bacteria 7396
340 Ga0496115_0012869 3300048918 Bacteria 6309
341 Ga0496115_0057933 3300048918 Bacteria 3117
342 Ga0496117_0060786 3300048920 Bacteria 2601
343 Ga0496118_0085799 3300048921 Bacteria 2190
344 Ga0496121_0000130 3300048924 Bacteria 168094
345 Ga0496121_0002319 3300048924 Bacteria 29484
346 Ga0496124_0013045 3300048927 Bacteria 8142
347 Ga0496125_0010944 3300048928 Bacteria 9116
348 Ga0495678_000358 3300049459 Bacteria 46919
349 Ga0501032_0169477 3300049569 Bacteria 1432
350 Ga0501039_0105217 3300049575 Bacteria 2204
351 Ga0501041_0242431 3300049577 Bacteria 1133
352 Ga0501046_0178770 3300049580 Bacteria 1588
353 Ga0501047_0000825 3300049581 Bacteria 32128
354 Ga0501047_0238470 3300049581 Bacteria 1670
355 Ga0501048_0130769 3300049582 Bacteria 1775
356 Ga0501076_0058210 3300049592 Bacteria 3071
357 Ga0501077_0377057 3300049593 Archaea 906
358 Ga0501238_001095 3300049671 Bacteria 3083
359 Ga0501238_001121 3300049671 Bacteria 3046
360 Ga0501079_0060955 3300049741 Bacteria 2911
361 Ga0501080_0180357 3300049742 Bacteria 1944
362 Ga0501035_0234198 3300049822 Bacteria 1564
363 Ga0501035_0311235 3300049822 Bacteria 1325
364 Ga0501044_0009852 3300049823 Bacteria 10387
365 Ga0501044_0352212 3300049823 Bacteria 1392
366 nmdc:mga00v17_2280_c1 3300050491 Bacteria 9840
367 nmdc:mga0k408_77644_c1 3300050493 Bacteria 1942
368 nmdc:mga04h51_124602_c1 3300050495 Bacteria 963
369 nmdc:mga07m45_1914_c1 3300050496 Bacteria 9617
370 nmdc:mga0sz30_13073_c1 3300050516 Bacteria 2940
371 Ga0495612_0115730 3300053078 Bacteria 1151
372 Ga0500635_0000328 3300053080 Bacteria 16376
373 Ga0500578_0000309 3300053086 Bacteria 59973
374 Ga0500643_001070 3300053087 Bacteria 16546
375 Ga0500643_009976 3300053087 Bacteria 3578
376 Ga0500643_059667 3300053087 Bacteria 1073
377 Ga0500644_0000036 3300053088 Bacteria 80681
378 Ga0500651_0098363 3300053093 Bacteria 1796
379 Ga0500641_0000276 3300053096 Bacteria 19065
380 Ga0500641_0003962 3300053096 Bacteria 5235
381 Ga0500641_0017893 3300053096 Bacteria 2658
382 Ga0500654_150621 3300053099 Bacteria 819
383 Ga0500554_000945 3300053102 Bacteria 5666
384 Ga0500555_055864 3300053103 Bacteria 1071
385 Ga0500556_0000382 3300053104 Bacteria 32379
386 Ga0500556_0002210 3300053104 Bacteria 6510
387 Ga0500556_0040116 3300053104 Bacteria 1644
388 Ga0500556_0071464 3300053104 Bacteria 1297
389 Ga0500562_001228 3300053108 Bacteria 6311
390 Ga0500562_006458 3300053108 Bacteria 2954
391 Ga0500562_016878 3300053108 Bacteria 1878
392 Ga0500569_001104 3300053109 Bacteria 4939
393 Ga0500594_0000141 3300053118 Bacteria 19985
394 Ga0500595_011120 3300053119 Bacteria 3538
395 Ga0500595_056365 3300053119 Bacteria 1201
396 Ga0500597_143611 3300053120 Bacteria 1027
397 Ga0500608_000107 3300053122 Bacteria 33885
398 Ga0500608_001574 3300053122 Bacteria 8182
399 Ga0500614_001953 3300053123 Bacteria 4732
400 Ga0500618_000074 3300053125 Bacteria 81608
401 Ga0500658_0005513 3300053134 Bacteria 4711
402 Ga0500559_0000086 3300053136 Bacteria 73688
403 Ga0500559_0003341 3300053136 Bacteria 7942
404 Ga0500559_0003905 3300053136 Bacteria 7203
405 Ga0500564_000359 3300053138 Bacteria 12852
406 Ga0500577_0009185 3300053142 Bacteria 2859
407 Ga0500604_0022964 3300053151 Bacteria 1776
408 Ga0500616_0016531 3300053153 Bacteria 4197
409 Ga0500616_0018299 3300053153 Bacteria 3963
410 Ga0500616_0150345 3300053153 Bacteria 1078
411 Ga0500622_0000608 3300053156 Bacteria 32512
412 Ga0500622_0008039 3300053156 Bacteria 5934
413 Ga0500622_0010260 3300053156 Bacteria 5148
414 Ga0500622_0010639 3300053156 Bacteria 5041
415 Ga0500622_0020783 3300053156 Bacteria 3484
416 Ga0500622_0036601 3300053156 Bacteria 2565
417 Ga0500624_018748 3300053157 Bacteria 1093
418 Ga0500627_0066975 3300053158 Bacteria 1586
419 Ga0500636_0012284 3300053177 Bacteria 5017
420 Ga0500637_0082082 3300053178 Bacteria 1862
421 Ga0500637_0094752 3300053178 Bacteria 1729
422 Ga0500625_017716 3300053729 Bacteria 3330
423 Ga0500645_000131 3300053730 Bacteria 58717
424 Ga0500645_002140 3300053730 Bacteria 9078
425 Ga0500645_002401 3300053730 Bacteria 8406
426 Ga0500645_002611 3300053730 Bacteria 7899
427 Ga0500609_001219 3300053731 Bacteria 3828
428 Ga0530510_0363823 3300061734 Bacteria 1087
429 2511125497 2510917020 Bacteria 5657507
430 2585146456 2582581279 Bacteria 4980720
431 2585151961 2582581280 Bacteria 5994497
432 2585194554 2582581293 Bacteria 5907401
433 2587918477 2585428106 Bacteria 5179711
434 2643748582 2643221545 Bacteria 5083237
435 2643779477 2643221552 Bacteria 5708754
436 2643923593 2643221583 Bacteria 5218014
437 2643931043 2643221584 Bacteria 5511711
438 2644224962 2643221640 Bacteria 5258820
439 2644234104 2643221642 Bacteria 5357871
440 2644510255 2643221691 Bacteria 5093099
441 2792462906 2791355048 Bacteria 5832535
442 2819537364 2818991435 Bacteria 5433759
443 2819646574 2818991454 Bacteria 5563326
444 2849561833 2849560528 Bacteria 5393480
445 2849574101 2849573788 Bacteria 5421256
446 2851157783 2851153111 Bacteria 5542585
447 2857505329 2857504554 Bacteria 5369913
448 2884962413 2884960567 Bacteria 5437054
449 2898332574 2898329390 Bacteria 5168154
450 2928533217 2928531327 Bacteria 5101314
451 Ga0373946_0060297
452 rootL2_10140596
453 Ga0055537_1001546
454 Ga0055536_1000911
455 Ga0055536_1001435
456 Ga0055530_10001800
457 Ga0055530_10007239
458 Ga0055530_10008847
459 Ga0055531_10001288
460 Ga0055531_10003395
461 Ga0055531_10009045
462 Ga0065165_1000413
463 Ga0065165_1000731
464 Ga0065165_1051739
465 Ga0070658_10301601
466 Ga0070670_100000020
467 Ga0070670_100016359
468 Ga0070670_100123994
469 Ga0070680_100023268
470 Ga0070680_100297814
471 Ga0068868_100102934
472 Ga0070668_100000108
473 Ga0070668_100001618
474 Ga0070668_100004507
475 Ga0070669_100008310
476 Ga0070669_100440131
477 Ga0070671_100022027
478 Ga0070671_100046265
479 Ga0070671_100065165
480 Ga0070659_100002556
481 Ga0070659_100031441
482 Ga0070667_100000163
483 Ga0070667_100004064
484 Ga0070667_100015105
485 Ga0070667_100138431
486 Ga0070667_100194123
487 Ga0070663_100101532
488 Ga0070678_100533362
489 Ga0070681_10022275
490 Ga0070679_100883726
491 Ga0068853_100157667
492 Ga0068853_100226859
493 Ga0070665_100000015
494 Ga0070665_100000441
495 Ga0070665_100032944
496 Ga0068855_100070276
497 Ga0068855_100288579
498 Ga0068856_100183225
499 Ga0068852_100038996
500 Ga0068859_100000671
501 Ga0068859_100009336
502 Ga0068859_100107525
503 Ga0068859_100360275
504 Ga0068864_100000071
505 Ga0068864_100008464
506 Ga0068864_100031006
507 Ga0068861_100122735
508 Ga0068861_100408969
509 Ga0068851_10195253
510 Ga0068863_100000037
511 Ga0068863_100000451
512 Ga0068863_100021083
513 Ga0068863_100064681
514 Ga0068858_100000029
515 Ga0068858_100002275
516 Ga0068858_100006867
517 Ga0068858_100422474
518 Ga0068860_100001003
519 Ga0068860_100002441
520 Ga0068860_100009413
521 Ga0068860_100247428
522 Ga0068862_100000057
523 Ga0068862_100030882
524 Ga0068862_100091482
525 Ga0070717_10017847
526 Ga0070717_10111695
527 Ga0075368_10006829
528 Ga0075364_10009664
529 Ga0070712_100587260
530 Ga0075367_10006951
531 Ga0075366_10009937
532 Ga0075366_10082445
533 Ga0075370_10050624
534 Ga0068865_100082273
535 Ga0068865_100304506
536 Ga0097620_100000671
537 Ga0097620_100009336
538 Ga0097620_100107524
539 Ga0097620_100360309
540 Ga0105240_10001340
541 Ga0105240_10010073
542 Ga0105240_10056843
543 Ga0105240_10121559
544 Ga0105240_10131977
545 Ga0105240_10183351
546 Ga0105240_10192658
547 Ga0105240_10593350
548 Ga0105247_10108879
549 Ga0105241_10439633
550 Ga0105248_10001636
551 Ga0105248_10003631
552 Ga0105248_10009715
553 Ga0105248_10010680
554 Ga0105248_10128381
555 Ga0105248_10239489
556 Ga0105237_10265465
557 Ga0105238_10002006
558 Ga0105238_10012701
559 Ga0105238_10032595
560 Ga0105249_10000792
561 Ga0105239_10252943
562 Ga0105239_10293309
563 Ga0157370_10367339
564 Ga0163162_10097670
565 Ga0157372_10015498
566 Ga0163163_10002745
567 Ga0163163_10060815
568 Ga0163163_10088102
569 Ga0163163_10187454
570 Ga0163163_10283556
571 Ga0157379_10000579
572 Ga0157379_10066106
573 Ga0157379_10220033
574 Ga0157379_10269652
575 Ga0213876_10020698
576 Ga0213875_10000182
577 Ga0209026_1000474
578 Ga0209673_1000979
579 Ga0209676_1000289
580 Ga0209676_1000799
581 Ga0209564_1008743
582 Ga0209564_1024742
583 Ga0209758_1003978
584 Ga0209758_1004642
585 Ga0209050_1000029
586 Ga0209050_1000724
587 Ga0209050_1001015
588 Ga0209050_1022828
589 Ga0209256_1004199
590 Ga0209256_1005763
591 Ga0209256_1011476
592 Ga0209051_1015403
593 Ga0209257_1000036
594 Ga0209257_1000152
595 Ga0209257_1000660
596 Ga0209257_1000903
597 Ga0209257_1007400
598 Ga0207699_10050355
599 Ga0207705_10032288
600 Ga0207705_10077770
601 Ga0207707_10073062
602 Ga0207707_10120574
603 Ga0207707_10123541
604 Ga0207695_10003819
605 Ga0207695_10008153
606 Ga0207695_10009530
607 Ga0207695_10100087
608 Ga0207660_10064231
609 Ga0207660_10100216
610 Ga0207657_10042708
611 Ga0207681_10142510
612 Ga0207694_10072099
613 Ga0207694_10096463
614 Ga0207694_10180483
615 Ga0207650_10000175
616 Ga0207650_10037016
617 Ga0207650_10068515
618 Ga0207664_10071807
619 Ga0207644_10161317
620 Ga0207690_10000887
621 Ga0207706_10088356
622 Ga0207704_10022695
623 Ga0207665_10111864
624 Ga0207711_10000978
625 Ga0207711_10001642
626 Ga0207711_10003500
627 Ga0207711_10013054
628 Ga0207667_10006902
629 Ga0207667_10110139
630 Ga0207712_10000376
631 Ga0207668_10000123
632 Ga0207668_10005201
633 Ga0207668_10006771
634 Ga0207668_10071587
635 Ga0207640_10261139
636 Ga0207658_10000118
637 Ga0207658_10014560
638 Ga0207658_10060628
639 Ga0207658_10384224
640 Ga0207703_10000079
641 Ga0207703_10002470
642 Ga0207703_10071077
643 Ga0207639_10401635
644 Ga0207702_10208367
645 Ga0207641_10000034
646 Ga0207641_10001419
647 Ga0207641_10027912
648 Ga0207641_10147610
649 Ga0207641_10707482
650 Ga0207676_10000376
651 Ga0207676_10000506
652 Ga0207676_10068455
653 Ga0207676_10185947
654 Ga0207675_100065311
655 Ga0207683_10092016
656 Ga0207698_10063564
657 Ga0209999_1004916
658 Ga0209983_1015060
659 Ga0268266_10000005
660 Ga0268266_10008699
661 Ga0268266_10050966
662 Ga0268266_10214048
663 Ga0268265_10001925
664 Ga0268265_10004919
665 Ga0268264_10000029
666 Ga0268264_10000481
667 Ga0268264_10024684
668 Ga0307517_10016140
669 Ga0307517_10030072
670 Ga0307517_10035496
671 Ga0307515_10023896
672 Ga0307515_10084117
673 Ga0307515_10135120
674 Ga0307511_10022238
675 Ga0265320_10000445
676 Ga0265325_10038582
677 Ga0265327_10002690
678 Ga0265327_10063743
679 Ga0307513_10000348
680 Ga0307513_10004937
681 Ga0307513_10006527
682 Ga0307513_10354469
683 Ga0265314_10032676
684 Ga0307414_10064669
685 Ga0307510_10012622
686 Ga0373936_0002059
687 Ga0373927_0000622
688 Ga0373937_0043521
689 Ga0373925_0000067
690 Ga0395899_0000095
691 Ga0395900_0000006
692 Ga0395900_0033761
693 Ga0395898_0026222
694 Ga0395905_0003726
695 Ga0395905_0056563
696 Ga0395905_0089611
697 Ga0395905_0137107
698 Ga0395905_0161474
699 Ga0395905_0225847
700 Ga0395905_0248456
701 Ga0436364_0276897
702 Ga0436364_0474573
703 Ga0436364_1241179
704 Ga0395901_0000001
705 Ga0436365_0041576
706 Ga0436362_0122513
707 Ga0466970_0061464
708 Ga0495627_000321
709 Ga0495590_0001458
710 Ga0495638_0000900
711 Ga0495638_0001500
712 Ga0495638_0002395
713 Ga0495638_0050853
714 Ga0495638_0068867
715 Ga0495638_0115792
716 Ga0495650_0000068
717 Ga0495650_0083534
718 Ga0495585_0107453
719 Ga0495607_0116861
720 Ga0495583_0000002
721 Ga0495583_0023347
722 Ga0495606_0002435
723 Ga0495606_0030353
724 Ga0495610_0000260
725 Ga0495610_0000813
726 Ga0495610_0012390
727 Ga0495616_0000317
728 Ga0495620_0115249
729 Ga0495620_0155373
730 Ga0495631_0007131
731 Ga0495632_0003901
732 Ga0495632_0020819
733 Ga0495637_0031739
734 Ga0495637_0050877
735 Ga0495648_0000067
736 Ga0495648_0029110
737 Ga0495642_0013931
738 Ga0495642_0096129
739 Ga0495654_0000042
740 Ga0495654_0039074
741 Ga0495665_0121018
742 Ga0495609_0027049
743 Ga0495609_0076376
744 Ga0495621_0117051
745 Ga0495597_0002477
746 Ga0495597_0015465
747 Ga0495668_0000026
748 Ga0495668_0001967
749 Ga0495668_0013362
750 Ga0495611_0043225
751 Ga0495625_0000127
752 Ga0495625_0018903
753 Ga0495625_0026427
754 Ga0495625_0057806
755 Ga0495625_0057893
756 Ga0495625_0099312
757 Ga0495625_0146712
758 Ga0495659_0066593
759 Ga0495623_0343177
760 Ga0495669_0065510
761 Ga0495613_0001327
762 Ga0495671_0035677
763 Ga0495649_0000048
764 Ga0495589_0010353
765 Ga0495660_0001869
766 Ga0495660_0158927
767 Ga0495672_0003400
768 Ga0495683_0060009
769 Ga0495687_099777
770 Ga0495679_024475
771 Ga0495673_0000208
772 Ga0495673_0000293
773 Ga0495673_0002253
774 Ga0495681_0141429
775 Ga0495686_0001397
776 Ga0495686_0002164
777 Ga0495686_0008686
778 Ga0495686_0012327
779 Ga0496102_0152475
780 Ga0496102_0230738
781 Ga0496102_0629574
782 Ga0496103_0172229
783 Ga0496107_0100456
784 Ga0496109_0439652
785 Ga0496112_0054527
786 Ga0496112_0173091
787 Ga0496112_0339236
788 Ga0496115_0001146
789 Ga0496115_0009027
790 Ga0496115_0012869
791 Ga0496115_0057933
792 Ga0496117_0060786
793 Ga0496118_0085799
794 Ga0496121_0000130
795 Ga0496121_0002319
796 Ga0496124_0013045
797 Ga0496125_0010944
798 Ga0495678_000358
799 Ga0501032_0169477
800 Ga0501039_0105217
801 Ga0501041_0242431
802 Ga0501046_0178770
803 Ga0501047_0000825
804 Ga0501047_0238470
805 Ga0501048_0130769
806 Ga0501076_0058210
807 Ga0501077_0377057
808 Ga0501238_001095
809 Ga0501238_001121
810 Ga0501079_0060955
811 Ga0501080_0180357
812 Ga0501035_0234198
813 Ga0501035_0311235
814 Ga0501044_0009852
815 Ga0501044_0352212
816 nmdc:mga00v17_2280_c1
817 nmdc:mga0k408_77644_c1
818 nmdc:mga04h51_124602_c1
819 nmdc:mga07m45_1914_c1
820 nmdc:mga0sz30_13073_c1
821 Ga0495612_0115730
822 Ga0500635_0000328
823 Ga0500578_0000309
824 Ga0500643_001070
825 Ga0500643_009976
826 Ga0500643_059667
827 Ga0500644_0000036
828 Ga0500651_0098363
829 Ga0500641_0000276
830 Ga0500641_0003962
831 Ga0500641_0017893
832 Ga0500654_150621
833 Ga0500554_000945
834 Ga0500555_055864
835 Ga0500556_0000382
836 Ga0500556_0002210
837 Ga0500556_0040116
838 Ga0500556_0071464
839 Ga0500562_001228
840 Ga0500562_006458
841 Ga0500562_016878
842 Ga0500569_001104
843 Ga0500594_0000141
844 Ga0500595_011120
845 Ga0500595_056365
846 Ga0500597_143611
847 Ga0500608_000107
848 Ga0500608_001574
849 Ga0500614_001953
850 Ga0500618_000074
851 Ga0500658_0005513
852 Ga0500559_0000086
853 Ga0500559_0003341
854 Ga0500559_0003905
855 Ga0500564_000359
856 Ga0500577_0009185
857 Ga0500604_0022964
858 Ga0500616_0016531
859 Ga0500616_0018299
860 Ga0500616_0150345
861 Ga0500622_0000608
862 Ga0500622_0008039
863 Ga0500622_0010260
864 Ga0500622_0010639
865 Ga0500622_0020783
866 Ga0500622_0036601
867 Ga0500624_018748
868 Ga0500627_0066975
869 Ga0500636_0012284
870 Ga0500637_0082082
871 Ga0500637_0094752
872 Ga0500625_017716
873 Ga0500645_000131
874 Ga0500645_002140
875 Ga0500645_002401
876 Ga0500645_002611
877 Ga0500609_001219
878 Ga0530510_0363823
879 2511125497
880 2585146456
881 2585151961
882 2585194554
883 2587918477
884 2643748582
885 2643779477
886 2643923593
887 2643931043
888 2644224962
889 2644234104
890 2644510255
891 2792462906
892 2819537364
893 2819646574
894 2849561833
895 2849574101
896 2851157783
897 2857505329
898 2884962413
899 2898332574
900 2928533217

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

168

289

0.9

PF03476

MOSC_N

MOSC N-terminal beta barrel domain

40

157

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o9q-assembly1.cif.gz_A crystal structure of the awp1 (adhesin-like wall protein 1) a-domain from candida glabrata 0.8181 82 106
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.813 151 263
7jr9-assembly1.cif.gz_B chlamydomonas reinhardtii radial spoke minimal head complex 0.7619 81 106
6fw2-assembly1.cif.gz_A crystal structure of human marc1 0.7561 11 262
7z4q-assembly1.cif.gz_A plasmodium falciparum pyruvate kinase mutant - c49a 0.7498 193 262
ID Description Score Start End Superfamily
af_Q58EJ9_194_321_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8869 151 261 2.40.33.20
af_A1Z803_208_336_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8841 151 261 2.40.33.20
af_Q96EN8_729_865_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8725 151 248 2.40.33.20
af_A4HT05_92_321_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8699 83 110 2.130.10.10
af_Q55D22_203_357_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8526 151 248 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A4Q3RXW7-F1-model_v4 MOSC domain-containing protein 0.9859 11 263 GO:0003824
GO:0030151
GO:0030170
AF-A0A4Q3RXW7-F1-model_v4 MOSC domain-containing protein 0.9821 11 263 GO:0003824
GO:0030151
GO:0030170
AF-A0A6M0HZC9-F1-model_v4 MOSC domain-containing protein 0.9798 150 263 GO:0003824
GO:0030151
GO:0030170
AF-A0A2D7IX20-F1-model_v4 MOSC domain-containing protein 0.9788 11 263 GO:0003824
GO:0030151
GO:0030170
AF-A0A5P9H1J6-F1-model_v4 Stearoyl-CoA 9-desaturase electron transfer partner 0.9688 151 263 GO:0016491
GO:0030151
GO:0030170
GO:0051537

Map