metagRoot

F446649

General Info

Members	Datasets	Scaffolds	Average Seq Length
450	264	449	269

Family's Representative Sequence

Representative Sequence	3300045976\|Ga0466967_0015255\|Ga0466967_0015255_3208_4011
Length	258
Sequence	VEQAGRAPKARLSSVANSMRLLTSFSGDEDELAITTLAQRLGLAKSTVHRLASTLVSAGFLEQNRDTGRYRLGVALFELGALVRRRMDVANEARPHLRELLEKTGETVQLGIVDHYSVLYVYEMESRRAIRMAAAVGARAPLHCTAVGKVLLAFQAADYIREVLDRGLTSFTEKTVTRRDAVLALLEDVRSRDYAIDDEESEIGLRAIAAPVRNQNGLVIAALGKKVMQTSVPSVISIAQAVSARLGYQPVRRKAFHE

Samples

	Sample ID	Description	Type	Environment
1	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
2	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
3	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
4	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
5	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
6	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
7	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
8	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
9	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
10	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
11	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
12	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
13	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
14	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
15	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
16	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
17	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
18	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
19	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
20	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
21	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
22	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
23	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
24	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
25	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
26	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
27	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
28	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
29	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
30	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
31	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
32	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
33	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
34	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
35	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
36	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
37	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
38	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
39	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
40	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
41	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
42	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
43	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
44	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
45	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
46	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
47	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
48	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
49	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
50	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
51	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
52	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
53	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
54	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
55	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
56	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
57	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
59	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
60	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
61	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
62	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
63	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
64	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
65	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
66	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
67	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
69	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
70	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
71	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
73	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
75	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
76	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
77	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
78	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
79	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
80	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
81	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
82	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
83	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
84	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
85	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
86	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
87	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
88	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
89	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
90	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
128	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
131	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
132	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
133	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
134	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
135	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
136	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
137	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
138	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
139	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
140	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
141	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
142	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
143	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
144	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
145	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
146	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
147	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
148	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
149	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
150	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
151	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
152	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
153	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
154	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
155	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
156	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
157	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
158	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
159	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
160	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
161	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
162	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
163	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
164	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
165	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
166	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
167	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
168	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
169	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
170	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
171	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
172	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
173	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
174	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
175	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
176	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
177	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
178	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
179	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
180	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
181	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
182	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
183	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
184	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
185	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
186	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
187	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
188	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
189	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
190	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
191	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
192	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
193	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
194	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
195	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
196	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
197	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
198	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
199	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
200	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
201	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
202	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
203	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
204	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
205	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
206	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
207	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
208	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
209	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
210	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
211	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
212	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
213	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
214	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
215	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
216	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
217	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
218	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
219	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
220	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
221	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
222	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
223	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
224	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
225	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
226	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
228	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
229	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
230	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
231	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
232	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
233	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
234	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
235	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
236	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
237	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
238	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
239	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
240	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
241	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
242	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
243	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
244	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
245	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
246	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
247	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
248	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
249	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
250	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
251	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
252	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
253	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
254	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
255	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
256	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
257	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
258	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
259	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
260	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
261	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
262	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
263	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
264	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.78
Metatranscriptomes	0
Isolates	0.22

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	0.22
Rhizosphere	99.33
Stem	0
Stem Tuber	0
Unclassified	0.44

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10043060	3300003203	Bacteria	1575
2	Ga0065707_10150126	3300005295	Bacteria	1659
3	Ga0070658_10210709	3300005327	Bacteria	1641
4	Ga0070690_100001141	3300005330	Bacteria	13673
5	Ga0070690_100106024	3300005330	Bacteria	1869
6	Ga0070690_100361798	3300005330	Bacteria	1056
7	Ga0070677_10050730	3300005333	Bacteria	1677
8	Ga0068869_100000089	3300005334	Bacteria	41752
9	Ga0070666_10185769	3300005335	Bacteria	1459
10	Ga0070680_100000807	3300005336	Bacteria	22103
11	Ga0070680_100056354	3300005336	Bacteria	3213
12	Ga0070680_100086257	3300005336	Bacteria	2595
13	Ga0070682_100014137	3300005337	Bacteria	4610
14	Ga0068868_100000554	3300005338	Bacteria	25023
15	Ga0070689_100000185	3300005340	Bacteria	37751
16	Ga0070689_100023944	3300005340	Bacteria	4577
17	Ga0070689_100073688	3300005340	Bacteria	2671
18	Ga0070689_100259121	3300005340	Bacteria	1437
19	Ga0070689_100409348	3300005340	Bacteria	1148
20	Ga0070691_10002337	3300005341	Bacteria	8406
21	Ga0070687_100000307	3300005343	Bacteria	16612
22	Ga0070687_100195383	3300005343	Bacteria	1222
23	Ga0070692_10000165	3300005345	Bacteria	16818
24	Ga0070692_10079641	3300005345	Bacteria	1762
25	Ga0070675_100004786	3300005354	Bacteria	10321
26	Ga0070675_100317115	3300005354	Bacteria	1377
27	Ga0070671_100490342	3300005355	Unclassified	1056
28	Ga0070673_100112695	3300005364	Bacteria	2258
29	Ga0070659_100038956	3300005366	Bacteria	3709
30	Ga0070701_10000413	3300005438	Bacteria	14514
31	Ga0070701_10035418	3300005438	Bacteria	2507
32	Ga0070705_100000541	3300005440	Bacteria	21859
33	Ga0070705_100159385	3300005440	Bacteria	1506
34	Ga0070700_100000398	3300005441	Bacteria	22486
35	Ga0070700_100027382	3300005441	Bacteria	3379
36	Ga0070700_100250674	3300005441	Bacteria	1270
37	Ga0070694_100000089	3300005444	Bacteria	43372
38	Ga0070694_100101766	3300005444	Bacteria	2033
39	Ga0070694_100250348	3300005444	Bacteria	1340
40	Ga0070694_100436936	3300005444	Bacteria	1031
41	Ga0070708_100047371	3300005445	Bacteria	3797
42	Ga0070681_10004952	3300005458	Bacteria	12806
43	Ga0070681_10006508	3300005458	Bacteria	11369
44	Ga0070681_10039880	3300005458	Bacteria	4708
45	Ga0070681_10065178	3300005458	Bacteria	3612
46	Ga0070681_10104476	3300005458	Bacteria	2775
47	Ga0070681_10170111	3300005458	Bacteria	2101
48	Ga0068867_100000803	3300005459	Bacteria	21184
49	Ga0068867_100246750	3300005459	Bacteria	1450
50	Ga0070685_10343006	3300005466	Bacteria	1019
51	Ga0070706_100008902	3300005467	Bacteria	9347
52	Ga0070706_100175971	3300005467	Bacteria	1998
53	Ga0070707_100096915	3300005468	Bacteria	2857
54	Ga0070707_100193028	3300005468	Bacteria	1986
55	Ga0070699_100007817	3300005518	Bacteria	9293
56	Ga0070699_100042427	3300005518	Bacteria	3937
57	Ga0070699_100157095	3300005518	Bacteria	2012
58	Ga0070699_100177886	3300005518	Unclassified	1887
59	Ga0070699_100569104	3300005518	Bacteria	1032
60	Ga0070679_100002303	3300005530	Bacteria	17267
61	Ga0070679_100004206	3300005530	Bacteria	13276
62	Ga0070679_100020254	3300005530	Bacteria	6483
63	Ga0070679_100182007	3300005530	Bacteria	2073
64	Ga0070684_100220695	3300005535	Bacteria	1730
65	Ga0070697_100368380	3300005536	Bacteria	1243
66	Ga0068853_100073359	3300005539	Bacteria	2984
67	Ga0070672_100364851	3300005543	Bacteria	1233
68	Ga0070686_100015485	3300005544	Bacteria	4419
69	Ga0070695_100000187	3300005545	Bacteria	29864
70	Ga0070695_100012890	3300005545	Bacteria	5018
71	Ga0070696_100001338	3300005546	Bacteria	16061
72	Ga0070696_100032326	3300005546	Bacteria	3590
73	Ga0070693_100000125	3300005547	Bacteria	34456
74	Ga0070693_100146137	3300005547	Unclassified	1493
75	Ga0070704_100000051	3300005549	Bacteria	37969
76	Ga0070704_100037038	3300005549	Bacteria	3329
77	Ga0070704_100095354	3300005549	Bacteria	2228
78	Ga0068855_100000741	3300005563	Bacteria	40118
79	Ga0068855_100008189	3300005563	Bacteria	12635
80	Ga0068855_100318145	3300005563	Bacteria	1721
81	Ga0068855_100324154	3300005563	Bacteria	1702
82	Ga0068854_100004113	3300005578	Bacteria	9142
83	Ga0068856_100303682	3300005614	Bacteria	1614
84	Ga0070702_100000541	3300005615	Bacteria	13675
85	Ga0070702_100256679	3300005615	Bacteria	1188
86	Ga0068852_100001065	3300005616	Bacteria	18109
87	Ga0068852_100071329	3300005616	Bacteria	3050
88	Ga0068852_100092079	3300005616	Bacteria	2714
89	Ga0068852_100289184	3300005616	Bacteria	1583
90	Ga0068859_100001531	3300005617	Bacteria	23584
91	Ga0068859_100142583	3300005617	Bacteria	2470
92	Ga0068864_100011457	3300005618	Bacteria	7325
93	Ga0068866_10000255	3300005718	Bacteria	24960
94	Ga0068861_100000466	3300005719	Bacteria	23683
95	Ga0068870_10096558	3300005840	Bacteria	1662
96	Ga0068863_100224661	3300005841	Bacteria	1810
97	Ga0068863_100355585	3300005841	Bacteria	1427
98	Ga0068858_100003050	3300005842	Bacteria	16786
99	Ga0068858_100172481	3300005842	Bacteria	2040
100	Ga0068858_100260116	3300005842	Bacteria	1649
101	Ga0068860_100000810	3300005843	Bacteria	34973
102	Ga0068860_100168700	3300005843	Bacteria	2114
103	Ga0068860_100301336	3300005843	Bacteria	1570
104	Ga0068862_100000622	3300005844	Bacteria	36814
105	Ga0081539_10000784	3300005985	Bacteria	61876
106	Ga0081539_10071362	3300005985	Bacteria	1860
107	Ga0075432_10048644	3300006058	Bacteria	1492
108	Ga0097621_100001560	3300006237	Bacteria	15661
109	Ga0097621_100008366	3300006237	Bacteria	7446
110	Ga0068871_100001324	3300006358	Bacteria	16559
111	Ga0075428_100000835	3300006844	Bacteria	32292
112	Ga0075430_100000498	3300006846	Bacteria	29452
113	Ga0075430_100017098	3300006846	Bacteria	6178
114	Ga0075430_100164059	3300006846	Bacteria	1849
115	Ga0075431_100053565	3300006847	Bacteria	4160
116	Ga0075433_10001421	3300006852	Bacteria	17640
117	Ga0075433_10199581	3300006852	Unclassified	1779
118	Ga0075434_100000621	3300006871	Bacteria	27353
119	Ga0075434_100232796	3300006871	Bacteria	1862
120	Ga0075434_100337016	3300006871	Bacteria	1529
121	Ga0075434_100378632	3300006871	Bacteria	1436
122	Ga0075429_100000096	3300006880	Bacteria	47975
123	Ga0068865_100000149	3300006881	Bacteria	37769
124	Ga0068865_100060475	3300006881	Bacteria	2653
125	Ga0068865_100076304	3300006881	Bacteria	2392
126	Ga0068865_100208602	3300006881	Unclassified	1521
127	Ga0075436_100002057	3300006914	Bacteria	13866
128	Ga0075436_100002295	3300006914	Bacteria	13196
129	Ga0075436_100004725	3300006914	Bacteria	9344
130	Ga0075436_100016335	3300006914	Bacteria	5082
131	Ga0075436_100018953	3300006914	Bacteria	4712
132	Ga0097620_100001531	3300006931	Bacteria	23584
133	Ga0097620_100142579	3300006931	Bacteria	2470
134	Ga0075435_100000485	3300007076	Bacteria	24143
135	Ga0075435_100070358	3300007076	Bacteria	2856
136	Ga0075435_100346564	3300007076	Bacteria	1273
137	Ga0099795_10037098	3300007788	Bacteria	1714
138	Ga0099795_10060513	3300007788	Bacteria	1404
139	Ga0105240_10296262	3300009093	Bacteria	1852
140	Ga0111539_10086522	3300009094	Bacteria	3683
141	Ga0105245_10004647	3300009098	Bacteria	12131
142	Ga0105245_10109153	3300009098	Unclassified	2571
143	Ga0114129_10001405	3300009147	Bacteria	32472
144	Ga0105243_10000577	3300009148	Bacteria	36910
145	Ga0105243_10076683	3300009148	Bacteria	2717
146	Ga0105241_10029327	3300009174	Bacteria	4105
147	Ga0105242_10001966	3300009176	Bacteria	16164
148	Ga0105242_10007977	3300009176	Bacteria	8156
149	Ga0105242_10567009	3300009176	Bacteria	1091
150	Ga0105242_10739365	3300009176	Bacteria	967
151	Ga0105248_10096986	3300009177	Bacteria	3322
152	Ga0105248_10746969	3300009177	Bacteria	1104
153	Ga0105238_10053881	3300009551	Bacteria	4042
154	Ga0105238_10506695	3300009551	Unclassified	1208
155	Ga0157370_10007069	3300013104	Bacteria	12260
156	Ga0157370_10326146	3300013104	Bacteria	1416
157	Ga0157369_10001315	3300013105	Bacteria	30866
158	Ga0157378_10000498	3300013297	Bacteria	37271
159	Ga0157378_10018846	3300013297	Bacteria	6066
160	Ga0157378_10482211	3300013297	Bacteria	1236
161	Ga0163162_10120206	3300013306	Bacteria	2730
162	Ga0157372_10006079	3300013307	Bacteria	12828
163	Ga0157372_10027785	3300013307	Bacteria	6166
164	Ga0157372_10069065	3300013307	Bacteria	3974
165	Ga0157372_10455407	3300013307	Unclassified	1491
166	Ga0157375_10191791	3300013308	Bacteria	2198
167	Ga0157375_10884178	3300013308	Bacteria	1038
168	Ga0157380_10027480	3300014326	Bacteria	4327
169	Ga0157377_10009874	3300014745	Bacteria	4704
170	Ga0157379_10044048	3300014968	Bacteria	3985
171	Ga0157379_10243386	3300014968	Bacteria	1632
172	Ga0157376_10050371	3300014969	Bacteria	3455
173	Ga0213876_10035289	3300021384	Bacteria	2638
174	Ga0207642_10001078	3300025899	Bacteria	8457
175	Ga0207680_10034095	3300025903	Bacteria	2910
176	Ga0207643_10089030	3300025908	Bacteria	1797
177	Ga0207705_10203627	3300025909	Bacteria	1500
178	Ga0207707_10003327	3300025912	Bacteria	14280
179	Ga0207707_10003466	3300025912	Bacteria	13973
180	Ga0207707_10038175	3300025912	Bacteria	4197
181	Ga0207707_10058386	3300025912	Bacteria	3358
182	Ga0207707_10270087	3300025912	Bacteria	1474
183	Ga0207695_10059044	3300025913	Bacteria	3980
184	Ga0207695_10222089	3300025913	Bacteria	1796
185	Ga0207660_10001260	3300025917	Bacteria	16983
186	Ga0207660_10018374	3300025917	Bacteria	4659
187	Ga0207660_10105726	3300025917	Bacteria	2110
188	Ga0207662_10000099	3300025918	Bacteria	40931
189	Ga0207657_10399965	3300025919	Unclassified	1080
190	Ga0207652_10029949	3300025921	Bacteria	4556
191	Ga0207652_10033989	3300025921	Bacteria	4295
192	Ga0207652_10100535	3300025921	Bacteria	2553
193	Ga0207652_10106744	3300025921	Bacteria	2479
194	Ga0207652_10328221	3300025921	Bacteria	1381
195	Ga0207646_10241329	3300025922	Bacteria	1632
196	Ga0207694_10253298	3300025924	Bacteria	1441
197	Ga0207694_10309434	3300025924	Bacteria	1302
198	Ga0207659_10039288	3300025926	Bacteria	3299
199	Ga0207659_10409667	3300025926	Bacteria	1135
200	Ga0207687_10000777	3300025927	Bacteria	21510
201	Ga0207687_10068080	3300025927	Bacteria	2535
202	Ga0207687_10177460	3300025927	Bacteria	1648
203	Ga0207664_10226554	3300025929	Bacteria	1623
204	Ga0207686_10000295	3300025934	Bacteria	36702
205	Ga0207686_10004657	3300025934	Bacteria	7350
206	Ga0207686_10209887	3300025934	Bacteria	1399
207	Ga0207709_10003302	3300025935	Bacteria	9674
208	Ga0207670_10001165	3300025936	Bacteria	13862
209	Ga0207670_10045016	3300025936	Bacteria	2923
210	Ga0207670_10065568	3300025936	Bacteria	2492
211	Ga0207670_10216470	3300025936	Bacteria	1464
212	Ga0207670_10339035	3300025936	Bacteria	1187
213	Ga0207669_10374201	3300025937	Bacteria	1108
214	Ga0207704_10000641	3300025938	Bacteria	15466
215	Ga0207704_10079626	3300025938	Unclassified	2112
216	Ga0207704_10098183	3300025938	Bacteria	1945
217	Ga0207665_10028700	3300025939	Bacteria	3677
218	Ga0207691_10259461	3300025940	Bacteria	1498
219	Ga0207689_10000432	3300025942	Bacteria	39235
220	Ga0207667_10010246	3300025949	Bacteria	10972
221	Ga0207667_10109099	3300025949	Bacteria	2855
222	Ga0207667_10118954	3300025949	Bacteria	2723
223	Ga0207712_10004115	3300025961	Bacteria	9184
224	Ga0207640_10002706	3300025981	Bacteria	9485
225	Ga0207677_10002882	3300026023	Bacteria	9081
226	Ga0207703_10000781	3300026035	Bacteria	31328
227	Ga0207639_10049445	3300026041	Bacteria	3188
228	Ga0207639_10105843	3300026041	Bacteria	2283
229	Ga0207708_10000412	3300026075	Bacteria	33576
230	Ga0207708_10024888	3300026075	Bacteria	4530
231	Ga0207702_10051811	3300026078	Bacteria	3471
232	Ga0207702_10103297	3300026078	Bacteria	2521
233	Ga0207641_10090571	3300026088	Bacteria	2675
234	Ga0207641_10229371	3300026088	Bacteria	1725
235	Ga0207641_10497928	3300026088	Bacteria	1183
236	Ga0207648_10000603	3300026089	Bacteria	40455
237	Ga0207648_10108076	3300026089	Unclassified	2442
238	Ga0207676_10010309	3300026095	Bacteria	6654
239	Ga0207674_10314950	3300026116	Unclassified	1514
240	Ga0207675_100000509	3300026118	Bacteria	37679
241	Ga0207698_10012296	3300026142	Bacteria	5595
242	Ga0207698_10031342	3300026142	Bacteria	3836
243	Ga0207428_10001166	3300027907	Bacteria	28282
244	Ga0207428_10009266	3300027907	Bacteria	8838
245	Ga0268265_10003883	3300028380	Bacteria	10552
246	Ga0268264_10001100	3300028381	Bacteria	26695
247	Ga0268264_10064756	3300028381	Bacteria	3077
248	Ga0307408_100249630	3300031548	Bacteria	1463
249	Ga0307406_10296671	3300031901	Bacteria	1240
250	Ga0307412_10109447	3300031911	Bacteria	1970
251	Ga0307412_10289456	3300031911	Unclassified	1290
252	Ga0307409_100417642	3300031995	Bacteria	1286
253	Ga0307409_100848735	3300031995	Bacteria	924
254	Ga0307416_100115881	3300032002	Bacteria	2374
255	Ga0373930_0024098	3300034816	Bacteria	1215
256	Ga0373930_0029255	3300034816	Bacteria	1125
257	Ga0373948_0043653	3300034817	Bacteria	945
258	Ga0373938_0011857	3300034957	Bacteria	1628
259	Ga0373926_0001396	3300035083	Bacteria	7315
260	Ga0373934_0001052	3300035086	Bacteria	9979
261	Ga0373934_0069446	3300035086	Bacteria	1408
262	Ga0373944_0065812	3300035089	Bacteria	1171
263	Ga0373951_0037390	3300035091	Bacteria	1161
264	Ga0373932_0002695	3300035112	Bacteria	4420
265	Ga0373936_0008146	3300035113	Bacteria	3940
266	Ga0373939_0054531	3300035114	Bacteria	1252
267	Ga0373941_0119701	3300035115	Bacteria	937
268	Ga0373953_0011569	3300035117	Bacteria	3101
269	Ga0373960_0015714	3300035121	Unclassified	1936
270	Ga0373960_0023563	3300035121	Bacteria	1659
271	Ga0373943_0051722	3300035170	Bacteria	2023
272	Ga0373943_0363834	3300035170	Bacteria	831
273	Ga0373955_0095248	3300035172	Bacteria	1702
274	Ga0373961_0008675	3300035241	Unclassified	2476
275	Ga0373931_0015506	3300035691	Bacteria	3739
276	Ga0373931_0017023	3300035691	Unclassified	3587
277	Ga0373931_0025175	3300035691	Bacteria	3022
278	Ga0373931_0121664	3300035691	Bacteria	1492
279	Ga0373935_0140265	3300035692	Unclassified	1632
280	Ga0373927_0020836	3300035695	Bacteria	4297
281	Ga0373933_0006435	3300035724	Bacteria	6395
282	Ga0373947_0010782	3300035725	Bacteria	5243
283	Ga0373937_0000480	3300036401	Bacteria	36669
284	Ga0373937_0023105	3300036401	Bacteria	5595
285	Ga0373937_0074137	3300036401	Bacteria	3140
286	Ga0373937_0302798	3300036401	Bacteria	1511
287	Ga0373925_0064200	3300037068	Bacteria	2763
288	Ga0395899_0031552	3300037312	Bacteria	3982
289	Ga0395905_0001763	3300037471	Bacteria	25156
290	Ga0395901_0042928	3300038443	Bacteria	4690
291	Ga0436365_0112315	3300039437	Bacteria	5736
292	Ga0439441_007974	3300042001	Bacteria	1720
293	Ga0451577_0041592	3300042876	Bacteria	4125
294	Ga0451577_0483760	3300042876	Unclassified	1124
295	Ga0466966_0185837	3300044684	Bacteria	1260
296	Ga0466961_0261882	3300044693	Bacteria	1060
297	Ga0466957_0043099	3300044842	Bacteria	2731
298	Ga0451576_0000927	3300045051	Bacteria	55291
299	Ga0451576_0129536	3300045051	Bacteria	2629
300	Ga0451576_0490836	3300045051	Bacteria	1290
301	Ga0451576_0701335	3300045051	Bacteria	1063
302	Ga0466958_0069294	3300045836	Bacteria	2156
303	Ga0466967_0015255	3300045976	Bacteria	6018
304	Ga0495592_0009882	3300046454	Bacteria	7185
305	Ga0495592_0034924	3300046454	Bacteria	3789
306	Ga0495592_0045312	3300046454	Bacteria	3282
307	Ga0495592_0144277	3300046454	Bacteria	1652
308	Ga0495603_0005362	3300046455	Bacteria	7647
309	Ga0495629_0062592	3300046459	Bacteria	2599
310	Ga0495651_0008591	3300046462	Bacteria	7828
311	Ga0495651_0033218	3300046462	Bacteria	4025
312	Ga0495580_0028853	3300046472	Bacteria	4031
313	Ga0495639_0056148	3300046475	Bacteria	1797
314	Ga0495584_0051516	3300046491	Bacteria	2072
315	Ga0495585_0000287	3300046492	Bacteria	50518
316	Ga0495585_0001520	3300046492	Bacteria	18010
317	Ga0495594_0068983	3300046499	Bacteria	1964
318	Ga0495596_0002017	3300046500	Bacteria	11179
319	Ga0495583_0017836	3300046506	Bacteria	3756
320	Ga0495608_0040622	3300046511	Bacteria	3116
321	Ga0495608_0049120	3300046511	Unclassified	2801
322	Ga0495628_0034782	3300046516	Bacteria	4051
323	Ga0495628_0088530	3300046516	Bacteria	2399
324	Ga0495628_0169305	3300046516	Bacteria	1657
325	Ga0495630_0021421	3300046517	Bacteria	4773
326	Ga0495630_0103982	3300046517	Bacteria	2149
327	Ga0495631_0003930	3300046518	Bacteria	8029
328	Ga0495643_0024732	3300046522	Bacteria	3404
329	Ga0495644_0014689	3300046523	Bacteria	2999
330	Ga0495648_0016654	3300046524	Bacteria	5290
331	Ga0495666_0040516	3300046526	Bacteria	2258
332	Ga0495642_0083224	3300046528	Bacteria	1350
333	Ga0495652_0022002	3300046529	Bacteria	5664
334	Ga0495652_0045593	3300046529	Bacteria	3768
335	Ga0495640_0055691	3300046533	Bacteria	2705
336	Ga0495586_0002442	3300046535	Bacteria	10085
337	Ga0495586_0013205	3300046535	Bacteria	4379
338	Ga0495586_0030151	3300046535	Bacteria	2903
339	Ga0495587_0003948	3300046536	Bacteria	9836
340	Ga0495587_0131862	3300046536	Bacteria	1428
341	Ga0495598_0079482	3300046537	Bacteria	1049
342	Ga0495609_0002760	3300046538	Bacteria	10570
343	Ga0495609_0040353	3300046538	Unclassified	2100
344	Ga0495621_0026282	3300046539	Bacteria	1962
345	Ga0495645_0000372	3300046543	Bacteria	31206
346	Ga0495645_0013911	3300046543	Bacteria	5703
347	Ga0495667_0014118	3300046559	Bacteria	5391
348	Ga0495667_0042412	3300046559	Unclassified	3017
349	Ga0495656_0056194	3300046615	Bacteria	1700
350	Ga0495668_0033663	3300046616	Bacteria	2877
351	Ga0495611_0064210	3300046648	Bacteria	1671
352	Ga0495635_0048050	3300046663	Bacteria	2942
353	Ga0495635_0050824	3300046663	Bacteria	2857
354	Ga0495659_0000447	3300046664	Bacteria	15414
355	Ga0495659_0012106	3300046664	Bacteria	2789
356	Ga0495661_0092491	3300046665	Unclassified	1718
357	Ga0495661_0189030	3300046665	Unclassified	1086
358	Ga0495588_0024694	3300046674	Bacteria	2987
359	Ga0495657_0050937	3300046675	Unclassified	2782
360	Ga0495599_0006891	3300046678	Bacteria	6867
361	Ga0495599_0061567	3300046678	Bacteria	2345
362	Ga0495623_0014417	3300046679	Bacteria	5115
363	Ga0495658_0028314	3300046683	Bacteria	3023
364	Ga0495658_0124874	3300046683	Bacteria	1560
365	Ga0495669_0059363	3300046684	Bacteria	1727
366	Ga0495624_0217260	3300046690	Bacteria	1159
367	Ga0495670_0082273	3300046691	Unclassified	1641
368	Ga0495589_0022998	3300046794	Bacteria	3176
369	Ga0495600_0040389	3300046809	Bacteria	3038
370	Ga0495581_0032039	3300047315	Bacteria	3044
371	Ga0495604_0061351	3300047317	Bacteria	2876
372	Ga0495636_0014013	3300047318	Bacteria	3186
373	Ga0495636_0080938	3300047318	Unclassified	1398
374	Ga0495636_0211716	3300047318	Unclassified	888
375	Ga0495674_0498678	3300047319	Bacteria	974
376	Ga0495676_0060220	3300047321	Bacteria	2977
377	Ga0495680_0043085	3300047322	Bacteria	3576
378	Ga0495680_0267405	3300047322	Bacteria	1208
379	Ga0495683_0013604	3300047323	Bacteria	4252
380	Ga0495677_0060567	3300047445	Unclassified	1403
381	Ga0495626_0004924	3300048091	Bacteria	8014
382	Ga0495626_0013208	3300048091	Bacteria	4298
383	Ga0496115_0005695	3300048918	Bacteria	9065
384	Ga0501033_0011977	3300049570	Bacteria	6626
385	Ga0501033_0060402	3300049570	Bacteria	2797
386	Ga0501036_0022679	3300049572	Bacteria	5283
387	Ga0501037_0014437	3300049573	Bacteria	5813
388	Ga0501040_0051958	3300049576	Bacteria	2804
389	Ga0501041_0013026	3300049577	Bacteria	4926
390	Ga0501041_0013436	3300049577	Bacteria	4854
391	Ga0501042_0016787	3300049578	Bacteria	5033
392	Ga0501042_0058796	3300049578	Bacteria	2744
393	Ga0501046_0012953	3300049580	Bacteria	7085
394	Ga0501047_0144168	3300049581	Bacteria	2259
395	Ga0501048_0022769	3300049582	Bacteria	4580
396	Ga0501068_0048337	3300049584	Bacteria	2568
397	Ga0501068_0093543	3300049584	Bacteria	1857
398	Ga0501069_0007993	3300049585	Bacteria	5554
399	Ga0501069_0110397	3300049585	Bacteria	1566
400	Ga0501070_0000520	3300049586	Bacteria	35280
401	Ga0501070_0413004	3300049586	Bacteria	1091
402	Ga0501072_0002114	3300049588	Bacteria	14797
403	Ga0501073_0001617	3300049589	Bacteria	16692
404	Ga0501073_0079114	3300049589	Bacteria	2288
405	Ga0501074_0032569	3300049590	Bacteria	3775
406	Ga0501075_0005791	3300049591	Bacteria	8455
407	Ga0501075_0051004	3300049591	Bacteria	3111
408	Ga0501076_0001218	3300049592	Bacteria	17111
409	Ga0501077_0006977	3300049593	Bacteria	6958
410	Ga0501225_0071686	3300049705	Bacteria	985
411	Ga0501079_0001515	3300049741	Bacteria	16443
412	Ga0501079_0211860	3300049741	Bacteria	1513
413	Ga0501080_0010186	3300049742	Bacteria	8595
414	Ga0501080_0077367	3300049742	Bacteria	3094
415	Ga0501080_0109322	3300049742	Bacteria	2562
416	Ga0501081_0014737	3300049743	Bacteria	5157
417	Ga0501081_0084931	3300049743	Bacteria	2221
418	Ga0501083_0001545	3300049744	Bacteria	15735
419	Ga0501044_0647181	3300049823	Bacteria	946
420	Ga0501045_0001660	3300049824	Bacteria	14966
421	nmdc:mga05p37_227111_c1	3300050507	Bacteria	2250
422	nmdc:mga05p37_331_c1	3300050507	Bacteria	50709
423	nmdc:mga09592_618_c1	3300050508	Bacteria	27081
424	nmdc:mga0qj67_7277_c1	3300050509	Bacteria	8177
425	nmdc:mga06r32_23555_c2	3300050510	Bacteria	5180
426	nmdc:mga08y16_13335_c1	3300050511	Bacteria	8646
427	nmdc:mga08y16_35813_c1	3300050511	Bacteria	5213
428	nmdc:mga0n895_22197_c1	3300050512	Bacteria	5950
429	nmdc:mga0n895_279647_c1	3300050512	Bacteria	1692
430	nmdc:mga0n895_38916_c1	3300050512	Bacteria	4610
431	nmdc:mga0n895_45616_c1	3300050512	Bacteria	4278
432	nmdc:mga0rr50_179810_c1	3300050513	Bacteria	1728
433	nmdc:mga0rr50_765_c1	3300050513	Bacteria	17289
434	nmdc:mga08x19_11111_c1	3300050514	Bacteria	4877
435	nmdc:mga08x19_1872_c1	3300050514	Bacteria	12891
436	nmdc:mga08x19_27983_c1	3300050514	Bacteria	3528
437	nmdc:mga08x19_77048_c1	3300050514	Bacteria	2183
438	nmdc:mga08x19_877_c1	3300050514	Bacteria	19125
439	nmdc:mga0a205_2581_c1	3300050515	Bacteria	15986
440	Ga0495601_0011617	3300053077	Bacteria	5275
441	Ga0495601_0046155	3300053077	Bacteria	2742
442	Ga0495601_0148073	3300053077	Bacteria	1532
443	Ga0495655_0101223	3300053083	Bacteria	853
444	Ga0495619_0445877	3300053085	Bacteria	892
445	Ga0501084_0020318	3300054114	Bacteria	5537
446	Ga0501084_0060389	3300054114	Bacteria	3174
447	Ga0501082_0019300	3300060353	Bacteria	5877
448	Ga0501082_0505271	3300060353	Bacteria	1056
449	Ga0466962_0153987	3300061719	Bacteria	1116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050514	nmdc:mga08x19_11111_c1	nmdc:mga08x19_11111_c1_2367_3101	244
2	3300046664	Ga0495659_0012106	Ga0495659_0012106_1459_2202	245
3	3300053077	Ga0495601_0148073	Ga0495601_0148073_442_1188	245
4	3300049741	Ga0501079_0211860	Ga0501079_0211860_42_797	251
5	3300053083	Ga0495655_0101223	Ga0495655_0101223_39_830	251
6	3300042876	Ga0451577_0483760	Ga0451577_0483760_113_919	252
7	3300005518	Ga0070699_100042427	Ga0070699_1000424273	254
8	3300035170	Ga0373943_0363834	Ga0373943_0363834_36_815	254
9	3300047318	Ga0495636_0211716	Ga0495636_0211716_95_871	254
10	3300060353	Ga0501082_0505271	Ga0501082_0505271_257_1036	254
11	3300005330	Ga0070690_100361798	Ga0070690_1003617982	256
12	3300005340	Ga0070689_100409348	Ga0070689_1004093482	256
13	3300005441	Ga0070700_100027382	Ga0070700_1000273823	256
14	3300006871	Ga0075434_100232796	Ga0075434_1002327962	256
15	3300009176	Ga0105242_10739365	Ga0105242_107393652	256
16	3300025936	Ga0207670_10216470	Ga0207670_102164702	256
17	3300025936	Ga0207670_10339035	Ga0207670_103390352	256
18	3300036401	Ga0373937_0074137	Ga0373937_0074137_1312_2082	256
19	3300045976	Ga0466967_0015255	Ga0466967_0015255_3208_4011	256
20	3300046454	Ga0495592_0144277	Ga0495592_0144277_719_1489	256
21	3300046511	Ga0495608_0040622	Ga0495608_0040622_1305_2075	256
22	3300046516	Ga0495628_0034782	Ga0495628_0034782_857_1627	256
23	3300046526	Ga0495666_0040516	Ga0495666_0040516_1305_2075	256
24	3300046535	Ga0495586_0013205	Ga0495586_0013205_2144_2914	256
25	3300046536	Ga0495587_0131862	Ga0495587_0131862_142_912	256
26	3300046559	Ga0495667_0014118	Ga0495667_0014118_1924_2694	256
27	3300046663	Ga0495635_0050824	Ga0495635_0050824_1434_2204	256
28	3300046678	Ga0495599_0061567	Ga0495599_0061567_236_1006	256
29	3300046809	Ga0495600_0040389	Ga0495600_0040389_2170_2940	256
30	3300047317	Ga0495604_0061351	Ga0495604_0061351_1122_1892	256
31	3300047319	Ga0495674_0498678	Ga0495674_0498678_156_926	256
32	3300047322	Ga0495680_0043085	Ga0495680_0043085_705_1475	256
33	3300050512	nmdc:mga0n895_279647_c1	nmdc:mga0n895_279647_c1_848_1642	256
34	3300053077	Ga0495601_0046155	Ga0495601_0046155_1133_1903	256
35	3300053085	Ga0495619_0445877	Ga0495619_0445877_55_825	256
36	3300005336	Ga0070680_100056354	Ga0070680_1000563542	258
37	3300005458	Ga0070681_10104476	Ga0070681_101044763	258
38	3300005530	Ga0070679_100002303	Ga0070679_1000023033	258
39	3300007788	Ga0099795_10060513	Ga0099795_100605132	258
40	3300025912	Ga0207707_10003327	Ga0207707_100033273	258
41	3300025917	Ga0207660_10018374	Ga0207660_100183747	258
42	3300025921	Ga0207652_10033989	Ga0207652_100339894	258
43	3300049591	Ga0501075_0051004	Ga0501075_0051004_797_1579	258
44	3300005458	Ga0070681_10006508	Ga0070681_100065087	259
45	3300005530	Ga0070679_100020254	Ga0070679_1000202544	259
46	3300005840	Ga0068870_10096558	Ga0068870_100965582	259
47	3300025908	Ga0207643_10089030	Ga0207643_100890302	259
48	3300025912	Ga0207707_10003466	Ga0207707_1000346611	259
49	3300025921	Ga0207652_10328221	Ga0207652_103282212	259
50	3300035121	Ga0373960_0015714	Ga0373960_0015714_415_1203	259
51	3300035241	Ga0373961_0008675	Ga0373961_0008675_723_1511	259
52	3300035691	Ga0373931_0017023	Ga0373931_0017023_2217_3005	259
53	3300049570	Ga0501033_0060402	Ga0501033_0060402_145_990	259
54	3300049577	Ga0501041_0013436	Ga0501041_0013436_3661_4506	259
55	3300049578	Ga0501042_0058796	Ga0501042_0058796_1708_2553	259
56	3300032002	Ga0307416_100115881	Ga0307416_1001158812	260
57	3300046615	Ga0495656_0056194	Ga0495656_0056194_567_1355	260
58	3300005440	Ga0070705_100159385	Ga0070705_1001593852	261
59	3300005444	Ga0070694_100101766	Ga0070694_1001017662	261
60	3300005518	Ga0070699_100157095	Ga0070699_1001570952	261
61	3300005545	Ga0070695_100012890	Ga0070695_1000128905	261
62	3300005549	Ga0070704_100037038	Ga0070704_1000370383	261
63	3300006846	Ga0075430_100000498	Ga0075430_1000004989	261
64	3300006846	Ga0075430_100017098	Ga0075430_1000170983	261
65	3300007076	Ga0075435_100070358	Ga0075435_1000703582	261
66	3300013104	Ga0157370_10326146	Ga0157370_103261462	261
67	3300046459	Ga0495629_0062592	Ga0495629_0062592_1296_2081	261
68	3300046516	Ga0495628_0169305	Ga0495628_0169305_42_827	261
69	3300046517	Ga0495630_0021421	Ga0495630_0021421_106_891	261
70	3300046533	Ga0495640_0055691	Ga0495640_0055691_12_797	261
71	3300046535	Ga0495586_0030151	Ga0495586_0030151_642_1427	261
72	3300046690	Ga0495624_0217260	Ga0495624_0217260_45_830	261
73	3300049743	Ga0501081_0084931	Ga0501081_0084931_1223_2014	261
74	3300050509	nmdc:mga0qj67_7277_c1	nmdc:mga0qj67_7277_c1_4549_5340	261
75	3300050512	nmdc:mga0n895_38916_c1	nmdc:mga0n895_38916_c1_1707_2492	261
76	3300050513	nmdc:mga0rr50_179810_c1	nmdc:mga0rr50_179810_c1_425_1210	261
77	3300050514	nmdc:mga08x19_77048_c1	nmdc:mga08x19_77048_c1_734_1519	261
78	3300005336	Ga0070680_100086257	Ga0070680_1000862572	262
79	3300005518	Ga0070699_100007817	Ga0070699_1000078179	262
80	3300005539	Ga0068853_100073359	Ga0068853_1000733592	262
81	3300006914	Ga0075436_100002057	Ga0075436_10000205710	262
82	3300006914	Ga0075436_100004725	Ga0075436_10000472510	262
83	3300007076	Ga0075435_100346564	Ga0075435_1003465641	262
84	3300013104	Ga0157370_10007069	Ga0157370_1000706912	262
85	3300013307	Ga0157372_10027785	Ga0157372_100277852	262
86	3300025912	Ga0207707_10270087	Ga0207707_102700872	262
87	3300025917	Ga0207660_10105726	Ga0207660_101057262	262
88	3300025919	Ga0207657_10399965	Ga0207657_103999651	262
89	3300026041	Ga0207639_10049445	Ga0207639_100494453	262
90	3300026078	Ga0207702_10051811	Ga0207702_100518112	262
91	3300026142	Ga0207698_10012296	Ga0207698_100122963	262
92	3300049585	Ga0501069_0110397	Ga0501069_0110397_488_1282	262
93	3300049705	Ga0501225_0071686	Ga0501225_0071686_51_845	262
94	3300050507	nmdc:mga05p37_227111_c1	nmdc:mga05p37_227111_c1_492_1286	262
95	3300050514	nmdc:mga08x19_1872_c1	nmdc:mga08x19_1872_c1_8904_9707	262
96	3300005444	Ga0070694_100436936	Ga0070694_1004369361	263
97	3300005468	Ga0070707_100193028	Ga0070707_1001930282	263
98	3300005518	Ga0070699_100177886	Ga0070699_1001778862	263
99	3300005985	Ga0081539_10071362	Ga0081539_100713623	263
100	3300005330	Ga0070690_100106024	Ga0070690_1001060242	264
101	3300005343	Ga0070687_100195383	Ga0070687_1001953831	264
102	3300005345	Ga0070692_10079641	Ga0070692_100796412	264
103	3300005438	Ga0070701_10035418	Ga0070701_100354183	264
104	3300005458	Ga0070681_10039880	Ga0070681_100398804	264
105	3300005617	Ga0068859_100142583	Ga0068859_1001425832	264
106	3300005842	Ga0068858_100172481	Ga0068858_1001724813	264
107	3300005843	Ga0068860_100301336	Ga0068860_1003013362	264
108	3300006871	Ga0075434_100378632	Ga0075434_1003786322	264
109	3300006931	Ga0097620_100142579	Ga0097620_1001425792	264
110	3300025912	Ga0207707_10038175	Ga0207707_100381753	264
111	3300025927	Ga0207687_10068080	Ga0207687_100680802	264
112	3300035086	Ga0373934_0001052	Ga0373934_0001052_7779_8585	264
113	3300035117	Ga0373953_0011569	Ga0373953_0011569_2273_3079	264
114	3300035172	Ga0373955_0095248	Ga0373955_0095248_278_1084	264
115	3300035724	Ga0373933_0006435	Ga0373933_0006435_252_1058	264
116	3300036401	Ga0373937_0000480	Ga0373937_0000480_4102_4908	264
117	3300037068	Ga0373925_0064200	Ga0373925_0064200_1758_2585	264
118	3300046454	Ga0495592_0009882	Ga0495592_0009882_3960_4787	264
119	3300046462	Ga0495651_0008591	Ga0495651_0008591_5458_6264	264
120	3300046529	Ga0495652_0022002	Ga0495652_0022002_3710_4537	264
121	3300046539	Ga0495621_0026282	Ga0495621_0026282_806_1618	264
122	3300046543	Ga0495645_0000372	Ga0495645_0000372_26315_27142	264
123	3300046678	Ga0495599_0006891	Ga0495599_0006891_946_1773	264
124	3300047322	Ga0495680_0267405	Ga0495680_0267405_87_893	264
125	3300005327	Ga0070658_10210709	Ga0070658_102107092	265
126	3300005333	Ga0070677_10050730	Ga0070677_100507302	265
127	3300005340	Ga0070689_100023944	Ga0070689_1000239442	265
128	3300005340	Ga0070689_100259121	Ga0070689_1002591212	265
129	3300005354	Ga0070675_100317115	Ga0070675_1003171151	265
130	3300005366	Ga0070659_100038956	Ga0070659_1000389564	265
131	3300005441	Ga0070700_100250674	Ga0070700_1002506741	265
132	3300005459	Ga0068867_100246750	Ga0068867_1002467502	265
133	3300005466	Ga0070685_10343006	Ga0070685_103430061	265
134	3300005535	Ga0070684_100220695	Ga0070684_1002206952	265
135	3300005543	Ga0070672_100364851	Ga0070672_1003648512	265
136	3300005547	Ga0070693_100146137	Ga0070693_1001461372	265
137	3300005563	Ga0068855_100008189	Ga0068855_1000081896	265
138	3300005563	Ga0068855_100318145	Ga0068855_1003181452	265
139	3300005614	Ga0068856_100303682	Ga0068856_1003036822	265
140	3300005615	Ga0070702_100256679	Ga0070702_1002566791	265
141	3300005616	Ga0068852_100001065	Ga0068852_10000106516	265
142	3300005616	Ga0068852_100092079	Ga0068852_1000920792	265
143	3300005616	Ga0068852_100289184	Ga0068852_1002891842	265
144	3300005842	Ga0068858_100260116	Ga0068858_1002601162	265
145	3300006237	Ga0097621_100008366	Ga0097621_1000083664	265
146	3300006881	Ga0068865_100060475	Ga0068865_1000604752	265
147	3300006881	Ga0068865_100076304	Ga0068865_1000763042	265
148	3300006881	Ga0068865_100208602	Ga0068865_1002086022	265
149	3300007788	Ga0099795_10037098	Ga0099795_100370982	265
150	3300009093	Ga0105240_10296262	Ga0105240_102962622	265
151	3300009098	Ga0105245_10109153	Ga0105245_101091532	265
152	3300009148	Ga0105243_10076683	Ga0105243_100766832	265
153	3300009176	Ga0105242_10007977	Ga0105242_100079774	265
154	3300009176	Ga0105242_10567009	Ga0105242_105670092	265
155	3300009177	Ga0105248_10096986	Ga0105248_100969864	265
156	3300009177	Ga0105248_10746969	Ga0105248_107469692	265
157	3300009551	Ga0105238_10053881	Ga0105238_100538812	265
158	3300009551	Ga0105238_10506695	Ga0105238_105066952	265
159	3300013105	Ga0157369_10001315	Ga0157369_100013152	265
160	3300013297	Ga0157378_10018846	Ga0157378_100188465	265
161	3300013297	Ga0157378_10482211	Ga0157378_104822112	265
162	3300013306	Ga0163162_10120206	Ga0163162_101202063	265
163	3300013307	Ga0157372_10006079	Ga0157372_100060794	265
164	3300013307	Ga0157372_10069065	Ga0157372_100690652	265
165	3300013307	Ga0157372_10455407	Ga0157372_104554072	265
166	3300013308	Ga0157375_10191791	Ga0157375_101917913	265
167	3300014326	Ga0157380_10027480	Ga0157380_100274804	265
168	3300014968	Ga0157379_10044048	Ga0157379_100440483	265
169	3300014969	Ga0157376_10050371	Ga0157376_100503713	265
170	3300021384	Ga0213876_10035289	Ga0213876_100352893	265
171	3300025909	Ga0207705_10203627	Ga0207705_102036272	265
172	3300025913	Ga0207695_10059044	Ga0207695_100590442	265
173	3300025913	Ga0207695_10222089	Ga0207695_102220892	265
174	3300025921	Ga0207652_10106744	Ga0207652_101067443	265
175	3300025924	Ga0207694_10253298	Ga0207694_102532982	265
176	3300025924	Ga0207694_10309434	Ga0207694_103094342	265
177	3300025926	Ga0207659_10409667	Ga0207659_104096672	265
178	3300025927	Ga0207687_10177460	Ga0207687_101774602	265
179	3300025934	Ga0207686_10004657	Ga0207686_100046578	265
180	3300025934	Ga0207686_10209887	Ga0207686_102098872	265
181	3300025936	Ga0207670_10065568	Ga0207670_100655683	265
182	3300025937	Ga0207669_10374201	Ga0207669_103742012	265
183	3300025938	Ga0207704_10079626	Ga0207704_100796262	265
184	3300025938	Ga0207704_10098183	Ga0207704_100981832	265
185	3300025940	Ga0207691_10259461	Ga0207691_102594612	265
186	3300025949	Ga0207667_10109099	Ga0207667_101090993	265
187	3300025949	Ga0207667_10118954	Ga0207667_101189542	265
188	3300026075	Ga0207708_10024888	Ga0207708_100248884	265
189	3300026088	Ga0207641_10497928	Ga0207641_104979281	265
190	3300026089	Ga0207648_10108076	Ga0207648_101080763	265
191	3300026116	Ga0207674_10314950	Ga0207674_103149502	265
192	3300026142	Ga0207698_10031342	Ga0207698_100313424	265
193	3300027907	Ga0207428_10009266	Ga0207428_100092667	265
194	3300031548	Ga0307408_100249630	Ga0307408_1002496302	265
195	3300031901	Ga0307406_10296671	Ga0307406_102966711	265
196	3300031911	Ga0307412_10109447	Ga0307412_101094473	265
197	3300031911	Ga0307412_10289456	Ga0307412_102894562	265
198	3300031995	Ga0307409_100848735	Ga0307409_1008487351	265
199	3300034816	Ga0373930_0029255	Ga0373930_0029255_228_1040	265
200	3300036401	Ga0373937_0023105	Ga0373937_0023105_1847_2662	265
201	3300037312	Ga0395899_0031552	Ga0395899_0031552_1650_2468	265
202	3300038443	Ga0395901_0042928	Ga0395901_0042928_3328_4146	265
203	3300039437	Ga0436365_0112315	Ga0436365_0112315_1453_2271	265
204	3300042001	Ga0439441_007974	Ga0439441_007974_249_1073	265
205	3300044684	Ga0466966_0185837	Ga0466966_0185837_143_961	265
206	3300044693	Ga0466961_0261882	Ga0466961_0261882_195_1013	265
207	3300044842	Ga0466957_0043099	Ga0466957_0043099_146_964	265
208	3300045836	Ga0466958_0069294	Ga0466958_0069294_384_1202	265
209	3300046454	Ga0495592_0045312	Ga0495592_0045312_1009_1824	265
210	3300046462	Ga0495651_0033218	Ga0495651_0033218_1895_2710	265
211	3300046511	Ga0495608_0049120	Ga0495608_0049120_1612_2427	265
212	3300046516	Ga0495628_0088530	Ga0495628_0088530_945_1760	265
213	3300046529	Ga0495652_0045593	Ga0495652_0045593_1453_2268	265
214	3300046536	Ga0495587_0003948	Ga0495587_0003948_1314_2129	265
215	3300046537	Ga0495598_0079482	Ga0495598_0079482_173_1000	265
216	3300046543	Ga0495645_0013911	Ga0495645_0013911_1788_2603	265
217	3300046559	Ga0495667_0042412	Ga0495667_0042412_1481_2296	265
218	3300046663	Ga0495635_0048050	Ga0495635_0048050_630_1445	265
219	3300046675	Ga0495657_0050937	Ga0495657_0050937_564_1379	265
220	3300046679	Ga0495623_0014417	Ga0495623_0014417_2864_3679	265
221	3300046683	Ga0495658_0124874	Ga0495658_0124874_20_847	265
222	3300047318	Ga0495636_0014013	Ga0495636_0014013_1677_2489	265
223	3300049581	Ga0501047_0144168	Ga0501047_0144168_24_839	265
224	3300049584	Ga0501068_0048337	Ga0501068_0048337_351_1166	265
225	3300049585	Ga0501069_0007993	Ga0501069_0007993_2775_3590	265
226	3300049586	Ga0501070_0000520	Ga0501070_0000520_11130_11945	265
227	3300049589	Ga0501073_0001617	Ga0501073_0001617_12312_13127	265
228	3300049589	Ga0501073_0079114	Ga0501073_0079114_1145_1960	265
229	3300049590	Ga0501074_0032569	Ga0501074_0032569_1421_2236	265
230	3300049741	Ga0501079_0001515	Ga0501079_0001515_6009_6824	265
231	3300049742	Ga0501080_0010186	Ga0501080_0010186_6241_7056	265
232	3300049742	Ga0501080_0077367	Ga0501080_0077367_82_897	265
233	3300049744	Ga0501083_0001545	Ga0501083_0001545_11318_12133	265
234	3300050511	nmdc:mga08y16_13335_c1	nmdc:mga08y16_13335_c1_7704_8543	265
235	3300053077	Ga0495601_0011617	Ga0495601_0011617_3671_4486	265
236	3300054114	Ga0501084_0060389	Ga0501084_0060389_1056_1871	265
237	3300061719	Ga0466962_0153987	Ga0466962_0153987_80_898	265
238	3300005354	Ga0070675_100004786	Ga0070675_1000047867	266
239	3300005458	Ga0070681_10170111	Ga0070681_101701112	266
240	3300005467	Ga0070706_100175971	Ga0070706_1001759711	266
241	3300005536	Ga0070697_100368380	Ga0070697_1003683802	266
242	3300005549	Ga0070704_100095354	Ga0070704_1000953543	266
243	3300006058	Ga0075432_10048644	Ga0075432_100486442	266
244	3300006852	Ga0075433_10199581	Ga0075433_101995812	266
245	3300006871	Ga0075434_100337016	Ga0075434_1003370162	266
246	3300006914	Ga0075436_100016335	Ga0075436_1000163353	266
247	3300014745	Ga0157377_10009874	Ga0157377_100098743	266
248	3300025926	Ga0207659_10039288	Ga0207659_100392882	266
249	3300025939	Ga0207665_10028700	Ga0207665_100287002	266
250	3300035086	Ga0373934_0069446	Ga0373934_0069446_428_1303	266
251	3300035121	Ga0373960_0023563	Ga0373960_0023563_677_1492	266
252	3300046454	Ga0495592_0034924	Ga0495592_0034924_2134_2967	266
253	3300046491	Ga0495584_0051516	Ga0495584_0051516_425_1240	266
254	3300046492	Ga0495585_0000287	Ga0495585_0000287_38600_39415	266
255	3300046499	Ga0495594_0068983	Ga0495594_0068983_1032_1847	266
256	3300046500	Ga0495596_0002017	Ga0495596_0002017_6339_7154	266
257	3300046506	Ga0495583_0017836	Ga0495583_0017836_1919_2734	266
258	3300046518	Ga0495631_0003930	Ga0495631_0003930_1054_1869	266
259	3300046522	Ga0495643_0024732	Ga0495643_0024732_1122_1937	266
260	3300046523	Ga0495644_0014689	Ga0495644_0014689_1234_2049	266
261	3300046524	Ga0495648_0016654	Ga0495648_0016654_735_1550	266
262	3300046538	Ga0495609_0002760	Ga0495609_0002760_8962_9777	266
263	3300046616	Ga0495668_0033663	Ga0495668_0033663_1489_2304	266
264	3300046648	Ga0495611_0064210	Ga0495611_0064210_833_1648	266
265	3300046664	Ga0495659_0000447	Ga0495659_0000447_1821_2636	266
266	3300046665	Ga0495661_0189030	Ga0495661_0189030_64_879	266
267	3300046691	Ga0495670_0082273	Ga0495670_0082273_429_1244	266
268	3300046794	Ga0495589_0022998	Ga0495589_0022998_970_1785	266
269	3300047318	Ga0495636_0080938	Ga0495636_0080938_509_1324	266
270	3300047321	Ga0495676_0060220	Ga0495676_0060220_1515_2330	266
271	3300047323	Ga0495683_0013604	Ga0495683_0013604_1926_2741	266
272	3300047445	Ga0495677_0060567	Ga0495677_0060567_493_1308	266
273	3300048091	Ga0495626_0013208	Ga0495626_0013208_1596_2411	266
274	3300050512	nmdc:mga0n895_45616_c1	nmdc:mga0n895_45616_c1_557_1363	266
275	3300050514	nmdc:mga08x19_27983_c1	nmdc:mga08x19_27983_c1_1806_2621	266
276	3300003203	JGI25406J46586_10043060	JGI25406J46586_100430602	267
277	3300005295	Ga0065707_10150126	Ga0065707_101501262	267
278	3300005330	Ga0070690_100001141	Ga0070690_1000011412	267
279	3300005334	Ga0068869_100000089	Ga0068869_10000008932	267
280	3300005335	Ga0070666_10185769	Ga0070666_101857692	267
281	3300005336	Ga0070680_100000807	Ga0070680_10000080710	267
282	3300005337	Ga0070682_100014137	Ga0070682_1000141373	267
283	3300005338	Ga0068868_100000554	Ga0068868_1000005548	267
284	3300005340	Ga0070689_100000185	Ga0070689_10000018538	267
285	3300005340	Ga0070689_100073688	Ga0070689_1000736883	267
286	3300005341	Ga0070691_10002337	Ga0070691_100023371	267
287	3300005343	Ga0070687_100000307	Ga0070687_10000030711	267
288	3300005345	Ga0070692_10000165	Ga0070692_100001656	267
289	3300005355	Ga0070671_100490342	Ga0070671_1004903422	267
290	3300005364	Ga0070673_100112695	Ga0070673_1001126952	267
291	3300005438	Ga0070701_10000413	Ga0070701_100004138	267
292	3300005440	Ga0070705_100000541	Ga0070705_10000054115	267
293	3300005441	Ga0070700_100000398	Ga0070700_10000039810	267
294	3300005444	Ga0070694_100000089	Ga0070694_1000000897	267
295	3300005444	Ga0070694_100250348	Ga0070694_1002503482	267
296	3300005445	Ga0070708_100047371	Ga0070708_1000473712	267
297	3300005458	Ga0070681_10004952	Ga0070681_100049523	267
298	3300005458	Ga0070681_10065178	Ga0070681_100651782	267
299	3300005459	Ga0068867_100000803	Ga0068867_1000008037	267
300	3300005467	Ga0070706_100008902	Ga0070706_1000089023	267
301	3300005468	Ga0070707_100096915	Ga0070707_1000969153	267
302	3300005518	Ga0070699_100569104	Ga0070699_1005691041	267
303	3300005530	Ga0070679_100004206	Ga0070679_10000420610	267
304	3300005530	Ga0070679_100182007	Ga0070679_1001820072	267
305	3300005544	Ga0070686_100015485	Ga0070686_1000154852	267
306	3300005545	Ga0070695_100000187	Ga0070695_1000001878	267
307	3300005546	Ga0070696_100001338	Ga0070696_10000133810	267
308	3300005546	Ga0070696_100032326	Ga0070696_1000323262	267
309	3300005547	Ga0070693_100000125	Ga0070693_1000001257	267
310	3300005549	Ga0070704_100000051	Ga0070704_10000005131	267
311	3300005563	Ga0068855_100000741	Ga0068855_10000074111	267
312	3300005563	Ga0068855_100324154	Ga0068855_1003241542	267
313	3300005578	Ga0068854_100004113	Ga0068854_1000041135	267
314	3300005615	Ga0070702_100000541	Ga0070702_1000005412	267
315	3300005616	Ga0068852_100071329	Ga0068852_1000713293	267
316	3300005617	Ga0068859_100001531	Ga0068859_10000153115	267
317	3300005618	Ga0068864_100011457	Ga0068864_1000114576	267
318	3300005718	Ga0068866_10000255	Ga0068866_1000025511	267
319	3300005719	Ga0068861_100000466	Ga0068861_10000046614	267
320	3300005841	Ga0068863_100224661	Ga0068863_1002246613	267
321	3300005841	Ga0068863_100355585	Ga0068863_1003555852	267
322	3300005842	Ga0068858_100003050	Ga0068858_1000030504	267
323	3300005843	Ga0068860_100000810	Ga0068860_10000081029	267
324	3300005843	Ga0068860_100168700	Ga0068860_1001687002	267
325	3300005844	Ga0068862_100000622	Ga0068862_10000062227	267
326	3300005985	Ga0081539_10000784	Ga0081539_1000078418	267
327	3300006237	Ga0097621_100001560	Ga0097621_1000015608	267
328	3300006358	Ga0068871_100001324	Ga0068871_1000013248	267
329	3300006844	Ga0075428_100000835	Ga0075428_10000083510	267
330	3300006846	Ga0075430_100164059	Ga0075430_1001640592	267
331	3300006847	Ga0075431_100053565	Ga0075431_1000535653	267
332	3300006852	Ga0075433_10001421	Ga0075433_1000142111	267
333	3300006871	Ga0075434_100000621	Ga0075434_10000062122	267
334	3300006880	Ga0075429_100000096	Ga0075429_1000000967	267
335	3300006881	Ga0068865_100000149	Ga0068865_1000001498	267
336	3300006914	Ga0075436_100002295	Ga0075436_1000022959	267
337	3300006914	Ga0075436_100018953	Ga0075436_1000189533	267
338	3300006931	Ga0097620_100001531	Ga0097620_10000153115	267
339	3300007076	Ga0075435_100000485	Ga0075435_10000048517	267
340	3300009094	Ga0111539_10086522	Ga0111539_100865222	267
341	3300009098	Ga0105245_10004647	Ga0105245_100046477	267
342	3300009147	Ga0114129_10001405	Ga0114129_100014053	267
343	3300009148	Ga0105243_10000577	Ga0105243_1000057729	267
344	3300009174	Ga0105241_10029327	Ga0105241_100293275	267
345	3300009176	Ga0105242_10001966	Ga0105242_100019662	267
346	3300013297	Ga0157378_10000498	Ga0157378_100004987	267
347	3300013308	Ga0157375_10884178	Ga0157375_108841782	267
348	3300014968	Ga0157379_10243386	Ga0157379_102433862	267
349	3300025899	Ga0207642_10001078	Ga0207642_100010782	267
350	3300025903	Ga0207680_10034095	Ga0207680_100340952	267
351	3300025912	Ga0207707_10058386	Ga0207707_100583862	267
352	3300025917	Ga0207660_10001260	Ga0207660_100012606	267
353	3300025918	Ga0207662_10000099	Ga0207662_1000009932	267
354	3300025921	Ga0207652_10029949	Ga0207652_100299491	267
355	3300025921	Ga0207652_10100535	Ga0207652_101005352	267
356	3300025922	Ga0207646_10241329	Ga0207646_102413292	267
357	3300025927	Ga0207687_10000777	Ga0207687_100007774	267
358	3300025929	Ga0207664_10226554	Ga0207664_102265542	267
359	3300025934	Ga0207686_10000295	Ga0207686_1000029529	267
360	3300025935	Ga0207709_10003302	Ga0207709_100033022	267
361	3300025936	Ga0207670_10001165	Ga0207670_1000116512	267
362	3300025936	Ga0207670_10045016	Ga0207670_100450162	267
363	3300025938	Ga0207704_10000641	Ga0207704_100006413	267
364	3300025942	Ga0207689_10000432	Ga0207689_1000043228	267
365	3300025949	Ga0207667_10010246	Ga0207667_100102461	267
366	3300025961	Ga0207712_10004115	Ga0207712_100041154	267
367	3300025981	Ga0207640_10002706	Ga0207640_100027064	267
368	3300026023	Ga0207677_10002882	Ga0207677_100028822	267
369	3300026035	Ga0207703_10000781	Ga0207703_1000078125	267
370	3300026041	Ga0207639_10105843	Ga0207639_101058432	267
371	3300026075	Ga0207708_10000412	Ga0207708_1000041226	267
372	3300026078	Ga0207702_10103297	Ga0207702_101032971	267
373	3300026088	Ga0207641_10090571	Ga0207641_100905713	267
374	3300026088	Ga0207641_10229371	Ga0207641_102293712	267
375	3300026089	Ga0207648_10000603	Ga0207648_1000060311	267
376	3300026095	Ga0207676_10010309	Ga0207676_100103096	267
377	3300026118	Ga0207675_100000509	Ga0207675_10000050928	267
378	3300027907	Ga0207428_10001166	Ga0207428_1000116610	267
379	3300028380	Ga0268265_10003883	Ga0268265_100038837	267
380	3300028381	Ga0268264_10001100	Ga0268264_1000110017	267
381	3300028381	Ga0268264_10064756	Ga0268264_100647562	267
382	3300031995	Ga0307409_100417642	Ga0307409_1004176422	267
383	3300034816	Ga0373930_0024098	Ga0373930_0024098_380_1189	267
384	3300034817	Ga0373948_0043653	Ga0373948_0043653_99_908	267
385	3300034957	Ga0373938_0011857	Ga0373938_0011857_537_1346	267
386	3300035083	Ga0373926_0001396	Ga0373926_0001396_5328_6137	267
387	3300035089	Ga0373944_0065812	Ga0373944_0065812_260_1069	267
388	3300035091	Ga0373951_0037390	Ga0373951_0037390_113_922	267
389	3300035112	Ga0373932_0002695	Ga0373932_0002695_1361_2170	267
390	3300035113	Ga0373936_0008146	Ga0373936_0008146_2573_3382	267
391	3300035114	Ga0373939_0054531	Ga0373939_0054531_167_976	267
392	3300035115	Ga0373941_0119701	Ga0373941_0119701_57_866	267
393	3300035170	Ga0373943_0051722	Ga0373943_0051722_172_981	267
394	3300035691	Ga0373931_0015506	Ga0373931_0015506_2651_3460	267
395	3300035691	Ga0373931_0025175	Ga0373931_0025175_1218_2027	267
396	3300035691	Ga0373931_0121664	Ga0373931_0121664_425_1234	267
397	3300035692	Ga0373935_0140265	Ga0373935_0140265_798_1607	267
398	3300035695	Ga0373927_0020836	Ga0373927_0020836_2944_3753	267
399	3300035725	Ga0373947_0010782	Ga0373947_0010782_2976_3785	267
400	3300036401	Ga0373937_0302798	Ga0373937_0302798_442_1251	267
401	3300037471	Ga0395905_0001763	Ga0395905_0001763_3011_3859	267
402	3300042876	Ga0451577_0041592	Ga0451577_0041592_2269_3078	267
403	3300045051	Ga0451576_0000927	Ga0451576_0000927_10358_11167	267
404	3300045051	Ga0451576_0129536	Ga0451576_0129536_15_824	267
405	3300045051	Ga0451576_0490836	Ga0451576_0490836_54_863	267
406	3300045051	Ga0451576_0701335	Ga0451576_0701335_240_1049	267
407	3300046455	Ga0495603_0005362	Ga0495603_0005362_6490_7299	267
408	3300046472	Ga0495580_0028853	Ga0495580_0028853_2550_3359	267
409	3300046475	Ga0495639_0056148	Ga0495639_0056148_304_1113	267
410	3300046492	Ga0495585_0001520	Ga0495585_0001520_8697_9521	267
411	3300046517	Ga0495630_0103982	Ga0495630_0103982_329_1138	267
412	3300046528	Ga0495642_0083224	Ga0495642_0083224_317_1126	267
413	3300046535	Ga0495586_0002442	Ga0495586_0002442_3446_4255	267
414	3300046538	Ga0495609_0040353	Ga0495609_0040353_680_1504	267
415	3300046665	Ga0495661_0092491	Ga0495661_0092491_614_1438	267
416	3300046674	Ga0495588_0024694	Ga0495588_0024694_132_941	267
417	3300046683	Ga0495658_0028314	Ga0495658_0028314_417_1226	267
418	3300046684	Ga0495669_0059363	Ga0495669_0059363_604_1413	267
419	3300047315	Ga0495581_0032039	Ga0495581_0032039_1200_2009	267
420	3300048091	Ga0495626_0004924	Ga0495626_0004924_4353_5177	267
421	3300048918	Ga0496115_0005695	Ga0496115_0005695_6562_7386	267
422	3300049570	Ga0501033_0011977	Ga0501033_0011977_4122_4928	267
423	3300049572	Ga0501036_0022679	Ga0501036_0022679_3861_4667	267
424	3300049573	Ga0501037_0014437	Ga0501037_0014437_3618_4424	267
425	3300049576	Ga0501040_0051958	Ga0501040_0051958_247_1053	267
426	3300049577	Ga0501041_0013026	Ga0501041_0013026_3648_4454	267
427	3300049578	Ga0501042_0016787	Ga0501042_0016787_3495_4301	267
428	3300049580	Ga0501046_0012953	Ga0501046_0012953_5978_6784	267
429	3300049582	Ga0501048_0022769	Ga0501048_0022769_3509_4315	267
430	3300049584	Ga0501068_0093543	Ga0501068_0093543_55_858	267
431	3300049586	Ga0501070_0413004	Ga0501070_0413004_266_1072	267
432	3300049588	Ga0501072_0002114	Ga0501072_0002114_12753_13559	267
433	3300049591	Ga0501075_0005791	Ga0501075_0005791_665_1471	267
434	3300049592	Ga0501076_0001218	Ga0501076_0001218_12097_12903	267
435	3300049593	Ga0501077_0006977	Ga0501077_0006977_75_881	267
436	3300049742	Ga0501080_0109322	Ga0501080_0109322_1321_2127	267
437	3300049743	Ga0501081_0014737	Ga0501081_0014737_3618_4424	267
438	3300049823	Ga0501044_0647181	Ga0501044_0647181_24_830	267
439	3300049824	Ga0501045_0001660	Ga0501045_0001660_5083_5889	267
440	3300050507	nmdc:mga05p37_331_c1	nmdc:mga05p37_331_c1_20841_21650	267
441	3300050508	nmdc:mga09592_618_c1	nmdc:mga09592_618_c1_15990_16799	267
442	3300050510	nmdc:mga06r32_23555_c2	nmdc:mga06r32_23555_c2_1132_1941	267
443	3300050511	nmdc:mga08y16_35813_c1	nmdc:mga08y16_35813_c1_1211_2020	267
444	3300050512	nmdc:mga0n895_22197_c1	nmdc:mga0n895_22197_c1_1983_2801	267
445	3300050513	nmdc:mga0rr50_765_c1	nmdc:mga0rr50_765_c1_10040_10858	267
446	3300050514	nmdc:mga08x19_877_c1	nmdc:mga08x19_877_c1_10872_11690	267
447	3300050515	nmdc:mga0a205_2581_c1	nmdc:mga0a205_2581_c1_7800_8618	267
448	3300054114	Ga0501084_0020318	Ga0501084_0020318_529_1335	267
449	3300060353	Ga0501082_0019300	Ga0501082_0019300_4461_5267	267
450	iso_pu_bacteria	2895511927	2895517899	267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01614

IclR

Bacterial transcriptional regulator

81

240

0.97 PF09339

HTH_IclR

IclR helix-turn-helix domain

14

65

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1tf1-assembly2.cif.gz_B	crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain	0.9485	85	258
2o99-assembly2.cif.gz_B	the crystal structure of e.coli iclr c-terminal fragment in complex with glyoxylate	0.939	90	258
1ysp-assembly1.cif.gz_A	crystal structure of the c-terminal domain of e. coli transcriptional regulator kdgr.	0.9253	90	259
1tf1-assembly2.cif.gz_B	crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain	0.923	85	258
5hpi-assembly1.cif.gz_A	crystal structure of the double mutant of pobr transcription factor inducer binding domain-3-hydroxy benzoic acid complex from acinetobacter	0.9171	95	254

ID	Description	Score	Start	End	Superfamily
af_P77300_3_76_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9682	16	85	1.10.10.10
af_P77732_79_254_3.30.450.40	Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain	0.9572	89	260	3.30.450.40
2ia2D01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9521	14	64	1.10.10.10
af_P77300_77_251_3.30.450.40	Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain	0.9513	90	260	3.30.450.40
1tf1B00	Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain	0.9485	85	258	3.30.450.40

ID	Description	Score	Start	End	GO Terms
AF-X1EUD4-F1-model_v4	IclR-ED domain-containing protein	0.9661	95	264	GO:0003677 GO:0003700 GO:0045892
AF-A0A2V9QTZ5-F1-model_v4	IclR-ED domain-containing protein	0.9564	91	257	GO:0003677 GO:0003700 GO:0045892
AF-A0A840QRB9-F1-model_v4	DNA-binding IclR family transcriptional regulator	0.9542	37	264	GO:0003677 GO:0003700 GO:0045892
AF-A0A530M694-F1-model_v4	deleted	0.9534	143	235
AF-Q32DT8-F1-model_v4	Regulator	0.952	134	262	GO:0003677 GO:0003700 GO:0045892

Feature Viewer

pLDDT	pTM	Quality
83.3	0.67	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F446649

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01614

IclR

Bacterial transcriptional regulator

81

240

0.97

PF09339

HTH_IclR

IclR helix-turn-helix domain

14

65

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map