F446691

General Info

Members Datasets Scaffolds Average Seq Length
450 232 900 247

Family's Representative Sequence

Representative Sequence 3300053121|Ga0500607_000007|Ga0500607_000007_104287_105075
Length 262
Sequence MTRFALTLEFDGGPFMGLQRQSHGPTVQQAVEEAAHAVTGEPVTMHAAGRTDAGVHALAMRAHVDIARDIAPFRLQEALNARLRPAPIAVTACEIVPDDWHARFSCTGRAYLYRIVNRRPPLTLDRGKAWRVHAPLDAAAMHRAAQALVGHHDFTTFRSAHCQSASPVKTLDRIAVRREGDLVLVETAARSFLHHQVRSMVGCLALVGLGRWEEARMAAALAARDRQALGLNAPPDGLYFTKAEYPNSDVGYTCNKMPLTRL

Samples

Sample ID Description Type Environment
1 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
146 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
197 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
219 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
220 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
221 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
222 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
223 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
224 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
225 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
226 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
227 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
228 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
229 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
230 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
231 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
232 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0
Isolates 3.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.78
Nodule 0
Rhizoplane 5.11
Rhizosphere 77.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500607_000007 3300053121 Bacteria 134097
2 SwRhRL2b_contig_69395 2162886007 Bacteria 3355
3 JGI24752J21851_1000107 3300001976 Bacteria 11204
4 JGI24752J21851_1001494 3300001976 Bacteria 3155
5 JGI24750J21931_1000022 3300002070 Bacteria 19714
6 JGI24748J21848_1000058 3300002074 Bacteria 46055
7 JGI24738J21930_10001900 3300002075 Bacteria 5644
8 JGI24034J26672_10000050 3300002239 Bacteria 53117
9 JGI24742J22300_10009123 3300002244 Bacteria 1636
10 JGI24751J29686_10019355 3300002459 Bacteria 1409
11 Ga0055542_1012827 3300003762 Bacteria 1433
12 Ga0055536_1034722 3300003781 Bacteria 1269
13 Ga0055530_10000065 3300003791 Bacteria 94009
14 Ga0055531_10003276 3300003794 Bacteria 10383
15 Ga0065165_1012068 3300005262 Bacteria 3543
16 Ga0065704_10093556 3300005289 Bacteria 2587
17 Ga0065707_10082647 3300005295 Bacteria 13064
18 Ga0070658_10000225 3300005327 Bacteria 50444
19 Ga0070658_10003675 3300005327 Bacteria 12560
20 Ga0070658_10010679 3300005327 Bacteria 7357
21 Ga0070658_10010960 3300005327 Bacteria 7266
22 Ga0070658_10070058 3300005327 Bacteria 2870
23 Ga0070658_10105924 3300005327 Bacteria 2326
24 Ga0070658_10327909 3300005327 Bacteria 1308
25 Ga0070683_100027201 3300005329 Bacteria 5158
26 Ga0070683_100150407 3300005329 Bacteria 2207
27 Ga0070690_100000041 3300005330 Bacteria 59073
28 Ga0070670_100007217 3300005331 Bacteria 9412
29 Ga0070670_100025779 3300005331 Bacteria 5059
30 Ga0070670_100718926 3300005331 Bacteria 899
31 Ga0070666_10000002 3300005335 Bacteria 478684
32 Ga0070666_10000033 3300005335 Bacteria 121625
33 Ga0070666_10223593 3300005335 Bacteria 1328
34 Ga0070680_100009446 3300005336 Bacteria 7494
35 Ga0070660_100000480 3300005339 Bacteria 26717
36 Ga0070660_100000741 3300005339 Bacteria 21612
37 Ga0070660_100003063 3300005339 Bacteria 11487
38 Ga0070660_100010273 3300005339 Bacteria 6608
39 Ga0070689_100028786 3300005340 Bacteria 4202
40 Ga0070661_100001069 3300005344 Bacteria 19422
41 Ga0070661_100110520 3300005344 Bacteria 2052
42 Ga0070668_100017427 3300005347 Bacteria 5382
43 Ga0070668_100021139 3300005347 Bacteria 4919
44 Ga0070668_100037416 3300005347 Bacteria 3706
45 Ga0070668_100054565 3300005347 Bacteria 3082
46 Ga0070668_100073205 3300005347 Bacteria 2671
47 Ga0070668_100155553 3300005347 Bacteria 1852
48 Ga0070669_100000055 3300005353 Bacteria 111488
49 Ga0070669_100000062 3300005353 Bacteria 107705
50 Ga0070669_100000075 3300005353 Bacteria 98073
51 Ga0070669_100005241 3300005353 Bacteria 9364
52 Ga0070669_100017575 3300005353 Bacteria 5101
53 Ga0070671_100000015 3300005355 Bacteria 166132
54 Ga0070671_100000117 3300005355 Bacteria 51485
55 Ga0070671_100006780 3300005355 Bacteria 9163
56 Ga0070671_100008949 3300005355 Bacteria 8034
57 Ga0070671_100010977 3300005355 Bacteria 7269
58 Ga0070671_100062360 3300005355 Bacteria 3104
59 Ga0070688_100083847 3300005365 Bacteria 2069
60 Ga0070688_100260652 3300005365 Bacteria 1238
61 Ga0070659_100003698 3300005366 Bacteria 10912
62 Ga0070659_100012393 3300005366 Bacteria 6323
63 Ga0070659_100326787 3300005366 Bacteria 1283
64 Ga0070667_100071642 3300005367 Bacteria 2952
65 Ga0070667_100076494 3300005367 Bacteria 2858
66 Ga0070705_100164968 3300005440 Bacteria 1485
67 Ga0070694_100607719 3300005444 Bacteria 881
68 Ga0070708_100152661 3300005445 Bacteria 2148
69 Ga0070663_100007136 3300005455 Bacteria 6782
70 Ga0070663_100082667 3300005455 Bacteria 2363
71 Ga0070663_100286602 3300005455 Bacteria 1314
72 Ga0070662_100001578 3300005457 Bacteria 14081
73 Ga0070662_100010914 3300005457 Bacteria 5986
74 Ga0070681_10006256 3300005458 Bacteria 11580
75 Ga0070685_10000023 3300005466 Bacteria 102548
76 Ga0070679_100005192 3300005530 Bacteria 12054
77 Ga0070684_100071220 3300005535 Bacteria 3060
78 Ga0068853_100018315 3300005539 Bacteria 5795
79 Ga0068853_100081996 3300005539 Bacteria 2825
80 Ga0068853_100181836 3300005539 Bacteria 1907
81 Ga0070686_100000003 3300005544 Bacteria 308397
82 Ga0070665_100000036 3300005548 Bacteria 314603
83 Ga0070665_100000530 3300005548 Bacteria 53943
84 Ga0070665_100015442 3300005548 Bacteria 7670
85 Ga0070665_100070509 3300005548 Bacteria 3502
86 Ga0068855_100009388 3300005563 Bacteria 11816
87 Ga0068855_100132148 3300005563 Bacteria 2850
88 Ga0068855_100486957 3300005563 Bacteria 1342
89 Ga0068857_100088025 3300005577 Bacteria 2778
90 Ga0068854_100002258 3300005578 Bacteria 11855
91 Ga0068854_100044864 3300005578 Bacteria 3141
92 Ga0068856_100033915 3300005614 Bacteria 4999
93 Ga0068852_100143285 3300005616 Bacteria 2214
94 Ga0068852_100224433 3300005616 Bacteria 1788
95 Ga0068852_100247358 3300005616 Bacteria 1707
96 Ga0068852_100269439 3300005616 Bacteria 1638
97 Ga0068859_100000214 3300005617 Bacteria 57556
98 Ga0068859_100084938 3300005617 Bacteria 3210
99 Ga0068859_100087117 3300005617 Bacteria 3170
100 Ga0068859_100177539 3300005617 Bacteria 2212
101 Ga0068859_100260389 3300005617 Bacteria 1826
102 Ga0068864_100000744 3300005618 Bacteria 27304
103 Ga0068861_100072167 3300005719 Bacteria 2678
104 Ga0068863_100000034 3300005841 Bacteria 168359
105 Ga0068863_100000879 3300005841 Bacteria 30177
106 Ga0068863_100032028 3300005841 Bacteria 5014
107 Ga0068863_100425108 3300005841 Bacteria 1302
108 Ga0068858_100086158 3300005842 Bacteria 2922
109 Ga0068860_100000001 3300005843 Bacteria 703043
110 Ga0068860_100000437 3300005843 Bacteria 52907
111 Ga0068860_100003606 3300005843 Bacteria 15909
112 Ga0068860_100027395 3300005843 Bacteria 5490
113 Ga0068860_100044968 3300005843 Bacteria 4208
114 Ga0068860_100077308 3300005843 Bacteria 3165
115 Ga0068860_100254744 3300005843 Bacteria 1710
116 Ga0068860_100414462 3300005843 Bacteria 1334
117 Ga0068860_100419016 3300005843 Bacteria 1327
118 Ga0068860_100748487 3300005843 Bacteria 989
119 Ga0068862_100000088 3300005844 Bacteria 109244
120 Ga0068862_100009592 3300005844 Bacteria 8003
121 Ga0068862_100016375 3300005844 Bacteria 6170
122 Ga0068862_100037284 3300005844 Bacteria 4120
123 Ga0068862_100600202 3300005844 Bacteria 1057
124 Ga0075364_10050164 3300006051 Bacteria 2723
125 Ga0075432_10001480 3300006058 Bacteria 7667
126 Ga0097621_100018847 3300006237 Bacteria 5283
127 Ga0075370_10056216 3300006353 Bacteria 2236
128 Ga0075370_10154552 3300006353 Bacteria 1345
129 Ga0068871_100450678 3300006358 Bacteria 1153
130 Ga0097620_100000214 3300006931 Bacteria 57556
131 Ga0097620_100084939 3300006931 Bacteria 3210
132 Ga0097620_100087119 3300006931 Bacteria 3170
133 Ga0097620_100177534 3300006931 Bacteria 2212
134 Ga0097620_100260369 3300006931 Bacteria 1826
135 Ga0105251_10006699 3300009011 Bacteria 7278
136 Ga0105251_10031177 3300009011 Bacteria 2670
137 Ga0105247_10009033 3300009101 Bacteria 6068
138 Ga0105241_10019819 3300009174 Bacteria 4965
139 Ga0105241_10257885 3300009174 Bacteria 1481
140 Ga0105242_10073672 3300009176 Bacteria 2840
141 Ga0105248_10027986 3300009177 Bacteria 6277
142 Ga0105248_10033994 3300009177 Bacteria 5699
143 Ga0105248_10199074 3300009177 Bacteria 2257
144 Ga0105248_10411086 3300009177 Bacteria 1523
145 Ga0105249_10000097 3300009553 Bacteria 120886
146 Ga0105249_10000114 3300009553 Bacteria 108599
147 Ga0105249_10002105 3300009553 Bacteria 17272
148 Ga0105249_10016048 3300009553 Bacteria 6638
149 Ga0105246_10000505 3300011119 Bacteria 21244
150 Ga0157373_10001545 3300013100 Bacteria 17571
151 Ga0157373_10051034 3300013100 Bacteria 2946
152 Ga0157371_10003539 3300013102 Bacteria 14091
153 Ga0157371_10300481 3300013102 Bacteria 1162
154 Ga0157370_10006429 3300013104 Bacteria 12963
155 Ga0157369_10022482 3300013105 Bacteria 7035
156 Ga0157374_10014340 3300013296 Bacteria 6935
157 Ga0163162_10012917 3300013306 Bacteria 8154
158 Ga0163162_10055039 3300013306 Bacteria 4004
159 Ga0157372_10006534 3300013307 Bacteria 12409
160 Ga0157372_10134257 3300013307 Bacteria 2849
161 Ga0163163_10009100 3300014325 Bacteria 8849
162 Ga0163163_10193573 3300014325 Bacteria 2081
163 Ga0157380_10000357 3300014326 Bacteria 27394
164 Ga0157380_10384954 3300014326 Bacteria 1325
165 Ga0157380_10454883 3300014326 Bacteria 1231
166 Ga0157379_10033218 3300014968 Bacteria 4601
167 Ga0157379_10329218 3300014968 Bacteria 1395
168 Ga0157379_10842536 3300014968 Bacteria 867
169 Ga0163161_10000008 3300017792 Bacteria 294642
170 Ga0163161_10111277 3300017792 Bacteria 2047
171 Ga0209148_1000117 3300025254 Bacteria 188938
172 Ga0209455_1000690 3300025272 Bacteria 19871
173 Ga0209455_1024965 3300025272 Bacteria 1096
174 Ga0209675_1000531 3300025291 Bacteria 27931
175 Ga0209676_1000187 3300025292 Bacteria 141338
176 Ga0209676_1000236 3300025292 Bacteria 118705
177 Ga0209025_1011221 3300025294 Bacteria 5940
178 Ga0209050_1000370 3300025298 Bacteria 85916
179 Ga0209050_1000400 3300025298 Bacteria 81202
180 Ga0209050_1022396 3300025298 Bacteria 2265
181 Ga0209257_1000232 3300025304 Bacteria 130749
182 Ga0209257_1000250 3300025304 Bacteria 124024
183 Ga0209257_1002965 3300025304 Bacteria 15518
184 Ga0207697_10000603 3300025315 Bacteria 20456
185 Ga0207696_1006839 3300025711 Bacteria 4539
186 Ga0207713_1004226 3300025735 Bacteria 9397
187 Ga0207710_10019539 3300025900 Bacteria 2891
188 Ga0207680_10000004 3300025903 Bacteria 827324
189 Ga0207680_10002858 3300025903 Bacteria 8081
190 Ga0207680_10015525 3300025903 Bacteria 3976
191 Ga0207680_10222912 3300025903 Bacteria 1293
192 Ga0207705_10000144 3300025909 Bacteria 76661
193 Ga0207705_10000250 3300025909 Bacteria 52558
194 Ga0207705_10005767 3300025909 Bacteria 9236
195 Ga0207705_10007210 3300025909 Bacteria 8187
196 Ga0207705_10064759 3300025909 Bacteria 2641
197 Ga0207705_10166605 3300025909 Bacteria 1657
198 Ga0207654_10171709 3300025911 Bacteria 1408
199 Ga0207660_10035837 3300025917 Bacteria 3447
200 Ga0207660_10263076 3300025917 Bacteria 1365
201 Ga0207657_10001916 3300025919 Bacteria 22462
202 Ga0207657_10002199 3300025919 Bacteria 21137
203 Ga0207657_10009183 3300025919 Bacteria 9970
204 Ga0207657_10017349 3300025919 Bacteria 6906
205 Ga0207649_10009759 3300025920 Bacteria 5258
206 Ga0207649_10117182 3300025920 Bacteria 1790
207 Ga0207652_10005673 3300025921 Bacteria 10127
208 Ga0207652_10010754 3300025921 Bacteria 7370
209 Ga0207652_10062467 3300025921 Bacteria 3219
210 Ga0207681_10000002 3300025923 Bacteria 985597
211 Ga0207681_10000069 3300025923 Bacteria 92959
212 Ga0207681_10000394 3300025923 Bacteria 30575
213 Ga0207681_10000540 3300025923 Bacteria 26022
214 Ga0207681_10000913 3300025923 Bacteria 19294
215 Ga0207681_10338125 3300025923 Bacteria 1202
216 Ga0207650_10004106 3300025925 Bacteria 9945
217 Ga0207650_10053048 3300025925 Bacteria 3005
218 Ga0207650_10374434 3300025925 Bacteria 1175
219 Ga0207644_10000002 3300025931 Bacteria 942221
220 Ga0207644_10000003 3300025931 Bacteria 585905
221 Ga0207644_10007128 3300025931 Bacteria 7286
222 Ga0207644_10052094 3300025931 Bacteria 2940
223 Ga0207690_10003054 3300025932 Bacteria 10085
224 Ga0207690_10015708 3300025932 Bacteria 4593
225 Ga0207690_10360871 3300025932 Bacteria 1151
226 Ga0207706_10000384 3300025933 Bacteria 48339
227 Ga0207706_10021938 3300025933 Bacteria 5732
228 Ga0207706_10080735 3300025933 Bacteria 2859
229 Ga0207670_10048737 3300025936 Bacteria 2829
230 Ga0207711_10015441 3300025941 Bacteria 6337
231 Ga0207711_10021337 3300025941 Bacteria 5411
232 Ga0207711_10030728 3300025941 Bacteria 4531
233 Ga0207711_10136138 3300025941 Bacteria 2206
234 Ga0207711_10148271 3300025941 Bacteria 2115
235 Ga0207661_10462895 3300025944 Bacteria 1156
236 Ga0207679_10021954 3300025945 Bacteria 4338
237 Ga0207667_10001504 3300025949 Bacteria 29232
238 Ga0207667_10028393 3300025949 Bacteria 6078
239 Ga0207667_10036783 3300025949 Bacteria 5241
240 Ga0207667_10051429 3300025949 Bacteria 4344
241 Ga0207712_10000001 3300025961 Bacteria 750309
242 Ga0207712_10000074 3300025961 Bacteria 120822
243 Ga0207712_10138926 3300025961 Bacteria 1862
244 Ga0207668_10012311 3300025972 Bacteria 5231
245 Ga0207668_10012433 3300025972 Bacteria 5211
246 Ga0207668_10125955 3300025972 Bacteria 1948
247 Ga0207640_10000710 3300025981 Bacteria 19310
248 Ga0207640_10002078 3300025981 Bacteria 10783
249 Ga0207658_10001432 3300025986 Bacteria 18601
250 Ga0207658_10002560 3300025986 Bacteria 13206
251 Ga0207658_10003836 3300025986 Bacteria 10588
252 Ga0207658_10014622 3300025986 Bacteria 5376
253 Ga0207658_10358726 3300025986 Bacteria 1271
254 Ga0207703_10003100 3300026035 Bacteria 14045
255 Ga0207703_10004059 3300026035 Bacteria 12094
256 Ga0207703_10146755 3300026035 Bacteria 2053
257 Ga0207703_10155859 3300026035 Bacteria 1996
258 Ga0207639_10008976 3300026041 Bacteria 6883
259 Ga0207639_10021732 3300026041 Bacteria 4612
260 Ga0207639_10073581 3300026041 Bacteria 2679
261 Ga0207678_10028921 3300026067 Bacteria 4837
262 Ga0207678_10034371 3300026067 Bacteria 4415
263 Ga0207678_10048064 3300026067 Bacteria 3689
264 Ga0207678_10395696 3300026067 Bacteria 1196
265 Ga0207702_10026043 3300026078 Bacteria 4856
266 Ga0207641_10000057 3300026088 Bacteria 168603
267 Ga0207641_10033920 3300026088 Bacteria 4243
268 Ga0207641_10067900 3300026088 Bacteria 3055
269 Ga0207641_10401878 3300026088 Bacteria 1315
270 Ga0207676_10006691 3300026095 Bacteria 8153
271 Ga0207676_10016428 3300026095 Bacteria 5360
272 Ga0207676_10095074 3300026095 Bacteria 2457
273 Ga0207674_10070233 3300026116 Bacteria 3521
274 Ga0207674_10387823 3300026116 Bacteria 1350
275 Ga0207675_100006830 3300026118 Bacteria 10806
276 Ga0207675_100010893 3300026118 Bacteria 8517
277 Ga0207698_10095968 3300026142 Bacteria 2442
278 Ga0207698_10250988 3300026142 Bacteria 1619
279 Ga0209983_1020136 3300027665 Bacteria 1390
280 Ga0209974_10020204 3300027876 Bacteria 2207
281 Ga0207428_10014153 3300027907 Bacteria 6945
282 Ga0268266_10000042 3300028379 Bacteria 316826
283 Ga0268266_10001263 3300028379 Bacteria 30915
284 Ga0268265_10000241 3300028380 Bacteria 62423
285 Ga0268265_10002078 3300028380 Bacteria 15621
286 Ga0268265_10017256 3300028380 Bacteria 4978
287 Ga0268265_10213433 3300028380 Bacteria 1683
288 Ga0268265_10377333 3300028380 Bacteria 1303
289 Ga0268265_10645031 3300028380 Bacteria 1017
290 Ga0268264_10000006 3300028381 Bacteria 827324
291 Ga0268264_10000010 3300028381 Bacteria 596543
292 Ga0268264_10001517 3300028381 Bacteria 21645
293 Ga0268264_10014246 3300028381 Bacteria 6537
294 Ga0268264_10028071 3300028381 Bacteria 4603
295 Ga0268264_10057604 3300028381 Bacteria 3250
296 Ga0268264_10072469 3300028381 Bacteria 2921
297 Ga0268264_10317494 3300028381 Bacteria 1472
298 Ga0268264_10456572 3300028381 Bacteria 1239
299 Ga0265327_10029976 3300031251 Bacteria 3084
300 Ga0307408_100531404 3300031548 Bacteria 1035
301 Ga0316576_10228614 3300031727 Bacteria 1399
302 Ga0307405_10000261 3300031731 Bacteria 19304
303 Ga0307413_10496134 3300031824 Bacteria 979
304 Ga0307406_10538919 3300031901 Bacteria 953
305 Ga0307412_10001551 3300031911 Bacteria 12691
306 Ga0307412_10056443 3300031911 Bacteria 2617
307 Ga0307412_10118549 3300031911 Bacteria 1902
308 Ga0307412_10124603 3300031911 Bacteria 1861
309 Ga0307416_100167249 3300032002 Bacteria 2041
310 Ga0307416_100768153 3300032002 Bacteria 1057
311 Ga0307414_10000486 3300032004 Bacteria 20663
312 Ga0307414_10049776 3300032004 Bacteria 2899
313 Ga0307414_10184945 3300032004 Bacteria 1680
314 Ga0307414_10676618 3300032004 Bacteria 932
315 Ga0307411_10041176 3300032005 Bacteria 2937
316 Ga0307411_10081568 3300032005 Bacteria 2228
317 Ga0307415_100435456 3300032126 Bacteria 1129
318 Ga0307415_100688479 3300032126 Bacteria 921
319 Ga0316583_10000596 3300032133 Bacteria 10981
320 Ga0373931_0149713 3300035691 Bacteria 1359
321 Ga0316582_0009794 3300036647 Bacteria 5215
322 Ga0316584_0029107 3300036712 Bacteria 4077
323 Ga0316584_0068361 3300036712 Bacteria 2663
324 Ga0395905_0246215 3300037471 Bacteria 1670
325 Ga0395905_0506835 3300037471 Bacteria 1107
326 Ga0451807_1998519 3300041486 Bacteria 1611
327 Ga0451837_0377562 3300041494 Bacteria 1363
328 Ga0451845_0387628 3300041501 Bacteria 860
329 Ga0451849_0013600 3300041505 Bacteria 1755
330 Ga0451853_3835874 3300041512 Bacteria 1137
331 Ga0439462_0003548 3300042015 Bacteria 3750
332 Ga0466957_0042948 3300044842 Bacteria 2736
333 Ga0466957_0094796 3300044842 Bacteria 1874
334 Ga0451576_0000007 3300045051 Bacteria 782228
335 Ga0466967_0364631 3300045976 Bacteria 1400
336 Ga0495638_0019303 3300046460 Bacteria 4510
337 Ga0495605_0192362 3300046474 Bacteria 892
338 Ga0495596_0000472 3300046500 Bacteria 25455
339 Ga0495607_0051622 3300046501 Bacteria 2387
340 Ga0495583_0096683 3300046506 Bacteria 1265
341 Ga0495610_0000269 3300046512 Bacteria 54194
342 Ga0495632_0030515 3300046519 Bacteria 2797
343 Ga0495643_0000207 3300046522 Bacteria 90642
344 Ga0495643_0004935 3300046522 Bacteria 9156
345 Ga0495643_0021449 3300046522 Bacteria 3706
346 Ga0495598_0009012 3300046537 Bacteria 2343
347 Ga0495598_0019159 3300046537 Bacteria 1790
348 Ga0495609_0016619 3300046538 Bacteria 3427
349 Ga0495621_0014061 3300046539 Bacteria 2527
350 Ga0495656_0091331 3300046615 Bacteria 1393
351 Ga0495668_0015679 3300046616 Bacteria 4418
352 Ga0495625_0064087 3300046660 Bacteria 2593
353 Ga0495670_0028128 3300046691 Bacteria 2787
354 Ga0495671_0107407 3300046692 Bacteria 1363
355 Ga0495615_0009102 3300048090 Bacteria 1942
356 Ga0495626_0003607 3300048091 Bacteria 9845
357 Ga0496100_0064217 3300048903 Bacteria 2428
358 Ga0496101_0014777 3300048904 Bacteria 5252
359 Ga0496102_0001063 3300048905 Bacteria 25467
360 Ga0496102_0044986 3300048905 Bacteria 4006
361 Ga0496102_0232365 3300048905 Bacteria 1738
362 Ga0496102_0275185 3300048905 Bacteria 1587
363 Ga0496103_0000195 3300048906 Bacteria 60384
364 Ga0496103_0076456 3300048906 Bacteria 2101
365 Ga0496104_0001584 3300048907 Bacteria 19588
366 Ga0496104_0543544 3300048907 Bacteria 1073
367 Ga0496105_0058395 3300048908 Bacteria 3184
368 Ga0496106_0030964 3300048909 Bacteria 3988
369 Ga0496106_0081636 3300048909 Bacteria 2484
370 Ga0496107_0002736 3300048910 Bacteria 11584
371 Ga0496107_0180973 3300048910 Bacteria 1565
372 Ga0496109_0097060 3300048912 Bacteria 2731
373 Ga0496110_0108850 3300048913 Bacteria 2488
374 Ga0496112_0181211 3300048915 Bacteria 2070
375 Ga0496113_0007041 3300048916 Bacteria 7194
376 Ga0496113_0022685 3300048916 Bacteria 4444
377 Ga0496113_0711737 3300048916 Bacteria 801
378 Ga0496114_0086723 3300048917 Bacteria 2653
379 Ga0496116_0043813 3300048919 Bacteria 3045
380 Ga0496116_0078600 3300048919 Bacteria 2056
381 Ga0496117_0004618 3300048920 Bacteria 15007
382 Ga0496117_0132430 3300048920 Bacteria 1508
383 Ga0496118_0078874 3300048921 Bacteria 2327
384 Ga0496119_0030524 3300048922 Bacteria 3631
385 Ga0496120_0001380 3300048923 Bacteria 29622
386 Ga0496121_0002650 3300048924 Bacteria 26852
387 Ga0496122_0049641 3300048925 Bacteria 3209
388 Ga0496123_0042462 3300048926 Bacteria 3137
389 Ga0496123_0078325 3300048926 Bacteria 2025
390 Ga0496123_0100059 3300048926 Bacteria 1690
391 Ga0496123_0122163 3300048926 Bacteria 1462
392 Ga0496123_0131543 3300048926 Bacteria 1385
393 Ga0496124_0000982 3300048927 Bacteria 45263
394 Ga0496124_0103542 3300048927 Bacteria 2302
395 Ga0496124_0191993 3300048927 Bacteria 1562
396 Ga0496125_0097990 3300048928 Bacteria 2170
397 Ga0496125_0153195 3300048928 Bacteria 1579
398 Ga0496125_0170224 3300048928 Bacteria 1465
399 Ga0496126_0000476 3300048929 Bacteria 79541
400 Ga0496126_0005453 3300048929 Bacteria 14509
401 Ga0496126_0246835 3300048929 Bacteria 1489
402 Ga0501034_0049747 3300049571 Bacteria 4229
403 Ga0501034_0629810 3300049571 Bacteria 976
404 Ga0501047_0324884 3300049581 Bacteria 1378
405 Ga0501224_000020 3300049664 Bacteria 74346
406 Ga0501233_001289 3300049668 Bacteria 4287
407 Ga0501235_009091 3300049669 Bacteria 2171
408 Ga0501225_0000009 3300049705 Bacteria 90065
409 Ga0501234_001287 3300049707 Bacteria 3927
410 Ga0501080_0088502 3300049742 Bacteria 2877
411 Ga0501044_0013804 3300049823 Bacteria 8730
412 Ga0501044_0242125 3300049823 Bacteria 1747
413 Ga0501226_000136 3300049853 Bacteria 14145
414 nmdc:mga00v17_43018_c1 3300050491 Bacteria 2719
415 nmdc:mga0k408_1951_c1 3300050493 Bacteria 11058
416 nmdc:mga07m45_122530_c1 3300050496 Bacteria 1502
417 nmdc:mga07m45_152888_c1 3300050496 Bacteria 1338
418 nmdc:mga07m45_23149_c1 3300050496 Bacteria 3394
419 nmdc:mga07m45_58012_c1 3300050496 Bacteria 2190
420 Ga0500643_000001 3300053087 Bacteria 1440111
421 Ga0500643_023017 3300053087 Bacteria 1996
422 Ga0500562_022811 3300053108 Bacteria 1632
423 Ga0500592_026360 3300053116 Bacteria 937
424 Ga0500595_009072 3300053119 Bacteria 4035
425 Ga0500559_0001214 3300053136 Bacteria 15283
426 Ga0500559_0006328 3300053136 Bacteria 5348
427 Ga0500604_0028064 3300053151 Bacteria 1633
428 Ga0500604_0065074 3300053151 Bacteria 1153
429 Ga0500616_0000893 3300053153 Bacteria 32769
430 Ga0500616_0038197 3300053153 Bacteria 2594
431 Ga0500622_0000145 3300053156 Bacteria 75417
432 Ga0500636_0010303 3300053177 Bacteria 5450
433 Ga0500637_0006635 3300053178 Bacteria 5718
434 Ga0500645_004302 3300053730 Bacteria 5492
435 Ga0500645_009595 3300053730 Bacteria 3243
436 2511125739 2510917021 Bacteria 5705459
437 2643949845 2643221588 Bacteria 3692460
438 2738711556 2738541275 Bacteria 4830863
439 2738849981 2738541301 Bacteria 4834102
440 2738865710 2738541304 Bacteria 4833665
441 2739298228 2738543022 Bacteria 4835059
442 2739359906 2738543033 Bacteria 4833336
443 2778124695 2775507255 Bacteria 3945731
444 2819553085 2818991438 Bacteria 5793701
445 2882808459 2882806704 Bacteria 3007728
446 2895884250 2895880812 Bacteria 11255272
447 2896187224 2896184354 Bacteria 3258548
448 2928104174 2928100450 Bacteria 4837635
449 2928961639 2928959182 Bacteria 4725774
450 8054305877 8054302542 Bacteria 5698134
451 Ga0500607_000007
452 SwRhRL2b_contig_69395
453 JGI24752J21851_1000107
454 JGI24752J21851_1001494
455 JGI24750J21931_1000022
456 JGI24748J21848_1000058
457 JGI24738J21930_10001900
458 JGI24034J26672_10000050
459 JGI24742J22300_10009123
460 JGI24751J29686_10019355
461 Ga0055542_1012827
462 Ga0055536_1034722
463 Ga0055530_10000065
464 Ga0055531_10003276
465 Ga0065165_1012068
466 Ga0065704_10093556
467 Ga0065707_10082647
468 Ga0070658_10000225
469 Ga0070658_10003675
470 Ga0070658_10010679
471 Ga0070658_10010960
472 Ga0070658_10070058
473 Ga0070658_10105924
474 Ga0070658_10327909
475 Ga0070683_100027201
476 Ga0070683_100150407
477 Ga0070690_100000041
478 Ga0070670_100007217
479 Ga0070670_100025779
480 Ga0070670_100718926
481 Ga0070666_10000002
482 Ga0070666_10000033
483 Ga0070666_10223593
484 Ga0070680_100009446
485 Ga0070660_100000480
486 Ga0070660_100000741
487 Ga0070660_100003063
488 Ga0070660_100010273
489 Ga0070689_100028786
490 Ga0070661_100001069
491 Ga0070661_100110520
492 Ga0070668_100017427
493 Ga0070668_100021139
494 Ga0070668_100037416
495 Ga0070668_100054565
496 Ga0070668_100073205
497 Ga0070668_100155553
498 Ga0070669_100000055
499 Ga0070669_100000062
500 Ga0070669_100000075
501 Ga0070669_100005241
502 Ga0070669_100017575
503 Ga0070671_100000015
504 Ga0070671_100000117
505 Ga0070671_100006780
506 Ga0070671_100008949
507 Ga0070671_100010977
508 Ga0070671_100062360
509 Ga0070688_100083847
510 Ga0070688_100260652
511 Ga0070659_100003698
512 Ga0070659_100012393
513 Ga0070659_100326787
514 Ga0070667_100071642
515 Ga0070667_100076494
516 Ga0070705_100164968
517 Ga0070694_100607719
518 Ga0070708_100152661
519 Ga0070663_100007136
520 Ga0070663_100082667
521 Ga0070663_100286602
522 Ga0070662_100001578
523 Ga0070662_100010914
524 Ga0070681_10006256
525 Ga0070685_10000023
526 Ga0070679_100005192
527 Ga0070684_100071220
528 Ga0068853_100018315
529 Ga0068853_100081996
530 Ga0068853_100181836
531 Ga0070686_100000003
532 Ga0070665_100000036
533 Ga0070665_100000530
534 Ga0070665_100015442
535 Ga0070665_100070509
536 Ga0068855_100009388
537 Ga0068855_100132148
538 Ga0068855_100486957
539 Ga0068857_100088025
540 Ga0068854_100002258
541 Ga0068854_100044864
542 Ga0068856_100033915
543 Ga0068852_100143285
544 Ga0068852_100224433
545 Ga0068852_100247358
546 Ga0068852_100269439
547 Ga0068859_100000214
548 Ga0068859_100084938
549 Ga0068859_100087117
550 Ga0068859_100177539
551 Ga0068859_100260389
552 Ga0068864_100000744
553 Ga0068861_100072167
554 Ga0068863_100000034
555 Ga0068863_100000879
556 Ga0068863_100032028
557 Ga0068863_100425108
558 Ga0068858_100086158
559 Ga0068860_100000001
560 Ga0068860_100000437
561 Ga0068860_100003606
562 Ga0068860_100027395
563 Ga0068860_100044968
564 Ga0068860_100077308
565 Ga0068860_100254744
566 Ga0068860_100414462
567 Ga0068860_100419016
568 Ga0068860_100748487
569 Ga0068862_100000088
570 Ga0068862_100009592
571 Ga0068862_100016375
572 Ga0068862_100037284
573 Ga0068862_100600202
574 Ga0075364_10050164
575 Ga0075432_10001480
576 Ga0097621_100018847
577 Ga0075370_10056216
578 Ga0075370_10154552
579 Ga0068871_100450678
580 Ga0097620_100000214
581 Ga0097620_100084939
582 Ga0097620_100087119
583 Ga0097620_100177534
584 Ga0097620_100260369
585 Ga0105251_10006699
586 Ga0105251_10031177
587 Ga0105247_10009033
588 Ga0105241_10019819
589 Ga0105241_10257885
590 Ga0105242_10073672
591 Ga0105248_10027986
592 Ga0105248_10033994
593 Ga0105248_10199074
594 Ga0105248_10411086
595 Ga0105249_10000097
596 Ga0105249_10000114
597 Ga0105249_10002105
598 Ga0105249_10016048
599 Ga0105246_10000505
600 Ga0157373_10001545
601 Ga0157373_10051034
602 Ga0157371_10003539
603 Ga0157371_10300481
604 Ga0157370_10006429
605 Ga0157369_10022482
606 Ga0157374_10014340
607 Ga0163162_10012917
608 Ga0163162_10055039
609 Ga0157372_10006534
610 Ga0157372_10134257
611 Ga0163163_10009100
612 Ga0163163_10193573
613 Ga0157380_10000357
614 Ga0157380_10384954
615 Ga0157380_10454883
616 Ga0157379_10033218
617 Ga0157379_10329218
618 Ga0157379_10842536
619 Ga0163161_10000008
620 Ga0163161_10111277
621 Ga0209148_1000117
622 Ga0209455_1000690
623 Ga0209455_1024965
624 Ga0209675_1000531
625 Ga0209676_1000187
626 Ga0209676_1000236
627 Ga0209025_1011221
628 Ga0209050_1000370
629 Ga0209050_1000400
630 Ga0209050_1022396
631 Ga0209257_1000232
632 Ga0209257_1000250
633 Ga0209257_1002965
634 Ga0207697_10000603
635 Ga0207696_1006839
636 Ga0207713_1004226
637 Ga0207710_10019539
638 Ga0207680_10000004
639 Ga0207680_10002858
640 Ga0207680_10015525
641 Ga0207680_10222912
642 Ga0207705_10000144
643 Ga0207705_10000250
644 Ga0207705_10005767
645 Ga0207705_10007210
646 Ga0207705_10064759
647 Ga0207705_10166605
648 Ga0207654_10171709
649 Ga0207660_10035837
650 Ga0207660_10263076
651 Ga0207657_10001916
652 Ga0207657_10002199
653 Ga0207657_10009183
654 Ga0207657_10017349
655 Ga0207649_10009759
656 Ga0207649_10117182
657 Ga0207652_10005673
658 Ga0207652_10010754
659 Ga0207652_10062467
660 Ga0207681_10000002
661 Ga0207681_10000069
662 Ga0207681_10000394
663 Ga0207681_10000540
664 Ga0207681_10000913
665 Ga0207681_10338125
666 Ga0207650_10004106
667 Ga0207650_10053048
668 Ga0207650_10374434
669 Ga0207644_10000002
670 Ga0207644_10000003
671 Ga0207644_10007128
672 Ga0207644_10052094
673 Ga0207690_10003054
674 Ga0207690_10015708
675 Ga0207690_10360871
676 Ga0207706_10000384
677 Ga0207706_10021938
678 Ga0207706_10080735
679 Ga0207670_10048737
680 Ga0207711_10015441
681 Ga0207711_10021337
682 Ga0207711_10030728
683 Ga0207711_10136138
684 Ga0207711_10148271
685 Ga0207661_10462895
686 Ga0207679_10021954
687 Ga0207667_10001504
688 Ga0207667_10028393
689 Ga0207667_10036783
690 Ga0207667_10051429
691 Ga0207712_10000001
692 Ga0207712_10000074
693 Ga0207712_10138926
694 Ga0207668_10012311
695 Ga0207668_10012433
696 Ga0207668_10125955
697 Ga0207640_10000710
698 Ga0207640_10002078
699 Ga0207658_10001432
700 Ga0207658_10002560
701 Ga0207658_10003836
702 Ga0207658_10014622
703 Ga0207658_10358726
704 Ga0207703_10003100
705 Ga0207703_10004059
706 Ga0207703_10146755
707 Ga0207703_10155859
708 Ga0207639_10008976
709 Ga0207639_10021732
710 Ga0207639_10073581
711 Ga0207678_10028921
712 Ga0207678_10034371
713 Ga0207678_10048064
714 Ga0207678_10395696
715 Ga0207702_10026043
716 Ga0207641_10000057
717 Ga0207641_10033920
718 Ga0207641_10067900
719 Ga0207641_10401878
720 Ga0207676_10006691
721 Ga0207676_10016428
722 Ga0207676_10095074
723 Ga0207674_10070233
724 Ga0207674_10387823
725 Ga0207675_100006830
726 Ga0207675_100010893
727 Ga0207698_10095968
728 Ga0207698_10250988
729 Ga0209983_1020136
730 Ga0209974_10020204
731 Ga0207428_10014153
732 Ga0268266_10000042
733 Ga0268266_10001263
734 Ga0268265_10000241
735 Ga0268265_10002078
736 Ga0268265_10017256
737 Ga0268265_10213433
738 Ga0268265_10377333
739 Ga0268265_10645031
740 Ga0268264_10000006
741 Ga0268264_10000010
742 Ga0268264_10001517
743 Ga0268264_10014246
744 Ga0268264_10028071
745 Ga0268264_10057604
746 Ga0268264_10072469
747 Ga0268264_10317494
748 Ga0268264_10456572
749 Ga0265327_10029976
750 Ga0307408_100531404
751 Ga0316576_10228614
752 Ga0307405_10000261
753 Ga0307413_10496134
754 Ga0307406_10538919
755 Ga0307412_10001551
756 Ga0307412_10056443
757 Ga0307412_10118549
758 Ga0307412_10124603
759 Ga0307416_100167249
760 Ga0307416_100768153
761 Ga0307414_10000486
762 Ga0307414_10049776
763 Ga0307414_10184945
764 Ga0307414_10676618
765 Ga0307411_10041176
766 Ga0307411_10081568
767 Ga0307415_100435456
768 Ga0307415_100688479
769 Ga0316583_10000596
770 Ga0373931_0149713
771 Ga0316582_0009794
772 Ga0316584_0029107
773 Ga0316584_0068361
774 Ga0395905_0246215
775 Ga0395905_0506835
776 Ga0451807_1998519
777 Ga0451837_0377562
778 Ga0451845_0387628
779 Ga0451849_0013600
780 Ga0451853_3835874
781 Ga0439462_0003548
782 Ga0466957_0042948
783 Ga0466957_0094796
784 Ga0451576_0000007
785 Ga0466967_0364631
786 Ga0495638_0019303
787 Ga0495605_0192362
788 Ga0495596_0000472
789 Ga0495607_0051622
790 Ga0495583_0096683
791 Ga0495610_0000269
792 Ga0495632_0030515
793 Ga0495643_0000207
794 Ga0495643_0004935
795 Ga0495643_0021449
796 Ga0495598_0009012
797 Ga0495598_0019159
798 Ga0495609_0016619
799 Ga0495621_0014061
800 Ga0495656_0091331
801 Ga0495668_0015679
802 Ga0495625_0064087
803 Ga0495670_0028128
804 Ga0495671_0107407
805 Ga0495615_0009102
806 Ga0495626_0003607
807 Ga0496100_0064217
808 Ga0496101_0014777
809 Ga0496102_0001063
810 Ga0496102_0044986
811 Ga0496102_0232365
812 Ga0496102_0275185
813 Ga0496103_0000195
814 Ga0496103_0076456
815 Ga0496104_0001584
816 Ga0496104_0543544
817 Ga0496105_0058395
818 Ga0496106_0030964
819 Ga0496106_0081636
820 Ga0496107_0002736
821 Ga0496107_0180973
822 Ga0496109_0097060
823 Ga0496110_0108850
824 Ga0496112_0181211
825 Ga0496113_0007041
826 Ga0496113_0022685
827 Ga0496113_0711737
828 Ga0496114_0086723
829 Ga0496116_0043813
830 Ga0496116_0078600
831 Ga0496117_0004618
832 Ga0496117_0132430
833 Ga0496118_0078874
834 Ga0496119_0030524
835 Ga0496120_0001380
836 Ga0496121_0002650
837 Ga0496122_0049641
838 Ga0496123_0042462
839 Ga0496123_0078325
840 Ga0496123_0100059
841 Ga0496123_0122163
842 Ga0496123_0131543
843 Ga0496124_0000982
844 Ga0496124_0103542
845 Ga0496124_0191993
846 Ga0496125_0097990
847 Ga0496125_0153195
848 Ga0496125_0170224
849 Ga0496126_0000476
850 Ga0496126_0005453
851 Ga0496126_0246835
852 Ga0501034_0049747
853 Ga0501034_0629810
854 Ga0501047_0324884
855 Ga0501224_000020
856 Ga0501233_001289
857 Ga0501235_009091
858 Ga0501225_0000009
859 Ga0501234_001287
860 Ga0501080_0088502
861 Ga0501044_0013804
862 Ga0501044_0242125
863 Ga0501226_000136
864 nmdc:mga00v17_43018_c1
865 nmdc:mga0k408_1951_c1
866 nmdc:mga07m45_122530_c1
867 nmdc:mga07m45_152888_c1
868 nmdc:mga07m45_23149_c1
869 nmdc:mga07m45_58012_c1
870 Ga0500643_000001
871 Ga0500643_023017
872 Ga0500562_022811
873 Ga0500592_026360
874 Ga0500595_009072
875 Ga0500559_0001214
876 Ga0500559_0006328
877 Ga0500604_0028064
878 Ga0500604_0065074
879 Ga0500616_0000893
880 Ga0500616_0038197
881 Ga0500622_0000145
882 Ga0500636_0010303
883 Ga0500637_0006635
884 Ga0500645_004302
885 Ga0500645_009595
886 2511125739
887 2643949845
888 2738711556
889 2738849981
890 2738865710
891 2739298228
892 2739359906
893 2778124695
894 2819553085
895 2882808459
896 2895884250
897 2896187224
898 2928104174
899 2928961639
900 8054305877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

144

246

0.99

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

7

105

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9368 2 246
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9305 2 246
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9089 2 246
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.8969 2 246
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.8966 1 248
ID Description Score Start End Superfamily
af_C7J2E5_59_129_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9552 3 65 3.30.70.580
af_Q54RR6_2_123_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9527 1 104 3.30.70.580
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9527 2 103 3.30.70.580
af_Q2QWH9_69_188_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9468 2 104 3.30.70.580
af_Q2FW37_1_104_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9428 3 106 3.30.70.580
ID Description Score Start End GO Terms
AF-A0A1C2AVU2-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9934 1 70 GO:0003723
GO:0009982
GO:0031119
GO:0140098
AF-A0A2N3DTC3-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9893 1 113 GO:0003723
GO:0031119
GO:0160147
AF-A0A533YIS0-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9803 1 105 GO:0003723
GO:0031119
GO:0160147
AF-A0A352GH46-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9795 1 136 GO:0003723
GO:0031119
GO:0160147
AF-A0A1C2AVU2-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9795 1 70 GO:0003723
GO:0009982
GO:0031119
GO:0140098

Map