F446705

General Info

Members Datasets Scaffolds Average Seq Length
451 233 902 157

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10017665|JGI24740J21852_100176653
Length 173
Sequence MRQNKNSDVVYSPSGVGDFTHLDEQGKATMVNVSEKKITQRSATARSIVQLPQAVLDKLIDGDIQTKKGSVFQTAIIAGIMAAKKTGDLIPLCHPLGLENCKVDIHLNDQQELVIDCTTNITAKTGVEMEALVGASIAALTIYDMCKALSHDIVIKETKLMEKTGGKNDFKRA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
215 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
216 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
217 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
218 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
219 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
220 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
221 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
222 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
223 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
224 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
225 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
226 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
227 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
228 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
229 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
230 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
231 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
232 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
233 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0.22
Isolates 3.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.31
Nodule 0
Rhizoplane 1.11
Rhizosphere 83.37
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017665 3300001979 Bacteria 2545
2 SwRhRL2b_contig_2249581 2162886007 Bacteria 2739
3 JGI24740J21852_10016410 3300001979 Bacteria 2678
4 JGI24740J21852_10141127 3300001979 Bacteria 600
5 JGI25162J39368_1002129 3300002737 Bacteria 8382
6 JGI25406J46586_10013358 3300003203 Bacteria 3530
7 JGI25406J46586_10021135 3300003203 Bacteria 2618
8 JGI25165J46597_1001445 3300003214 Bacteria 12601
9 JGI25153J46596_10058865 3300003215 Unclassified 1055
10 JGI25153J46596_10066463 3300003215 Bacteria 954
11 rootH2_10001101 3300003320 Bacteria 45863
12 rootH2_10021057 3300003320 Bacteria 19112
13 rootH2_10154995 3300003320 Bacteria 1871
14 rootH2_10215700 3300003320 Bacteria 2621
15 rootH1_10009528 3300003323 Bacteria 31356
16 rootH1_10039649 3300003323 Bacteria 1328
17 rootH1_10094446 3300003323 Bacteria 2165
18 rootH1_10158475 3300003323 Bacteria 2210
19 rootH1_10232185 3300003323 Bacteria 3721
20 JGI25160J50197_1007750 3300003354 Bacteria 4166
21 JGI25160J50197_1010557 3300003354 Unclassified 3329
22 Ga0055526_1015271 3300003771 Bacteria 3092
23 Ga0055526_1017392 3300003771 Bacteria 2748
24 Ga0055528_1000600 3300003790 Bacteria 27092
25 Ga0055530_10011881 3300003791 Bacteria 3084
26 Ga0055543_1032763 3300004625 Bacteria 901
27 Ga0058863_11903483 3300004799 Bacteria 5348
28 Ga0065165_1000100 3300005262 Bacteria 141963
29 Ga0065714_10006471 3300005288 Bacteria 5544
30 Ga0065704_10001934 3300005289 Bacteria 8070
31 Ga0065715_10584689 3300005293 Unclassified 649
32 Ga0070658_10000011 3300005327 Bacteria 294396
33 Ga0070658_10059182 3300005327 Bacteria 3120
34 Ga0070658_10187503 3300005327 Bacteria 1742
35 Ga0070658_10753882 3300005327 Unclassified 845
36 Ga0070676_10000471 3300005328 Bacteria 19324
37 Ga0070676_10110857 3300005328 Bacteria 1708
38 Ga0070676_11150863 3300005328 Bacteria 588
39 Ga0070683_100104508 3300005329 Bacteria 2669
40 Ga0070690_100230531 3300005330 Bacteria 1302
41 Ga0070670_100259120 3300005331 Bacteria 1516
42 Ga0070677_10478376 3300005333 Bacteria 671
43 Ga0068869_100150757 3300005334 Bacteria 1803
44 Ga0068869_100488382 3300005334 Unclassified 1026
45 Ga0068869_100592781 3300005334 Bacteria 935
46 Ga0070666_10193073 3300005335 Bacteria 1431
47 Ga0070680_100317620 3300005336 Bacteria 1322
48 Ga0070680_100327163 3300005336 Bacteria 1301
49 Ga0070680_100725343 3300005336 Unclassified 855
50 Ga0070660_100014306 3300005339 Bacteria 5714
51 Ga0070660_100055845 3300005339 Bacteria 3053
52 Ga0070660_100284733 3300005339 Bacteria 1353
53 Ga0070661_100276884 3300005344 Bacteria 1301
54 Ga0070669_100267287 3300005353 Unclassified 1366
55 Ga0070675_100176988 3300005354 Bacteria 1842
56 Ga0070671_100029755 3300005355 Bacteria 4505
57 Ga0070671_100575466 3300005355 Bacteria 972
58 Ga0070674_100157872 3300005356 Bacteria 1718
59 Ga0070674_100369679 3300005356 Bacteria 1163
60 Ga0070673_100006304 3300005364 Bacteria 7702
61 Ga0070673_100236646 3300005364 Unclassified 1586
62 Ga0070659_100004095 3300005366 Bacteria 10394
63 Ga0070659_100178954 3300005366 Unclassified 1739
64 Ga0070659_100512986 3300005366 Bacteria 1023
65 Ga0070678_100002096 3300005456 Bacteria 10811
66 Ga0070662_100002245 3300005457 Bacteria 11849
67 Ga0070662_100136109 3300005457 Bacteria 1899
68 Ga0070662_100412540 3300005457 Bacteria 1116
69 Ga0070662_100698408 3300005457 Bacteria 858
70 Ga0070681_10093028 3300005458 Bacteria 2964
71 Ga0068867_100003012 3300005459 Bacteria 11876
72 Ga0068867_100380966 3300005459 Bacteria 1185
73 Ga0068867_101079096 3300005459 Bacteria 732
74 Ga0070679_100032826 3300005530 Bacteria 5138
75 Ga0070679_100141055 3300005530 Bacteria 2389
76 Ga0070679_100526702 3300005530 Bacteria 1126
77 Ga0070684_100121665 3300005535 Unclassified 2348
78 Ga0070684_101013127 3300005535 Bacteria 779
79 Ga0068853_100004807 3300005539 Bacteria 10506
80 Ga0068853_100049786 3300005539 Bacteria 3602
81 Ga0068853_100275649 3300005539 Unclassified 1550
82 Ga0068853_100846797 3300005539 Bacteria 877
83 Ga0070695_101537486 3300005545 Unclassified 554
84 Ga0070665_100000003 3300005548 Bacteria 811857
85 Ga0070665_100006942 3300005548 Bacteria 11513
86 Ga0068855_100010991 3300005563 Bacteria 10924
87 Ga0068855_100017518 3300005563 Bacteria 8614
88 Ga0068855_100208154 3300005563 Unclassified 2199
89 Ga0068855_100233312 3300005563 Bacteria 2059
90 Ga0068855_101386092 3300005563 Bacteria 725
91 Ga0068855_101757860 3300005563 Unclassified 631
92 Ga0068855_101828029 3300005563 Bacteria 617
93 Ga0068857_100037446 3300005577 Bacteria 4297
94 Ga0068857_100107398 3300005577 Bacteria 2507
95 Ga0068857_100174186 3300005577 Bacteria 1957
96 Ga0068857_100287742 3300005577 Bacteria 1513
97 Ga0068854_101340089 3300005578 Bacteria 645
98 Ga0068856_100005531 3300005614 Bacteria 12443
99 Ga0068856_100020553 3300005614 Bacteria 6413
100 Ga0068856_100201118 3300005614 Bacteria 2007
101 Ga0068856_100565266 3300005614 Bacteria 1158
102 Ga0068852_100006806 3300005616 Bacteria 8299
103 Ga0068852_100226196 3300005616 Bacteria 1781
104 Ga0068852_100239301 3300005616 Unclassified 1734
105 Ga0068852_100839445 3300005616 Bacteria 934
106 Ga0068852_102659718 3300005616 Unclassified 520
107 Ga0068859_100039885 3300005617 Bacteria 4712
108 Ga0068859_101131958 3300005617 Bacteria 861
109 Ga0068864_100434578 3300005618 Bacteria 1253
110 Ga0068851_10107854 3300005834 Bacteria 1484
111 Ga0068851_10434717 3300005834 Bacteria 777
112 Ga0068870_10535096 3300005840 Bacteria 786
113 Ga0068858_100158547 3300005842 Bacteria 2130
114 Ga0068860_100003179 3300005843 Bacteria 16941
115 Ga0068860_100039308 3300005843 Bacteria 4525
116 Ga0068860_100749525 3300005843 Bacteria 988
117 Ga0068862_100137052 3300005844 Unclassified 2170
118 Ga0081539_10001000 3300005985 Bacteria 52492
119 Ga0081539_10027743 3300005985 Bacteria 3578
120 Ga0081539_10111806 3300005985 Bacteria 1373
121 Ga0075366_10193559 3300006195 Bacteria 1236
122 Ga0097621_100000020 3300006237 Bacteria 86226
123 Ga0097621_100597036 3300006237 Bacteria 1009
124 Ga0068871_100000130 3300006358 Bacteria 47875
125 Ga0075428_100011356 3300006844 Bacteria 9908
126 Ga0068865_100000050 3300006881 Bacteria 65632
127 Ga0097620_100039887 3300006931 Bacteria 4712
128 Ga0097620_101131964 3300006931 Bacteria 861
129 Ga0105240_10010235 3300009093 Bacteria 13201
130 Ga0105240_10017595 3300009093 Bacteria 9629
131 Ga0105240_10018707 3300009093 Bacteria 9281
132 Ga0105240_10131450 3300009093 Unclassified 3002
133 Ga0105240_11510709 3300009093 Bacteria 704
134 Ga0111539_10073077 3300009094 Unclassified 4043
135 Ga0105245_10029178 3300009098 Bacteria 4872
136 Ga0105245_10642604 3300009098 Bacteria 1091
137 Ga0105247_10452901 3300009101 Bacteria 925
138 Ga0105247_10520370 3300009101 Bacteria 870
139 Ga0105243_10079878 3300009148 Bacteria 2666
140 Ga0105241_10000281 3300009174 Bacteria 37919
141 Ga0105241_10009625 3300009174 Bacteria 7101
142 Ga0105241_10009913 3300009174 Bacteria 7001
143 Ga0105241_10063493 3300009174 Unclassified 2850
144 Ga0105241_10398170 3300009174 Bacteria 1207
145 Ga0105241_10476776 3300009174 Bacteria 1108
146 Ga0105241_11167234 3300009174 Unclassified 728
147 Ga0105242_10017684 3300009176 Bacteria 5561
148 Ga0105237_10003737 3300009545 Bacteria 17929
149 Ga0105237_10005432 3300009545 Bacteria 14392
150 Ga0105237_10018441 3300009545 Bacteria 7222
151 Ga0105237_10158158 3300009545 Unclassified 2263
152 Ga0105237_10323523 3300009545 Bacteria 1546
153 Ga0105237_10339220 3300009545 Bacteria 1507
154 Ga0105237_10628309 3300009545 Bacteria 1081
155 Ga0105238_10018941 3300009551 Bacteria 7009
156 Ga0105239_10000002 3300010375 Bacteria 610298
157 Ga0105239_10008543 3300010375 Bacteria 11630
158 Ga0105239_10071795 3300010375 Bacteria 3803
159 Ga0105239_10073017 3300010375 Unclassified 3773
160 Ga0105239_10077424 3300010375 Bacteria 3659
161 Ga0105239_10081977 3300010375 Bacteria 3551
162 Ga0105239_10188381 3300010375 Bacteria 2309
163 Ga0105239_10190093 3300010375 Unclassified 2298
164 Ga0105246_10012536 3300011119 Bacteria 5294
165 Ga0105246_10220149 3300011119 Bacteria 1487
166 Ga0105246_10775115 3300011119 Bacteria 848
167 Ga0157373_10011051 3300013100 Bacteria 6649
168 Ga0157373_10142759 3300013100 Bacteria 1684
169 Ga0157373_10239916 3300013100 Bacteria 1281
170 Ga0157371_10000269 3300013102 Bacteria 70787
171 Ga0157371_10070860 3300013102 Bacteria 2468
172 Ga0157371_10162071 3300013102 Bacteria 1597
173 Ga0157371_10373621 3300013102 Bacteria 1040
174 Ga0157371_10933133 3300013102 Bacteria 659
175 Ga0157370_10132970 3300013104 Bacteria 2320
176 Ga0157370_10464400 3300013104 Bacteria 1163
177 Ga0157370_10967153 3300013104 Bacteria 771
178 Ga0157369_10099032 3300013105 Bacteria 3108
179 Ga0157369_10157365 3300013105 Unclassified 2399
180 Ga0157369_10248245 3300013105 Bacteria 1858
181 Ga0157369_10296173 3300013105 Bacteria 1683
182 Ga0157374_10003065 3300013296 Bacteria 14011
183 Ga0157374_10003613 3300013296 Bacteria 13024
184 Ga0157374_10032460 3300013296 Bacteria 4754
185 Ga0157374_10558816 3300013296 Bacteria 1152
186 Ga0157378_10011737 3300013297 Bacteria 7670
187 Ga0157378_10025837 3300013297 Bacteria 5174
188 Ga0157378_10158271 3300013297 Bacteria 2116
189 Ga0157378_11004333 3300013297 Bacteria 869
190 Ga0163162_10000031 3300013306 Bacteria 157666
191 Ga0163162_10000705 3300013306 Bacteria 30921
192 Ga0163162_10005497 3300013306 Bacteria 12245
193 Ga0163162_10877308 3300013306 Bacteria 1011
194 Ga0163162_10917261 3300013306 Bacteria 988
195 Ga0163162_11284622 3300013306 Unclassified 831
196 Ga0163162_11451799 3300013306 Bacteria 781
197 Ga0157372_10001534 3300013307 Bacteria 25119
198 Ga0157372_10261500 3300013307 Unclassified 2010
199 Ga0157372_10288551 3300013307 Unclassified 1908
200 Ga0157372_10291468 3300013307 Bacteria 1898
201 Ga0157372_10516304 3300013307 Bacteria 1393
202 Ga0157372_10731150 3300013307 Unclassified 1151
203 Ga0157375_10070001 3300013308 Bacteria 3516
204 Ga0157375_10319225 3300013308 Bacteria 1718
205 Ga0157375_11265308 3300013308 Bacteria 867
206 Ga0163163_10623135 3300014325 Unclassified 1142
207 Ga0163163_10903493 3300014325 Bacteria 946
208 Ga0157377_10437454 3300014745 Bacteria 900
209 Ga0213872_10008555 3300021361 Bacteria 4949
210 Ga0213874_10169891 3300021377 Bacteria 771
211 Ga0209436_101223 3300025208 Bacteria 9305
212 Ga0209563_104761 3300025230 Bacteria 2545
213 Ga0207427_100766 3300025231 Bacteria 14625
214 Ga0209437_100052 3300025233 Bacteria 380548
215 Ga0209026_1013628 3300025250 Bacteria 1379
216 Ga0209233_1000067 3300025261 Bacteria 380554
217 Ga0209233_1001304 3300025261 Bacteria 9948
218 Ga0209455_1004456 3300025272 Bacteria 4576
219 Ga0209673_1000049 3300025273 Bacteria 286207
220 Ga0209130_1000976 3300025284 Bacteria 22454
221 Ga0209564_1005217 3300025295 Bacteria 7518
222 Ga0209564_1007602 3300025295 Bacteria 5560
223 Ga0209564_1081662 3300025295 Unclassified 629
224 Ga0209758_1004184 3300025297 Bacteria 12259
225 Ga0209758_1008253 3300025297 Bacteria 6817
226 Ga0209050_1000272 3300025298 Bacteria 110636
227 Ga0207426_1000030 3300025302 Bacteria 461478
228 Ga0207426_1000233 3300025302 Bacteria 127848
229 Ga0207426_1001865 3300025302 Bacteria 15465
230 Ga0207426_1047250 3300025302 Bacteria 1299
231 Ga0209257_1002478 3300025304 Bacteria 18255
232 Ga0207656_10279266 3300025321 Bacteria 823
233 Ga0207647_10000463 3300025904 Bacteria 32923
234 Ga0207647_10002317 3300025904 Bacteria 14485
235 Ga0207647_10008145 3300025904 Bacteria 7530
236 Ga0207645_10000082 3300025907 Bacteria 68372
237 Ga0207705_10000015 3300025909 Bacteria 382901
238 Ga0207705_10090856 3300025909 Bacteria 2236
239 Ga0207705_10442565 3300025909 Bacteria 1007
240 Ga0207705_10544828 3300025909 Unclassified 902
241 Ga0207654_10002190 3300025911 Bacteria 9998
242 Ga0207654_10094726 3300025911 Bacteria 1828
243 Ga0207654_10244739 3300025911 Bacteria 1200
244 Ga0207707_10528295 3300025912 Bacteria 1004
245 Ga0207695_10010555 3300025913 Bacteria 11295
246 Ga0207695_10022088 3300025913 Bacteria 7238
247 Ga0207695_10026330 3300025913 Bacteria 6492
248 Ga0207695_10045184 3300025913 Bacteria 4678
249 Ga0207695_10169042 3300025913 Unclassified 2113
250 Ga0207695_11012520 3300025913 Bacteria 710
251 Ga0207671_10004889 3300025914 Bacteria 12594
252 Ga0207671_10013495 3300025914 Bacteria 6503
253 Ga0207671_10200242 3300025914 Bacteria 1559
254 Ga0207671_10285494 3300025914 Bacteria 1302
255 Ga0207660_10121846 3300025917 Bacteria 1976
256 Ga0207657_10118301 3300025919 Bacteria 2181
257 Ga0207657_10168624 3300025919 Bacteria 1775
258 Ga0207649_10193466 3300025920 Unclassified 1432
259 Ga0207652_10561611 3300025921 Unclassified 1025
260 Ga0207652_10675776 3300025921 Bacteria 922
261 Ga0207652_10911167 3300025921 Bacteria 776
262 Ga0207681_10606889 3300025923 Bacteria 905
263 Ga0207694_10097885 3300025924 Bacteria 2322
264 Ga0207650_10449747 3300025925 Unclassified 1072
265 Ga0207659_10110951 3300025926 Unclassified 2085
266 Ga0207659_10861722 3300025926 Bacteria 779
267 Ga0207659_11255596 3300025926 Bacteria 636
268 Ga0207644_10025333 3300025931 Bacteria 4080
269 Ga0207644_10698221 3300025931 Bacteria 846
270 Ga0207690_10018517 3300025932 Bacteria 4271
271 Ga0207690_10862537 3300025932 Bacteria 750
272 Ga0207706_10001363 3300025933 Bacteria 24429
273 Ga0207706_10006247 3300025933 Bacteria 11074
274 Ga0207669_10167058 3300025937 Bacteria 1562
275 Ga0207669_10386974 3300025937 Bacteria 1091
276 Ga0207704_10000078 3300025938 Bacteria 59491
277 Ga0207691_10205477 3300025940 Bacteria 1713
278 Ga0207691_11036514 3300025940 Bacteria 684
279 Ga0207689_10249464 3300025942 Unclassified 1468
280 Ga0207689_10376998 3300025942 Bacteria 1181
281 Ga0207661_10911308 3300025944 Bacteria 809
282 Ga0207679_10471249 3300025945 Bacteria 1116
283 Ga0207667_10001584 3300025949 Bacteria 28609
284 Ga0207667_10013812 3300025949 Bacteria 9224
285 Ga0207667_10037382 3300025949 Bacteria 5190
286 Ga0207667_10045148 3300025949 Bacteria 4667
287 Ga0207667_10056234 3300025949 Bacteria 4134
288 Ga0207667_10227629 3300025949 Bacteria 1910
289 Ga0207667_10366928 3300025949 Unclassified 1468
290 Ga0207667_11256867 3300025949 Unclassified 718
291 Ga0207667_11501597 3300025949 Bacteria 645
292 Ga0207651_10003963 3300025960 Bacteria 7353
293 Ga0207651_10210453 3300025960 Unclassified 1565
294 Ga0207640_11139626 3300025981 Unclassified 691
295 Ga0207640_11246111 3300025981 Bacteria 663
296 Ga0207640_12014018 3300025981 Bacteria 523
297 Ga0207658_11413263 3300025986 Unclassified 636
298 Ga0207658_11464018 3300025986 Bacteria 625
299 Ga0207639_10002536 3300026041 Bacteria 12254
300 Ga0207639_10184541 3300026041 Unclassified 1777
301 Ga0207639_10487562 3300026041 Bacteria 1124
302 Ga0207639_10502930 3300026041 Bacteria 1107
303 Ga0207639_11131218 3300026041 Bacteria 734
304 Ga0207702_10054908 3300026078 Bacteria 3377
305 Ga0207702_10079442 3300026078 Bacteria 2843
306 Ga0207702_10593192 3300026078 Bacteria 1087
307 Ga0207702_10878119 3300026078 Bacteria 888
308 Ga0207702_10982871 3300026078 Bacteria 837
309 Ga0207702_12406608 3300026078 Bacteria 514
310 Ga0207641_11335808 3300026088 Bacteria 718
311 Ga0207648_10000472 3300026089 Bacteria 44933
312 Ga0207648_10239697 3300026089 Bacteria 1614
313 Ga0207676_10243860 3300026095 Bacteria 1614
314 Ga0207676_10257108 3300026095 Bacteria 1575
315 Ga0207676_10389267 3300026095 Bacteria 1300
316 Ga0207676_12431691 3300026095 Bacteria 521
317 Ga0207674_10177020 3300026116 Unclassified 2085
318 Ga0207674_10212888 3300026116 Bacteria 1881
319 Ga0207674_10308827 3300026116 Bacteria 1531
320 Ga0207674_10661551 3300026116 Bacteria 1009
321 Ga0207675_100375005 3300026118 Bacteria 1398
322 Ga0207683_10014226 3300026121 Bacteria 6778
323 Ga0207698_10161706 3300026142 Bacteria 1959
324 Ga0207698_10283439 3300026142 Bacteria 1534
325 Ga0207698_10302479 3300026142 Bacteria 1489
326 Ga0207698_10588993 3300026142 Bacteria 1095
327 Ga0207698_11080014 3300026142 Bacteria 815
328 Ga0268266_10000052 3300028379 Bacteria 296230
329 Ga0268266_10042782 3300028379 Unclassified 3870
330 Ga0268265_10095657 3300028380 Unclassified 2385
331 Ga0268264_10005023 3300028381 Bacteria 11200
332 Ga0268264_12032374 3300028381 Bacteria 584
333 Ga0307517_10013049 3300028786 Bacteria 11328
334 Ga0307515_10000280 3300028794 Bacteria 125330
335 Ga0265338_10014193 3300028800 Bacteria 8897
336 Ga0265320_10069354 3300031240 Bacteria 1664
337 Ga0265327_10045402 3300031251 Bacteria 2335
338 Ga0307509_10007469 3300031507 Bacteria 14263
339 Ga0307509_10480132 3300031507 Bacteria 931
340 Ga0307412_11537006 3300031911 Bacteria 606
341 Ga0307510_10021390 3300033180 Bacteria 7538
342 Ga0307510_10484276 3300033180 Bacteria 679
343 Ga0373941_0044832 3300035115 Bacteria 1381
344 Ga0395899_0000002 3300037312 Bacteria 1324310
345 Ga0395899_0000312 3300037312 Bacteria 62304
346 Ga0395899_0072330 3300037312 Bacteria 2523
347 Ga0395900_0000014 3300037418 Bacteria 386513
348 Ga0395900_0000128 3300037418 Bacteria 127446
349 Ga0395900_0005426 3300037418 Bacteria 13362
350 Ga0395900_0986217 3300037418 Bacteria 763
351 Ga0395898_0021189 3300037466 Bacteria 6594
352 Ga0395905_0000037 3300037471 Bacteria 261808
353 Ga0395905_0006237 3300037471 Bacteria 12038
354 Ga0395905_0170697 3300037471 Bacteria 2043
355 Ga0395905_0259434 3300037471 Unclassified 1623
356 Ga0395905_0598979 3300037471 Bacteria 1004
357 Ga0395901_0000166 3300038443 Bacteria 86352
358 Ga0436361_0360494 3300039447 Bacteria 8737
359 Ga0436363_0061232 3300039450 Bacteria 2581
360 Ga0436363_0121304 3300039450 Bacteria 1654
361 Ga0451791_0703053 3300041451 Bacteria 1186
362 Ga0451791_0969218 3300041451 Bacteria 684
363 Ga0451800_1033799 3300041459 Unclassified 701
364 Ga0451807_0001899 3300041486 Bacteria 821
365 Ga0451807_1089415 3300041486 Bacteria 529
366 Ga0451833_1056126 3300041491 Bacteria 960
367 Ga0439431_0000225 3300041997 Bacteria 11382
368 Ga0466969_0140681 3300044656 Bacteria 1115
369 Ga0466972_0073142 3300044658 Bacteria 1634
370 Ga0466972_0483093 3300044658 Bacteria 583
371 Ga0466965_0104846 3300044683 Bacteria 1449
372 Ga0453684_0096941 3300044712 Bacteria 3621
373 Ga0466968_0088057 3300044735 Bacteria 1372
374 Ga0466957_0157485 3300044842 Bacteria 1473
375 Ga0466957_0228546 3300044842 Bacteria 1231
376 Ga0466960_0267213 3300044901 Bacteria 955
377 Ga0466959_0009583 3300045049 Bacteria 6890
378 Ga0466959_1121709 3300045049 Unclassified 523
379 Ga0466967_1233281 3300045976 Bacteria 745
380 Ga0495650_0000087 3300046471 Bacteria 234870
381 Ga0495585_0137308 3300046492 Bacteria 1283
382 Ga0495596_0194502 3300046500 Bacteria 788
383 Ga0495583_0117821 3300046506 Bacteria 1120
384 Ga0495606_0546979 3300046507 Bacteria 577
385 Ga0495608_0360811 3300046511 Bacteria 893
386 Ga0495610_0064142 3300046512 Bacteria 1737
387 Ga0495616_0002580 3300046513 Bacteria 11923
388 Ga0495616_0005811 3300046513 Bacteria 7538
389 Ga0495631_0018106 3300046518 Bacteria 3320
390 Ga0495644_0235141 3300046523 Bacteria 710
391 Ga0495648_0005125 3300046524 Bacteria 10975
392 Ga0495642_0160364 3300046528 Bacteria 975
393 Ga0495652_0170444 3300046529 Unclassified 1681
394 Ga0495654_0034622 3300046530 Bacteria 2547
395 Ga0495609_0016612 3300046538 Bacteria 3427
396 Ga0495622_0164902 3300046557 Bacteria 998
397 Ga0495668_0189266 3300046616 Bacteria 1127
398 Ga0495611_0334387 3300046648 Bacteria 696
399 Ga0495625_0000008 3300046660 Bacteria 536165
400 Ga0495625_0014767 3300046660 Bacteria 6216
401 Ga0495625_0031960 3300046660 Bacteria 3910
402 Ga0495661_0003217 3300046665 Bacteria 12191
403 Ga0495671_0117910 3300046692 Bacteria 1296
404 Ga0495649_0000018 3300046694 Bacteria 220586
405 Ga0495604_0899231 3300047317 Bacteria 553
406 Ga0495672_0035866 3300047320 Bacteria 3051
407 Ga0495687_001574 3300047443 Bacteria 20718
408 Ga0495687_209927 3300047443 Bacteria 611
409 Ga0495679_086770 3300047446 Bacteria 882
410 Ga0495673_0085717 3300047469 Bacteria 1296
411 Ga0495686_0025603 3300047472 Bacteria 3867
412 Ga0495686_0030076 3300047472 Unclassified 3530
413 Ga0495686_0193718 3300047472 Bacteria 1170
414 Ga0496121_0000008 3300048924 Bacteria 843593
415 Ga0495678_030657 3300049459 Bacteria 2249
416 Ga0501033_0038409 3300049570 Bacteria 3579
417 Ga0501034_0296973 3300049571 Bacteria 1553
418 Ga0501034_0613088 3300049571 Bacteria 993
419 Ga0501037_0270358 3300049573 Bacteria 1186
420 Ga0501038_0534218 3300049574 Bacteria 894
421 Ga0501046_0000103 3300049580 Bacteria 89927
422 Ga0501047_0027417 3300049581 Bacteria 5487
423 Ga0501035_0017901 3300049822 Bacteria 6536
424 Ga0501035_0125793 3300049822 Bacteria 2238
425 Ga0501035_0379556 3300049822 Unclassified 1179
426 Ga0501044_0336629 3300049823 Bacteria 1431
427 nmdc:mga0k408_13994_c1 3300050493 Bacteria 4409
428 nmdc:mga0qj67_365061_c1 3300050509 Bacteria 1166
429 nmdc:mga08y16_111765_c1 3300050511 Unclassified 2844
430 Ga0500635_0002470 3300053080 Bacteria 4588
431 Ga0500635_0010879 3300053080 Bacteria 2570
432 Ga0500607_265108 3300053121 Bacteria 669
433 Ga0500608_028201 3300053122 Bacteria 2650
434 Ga0500608_035171 3300053122 Bacteria 2389
435 Ga0500642_0058116 3300053130 Bacteria 1728
436 Ga0500652_002298 3300053131 Bacteria 5745
437 Ga0500588_0004226 3300053146 Bacteria 3096
438 2739255291 2738543014 Bacteria 4048139
439 2839992637 2839989709 Bacteria 3773432
440 2852623773 2852623160 Bacteria 4376875
441 2884797324 2884791551 Bacteria 8511252
442 2884937321 2884933994 Bacteria 4535041
443 2896087966 2896085136 Bacteria 6129793
444 2896112310 2896109856 Bacteria 7140722
445 2911141355 2911138879 Bacteria 5811561
446 2919404073 2919399522 Bacteria 5164947
447 2929177206 2929177148 Bacteria 7883697
448 2929239628 2929239360 Bacteria 7745570
449 2945979573 2945977869 Bacteria 7777518
450 2946014559 2946013367 Bacteria 7766675
451 2946020996 2946019816 Bacteria 4621265
452 JGI24740J21852_10017665
453 SwRhRL2b_contig_2249581
454 JGI24740J21852_10016410
455 JGI24740J21852_10141127
456 JGI25162J39368_1002129
457 JGI25406J46586_10013358
458 JGI25406J46586_10021135
459 JGI25165J46597_1001445
460 JGI25153J46596_10058865
461 JGI25153J46596_10066463
462 rootH2_10001101
463 rootH2_10021057
464 rootH2_10154995
465 rootH2_10215700
466 rootH1_10009528
467 rootH1_10039649
468 rootH1_10094446
469 rootH1_10158475
470 rootH1_10232185
471 JGI25160J50197_1007750
472 JGI25160J50197_1010557
473 Ga0055526_1015271
474 Ga0055526_1017392
475 Ga0055528_1000600
476 Ga0055530_10011881
477 Ga0055543_1032763
478 Ga0058863_11903483
479 Ga0065165_1000100
480 Ga0065714_10006471
481 Ga0065704_10001934
482 Ga0065715_10584689
483 Ga0070658_10000011
484 Ga0070658_10059182
485 Ga0070658_10187503
486 Ga0070658_10753882
487 Ga0070676_10000471
488 Ga0070676_10110857
489 Ga0070676_11150863
490 Ga0070683_100104508
491 Ga0070690_100230531
492 Ga0070670_100259120
493 Ga0070677_10478376
494 Ga0068869_100150757
495 Ga0068869_100488382
496 Ga0068869_100592781
497 Ga0070666_10193073
498 Ga0070680_100317620
499 Ga0070680_100327163
500 Ga0070680_100725343
501 Ga0070660_100014306
502 Ga0070660_100055845
503 Ga0070660_100284733
504 Ga0070661_100276884
505 Ga0070669_100267287
506 Ga0070675_100176988
507 Ga0070671_100029755
508 Ga0070671_100575466
509 Ga0070674_100157872
510 Ga0070674_100369679
511 Ga0070673_100006304
512 Ga0070673_100236646
513 Ga0070659_100004095
514 Ga0070659_100178954
515 Ga0070659_100512986
516 Ga0070678_100002096
517 Ga0070662_100002245
518 Ga0070662_100136109
519 Ga0070662_100412540
520 Ga0070662_100698408
521 Ga0070681_10093028
522 Ga0068867_100003012
523 Ga0068867_100380966
524 Ga0068867_101079096
525 Ga0070679_100032826
526 Ga0070679_100141055
527 Ga0070679_100526702
528 Ga0070684_100121665
529 Ga0070684_101013127
530 Ga0068853_100004807
531 Ga0068853_100049786
532 Ga0068853_100275649
533 Ga0068853_100846797
534 Ga0070695_101537486
535 Ga0070665_100000003
536 Ga0070665_100006942
537 Ga0068855_100010991
538 Ga0068855_100017518
539 Ga0068855_100208154
540 Ga0068855_100233312
541 Ga0068855_101386092
542 Ga0068855_101757860
543 Ga0068855_101828029
544 Ga0068857_100037446
545 Ga0068857_100107398
546 Ga0068857_100174186
547 Ga0068857_100287742
548 Ga0068854_101340089
549 Ga0068856_100005531
550 Ga0068856_100020553
551 Ga0068856_100201118
552 Ga0068856_100565266
553 Ga0068852_100006806
554 Ga0068852_100226196
555 Ga0068852_100239301
556 Ga0068852_100839445
557 Ga0068852_102659718
558 Ga0068859_100039885
559 Ga0068859_101131958
560 Ga0068864_100434578
561 Ga0068851_10107854
562 Ga0068851_10434717
563 Ga0068870_10535096
564 Ga0068858_100158547
565 Ga0068860_100003179
566 Ga0068860_100039308
567 Ga0068860_100749525
568 Ga0068862_100137052
569 Ga0081539_10001000
570 Ga0081539_10027743
571 Ga0081539_10111806
572 Ga0075366_10193559
573 Ga0097621_100000020
574 Ga0097621_100597036
575 Ga0068871_100000130
576 Ga0075428_100011356
577 Ga0068865_100000050
578 Ga0097620_100039887
579 Ga0097620_101131964
580 Ga0105240_10010235
581 Ga0105240_10017595
582 Ga0105240_10018707
583 Ga0105240_10131450
584 Ga0105240_11510709
585 Ga0111539_10073077
586 Ga0105245_10029178
587 Ga0105245_10642604
588 Ga0105247_10452901
589 Ga0105247_10520370
590 Ga0105243_10079878
591 Ga0105241_10000281
592 Ga0105241_10009625
593 Ga0105241_10009913
594 Ga0105241_10063493
595 Ga0105241_10398170
596 Ga0105241_10476776
597 Ga0105241_11167234
598 Ga0105242_10017684
599 Ga0105237_10003737
600 Ga0105237_10005432
601 Ga0105237_10018441
602 Ga0105237_10158158
603 Ga0105237_10323523
604 Ga0105237_10339220
605 Ga0105237_10628309
606 Ga0105238_10018941
607 Ga0105239_10000002
608 Ga0105239_10008543
609 Ga0105239_10071795
610 Ga0105239_10073017
611 Ga0105239_10077424
612 Ga0105239_10081977
613 Ga0105239_10188381
614 Ga0105239_10190093
615 Ga0105246_10012536
616 Ga0105246_10220149
617 Ga0105246_10775115
618 Ga0157373_10011051
619 Ga0157373_10142759
620 Ga0157373_10239916
621 Ga0157371_10000269
622 Ga0157371_10070860
623 Ga0157371_10162071
624 Ga0157371_10373621
625 Ga0157371_10933133
626 Ga0157370_10132970
627 Ga0157370_10464400
628 Ga0157370_10967153
629 Ga0157369_10099032
630 Ga0157369_10157365
631 Ga0157369_10248245
632 Ga0157369_10296173
633 Ga0157374_10003065
634 Ga0157374_10003613
635 Ga0157374_10032460
636 Ga0157374_10558816
637 Ga0157378_10011737
638 Ga0157378_10025837
639 Ga0157378_10158271
640 Ga0157378_11004333
641 Ga0163162_10000031
642 Ga0163162_10000705
643 Ga0163162_10005497
644 Ga0163162_10877308
645 Ga0163162_10917261
646 Ga0163162_11284622
647 Ga0163162_11451799
648 Ga0157372_10001534
649 Ga0157372_10261500
650 Ga0157372_10288551
651 Ga0157372_10291468
652 Ga0157372_10516304
653 Ga0157372_10731150
654 Ga0157375_10070001
655 Ga0157375_10319225
656 Ga0157375_11265308
657 Ga0163163_10623135
658 Ga0163163_10903493
659 Ga0157377_10437454
660 Ga0213872_10008555
661 Ga0213874_10169891
662 Ga0209436_101223
663 Ga0209563_104761
664 Ga0207427_100766
665 Ga0209437_100052
666 Ga0209026_1013628
667 Ga0209233_1000067
668 Ga0209233_1001304
669 Ga0209455_1004456
670 Ga0209673_1000049
671 Ga0209130_1000976
672 Ga0209564_1005217
673 Ga0209564_1007602
674 Ga0209564_1081662
675 Ga0209758_1004184
676 Ga0209758_1008253
677 Ga0209050_1000272
678 Ga0207426_1000030
679 Ga0207426_1000233
680 Ga0207426_1001865
681 Ga0207426_1047250
682 Ga0209257_1002478
683 Ga0207656_10279266
684 Ga0207647_10000463
685 Ga0207647_10002317
686 Ga0207647_10008145
687 Ga0207645_10000082
688 Ga0207705_10000015
689 Ga0207705_10090856
690 Ga0207705_10442565
691 Ga0207705_10544828
692 Ga0207654_10002190
693 Ga0207654_10094726
694 Ga0207654_10244739
695 Ga0207707_10528295
696 Ga0207695_10010555
697 Ga0207695_10022088
698 Ga0207695_10026330
699 Ga0207695_10045184
700 Ga0207695_10169042
701 Ga0207695_11012520
702 Ga0207671_10004889
703 Ga0207671_10013495
704 Ga0207671_10200242
705 Ga0207671_10285494
706 Ga0207660_10121846
707 Ga0207657_10118301
708 Ga0207657_10168624
709 Ga0207649_10193466
710 Ga0207652_10561611
711 Ga0207652_10675776
712 Ga0207652_10911167
713 Ga0207681_10606889
714 Ga0207694_10097885
715 Ga0207650_10449747
716 Ga0207659_10110951
717 Ga0207659_10861722
718 Ga0207659_11255596
719 Ga0207644_10025333
720 Ga0207644_10698221
721 Ga0207690_10018517
722 Ga0207690_10862537
723 Ga0207706_10001363
724 Ga0207706_10006247
725 Ga0207669_10167058
726 Ga0207669_10386974
727 Ga0207704_10000078
728 Ga0207691_10205477
729 Ga0207691_11036514
730 Ga0207689_10249464
731 Ga0207689_10376998
732 Ga0207661_10911308
733 Ga0207679_10471249
734 Ga0207667_10001584
735 Ga0207667_10013812
736 Ga0207667_10037382
737 Ga0207667_10045148
738 Ga0207667_10056234
739 Ga0207667_10227629
740 Ga0207667_10366928
741 Ga0207667_11256867
742 Ga0207667_11501597
743 Ga0207651_10003963
744 Ga0207651_10210453
745 Ga0207640_11139626
746 Ga0207640_11246111
747 Ga0207640_12014018
748 Ga0207658_11413263
749 Ga0207658_11464018
750 Ga0207639_10002536
751 Ga0207639_10184541
752 Ga0207639_10487562
753 Ga0207639_10502930
754 Ga0207639_11131218
755 Ga0207702_10054908
756 Ga0207702_10079442
757 Ga0207702_10593192
758 Ga0207702_10878119
759 Ga0207702_10982871
760 Ga0207702_12406608
761 Ga0207641_11335808
762 Ga0207648_10000472
763 Ga0207648_10239697
764 Ga0207676_10243860
765 Ga0207676_10257108
766 Ga0207676_10389267
767 Ga0207676_12431691
768 Ga0207674_10177020
769 Ga0207674_10212888
770 Ga0207674_10308827
771 Ga0207674_10661551
772 Ga0207675_100375005
773 Ga0207683_10014226
774 Ga0207698_10161706
775 Ga0207698_10283439
776 Ga0207698_10302479
777 Ga0207698_10588993
778 Ga0207698_11080014
779 Ga0268266_10000052
780 Ga0268266_10042782
781 Ga0268265_10095657
782 Ga0268264_10005023
783 Ga0268264_12032374
784 Ga0307517_10013049
785 Ga0307515_10000280
786 Ga0265338_10014193
787 Ga0265320_10069354
788 Ga0265327_10045402
789 Ga0307509_10007469
790 Ga0307509_10480132
791 Ga0307412_11537006
792 Ga0307510_10021390
793 Ga0307510_10484276
794 Ga0373941_0044832
795 Ga0395899_0000002
796 Ga0395899_0000312
797 Ga0395899_0072330
798 Ga0395900_0000014
799 Ga0395900_0000128
800 Ga0395900_0005426
801 Ga0395900_0986217
802 Ga0395898_0021189
803 Ga0395905_0000037
804 Ga0395905_0006237
805 Ga0395905_0170697
806 Ga0395905_0259434
807 Ga0395905_0598979
808 Ga0395901_0000166
809 Ga0436361_0360494
810 Ga0436363_0061232
811 Ga0436363_0121304
812 Ga0451791_0703053
813 Ga0451791_0969218
814 Ga0451800_1033799
815 Ga0451807_0001899
816 Ga0451807_1089415
817 Ga0451833_1056126
818 Ga0439431_0000225
819 Ga0466969_0140681
820 Ga0466972_0073142
821 Ga0466972_0483093
822 Ga0466965_0104846
823 Ga0453684_0096941
824 Ga0466968_0088057
825 Ga0466957_0157485
826 Ga0466957_0228546
827 Ga0466960_0267213
828 Ga0466959_0009583
829 Ga0466959_1121709
830 Ga0466967_1233281
831 Ga0495650_0000087
832 Ga0495585_0137308
833 Ga0495596_0194502
834 Ga0495583_0117821
835 Ga0495606_0546979
836 Ga0495608_0360811
837 Ga0495610_0064142
838 Ga0495616_0002580
839 Ga0495616_0005811
840 Ga0495631_0018106
841 Ga0495644_0235141
842 Ga0495648_0005125
843 Ga0495642_0160364
844 Ga0495652_0170444
845 Ga0495654_0034622
846 Ga0495609_0016612
847 Ga0495622_0164902
848 Ga0495668_0189266
849 Ga0495611_0334387
850 Ga0495625_0000008
851 Ga0495625_0014767
852 Ga0495625_0031960
853 Ga0495661_0003217
854 Ga0495671_0117910
855 Ga0495649_0000018
856 Ga0495604_0899231
857 Ga0495672_0035866
858 Ga0495687_001574
859 Ga0495687_209927
860 Ga0495679_086770
861 Ga0495673_0085717
862 Ga0495686_0025603
863 Ga0495686_0030076
864 Ga0495686_0193718
865 Ga0496121_0000008
866 Ga0495678_030657
867 Ga0501033_0038409
868 Ga0501034_0296973
869 Ga0501034_0613088
870 Ga0501037_0270358
871 Ga0501038_0534218
872 Ga0501046_0000103
873 Ga0501047_0027417
874 Ga0501035_0017901
875 Ga0501035_0125793
876 Ga0501035_0379556
877 Ga0501044_0336629
878 nmdc:mga0k408_13994_c1
879 nmdc:mga0qj67_365061_c1
880 nmdc:mga08y16_111765_c1
881 Ga0500635_0002470
882 Ga0500635_0010879
883 Ga0500607_265108
884 Ga0500608_028201
885 Ga0500608_035171
886 Ga0500642_0058116
887 Ga0500652_002298
888 Ga0500588_0004226
889 2739255291
890 2839992637
891 2852623773
892 2884797324
893 2884937321
894 2896087966
895 2896112310
896 2911141355
897 2919404073
898 2929177206
899 2929239628
900 2945979573
901 2946014559
902 2946020996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

30

166

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.8602 17 158
1eks-assembly1.cif.gz_A asp128ala variant of moac protein from e. coli 0.8598 17 158
1ekr-assembly1.cif.gz_A moac protein from e. coli 0.8587 13 158
4pyd-assembly1.cif.gz_D moac in complex with cpmp crystallized in space group p212121 0.8577 7 153
4pyd-assembly1.cif.gz_F moac in complex with cpmp crystallized in space group p212121 0.8559 26 147
ID Description Score Start End Superfamily
af_P9WJR7_13_167_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8736 7 155 3.30.70.640
af_Q20624_440_595_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8605 5 159 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8591 7 153 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8587 13 158 3.30.70.640
af_Q54NM6_454_628_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.8567 4 154 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A522H4W9-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.8971 3 157 GO:0006777
GO:0061798
GO:0061799
AF-A0A522NAT1-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.8947 6 157 GO:0006777
GO:0061798
GO:0061799
AF-A0A2E5FHE4-F1-model_v4 Cyclic pyranopterin monophosphate synthase MoaC 0.8938 1 151 GO:0006777
GO:0061799
AF-A0A2N0FR25-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.8937 4 158 GO:0006777
GO:0061799
AF-A0A1I1N7J3-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.8931 17 158 GO:0006777
GO:0061799

Map