F446719

General Info

Members Datasets Scaffolds Average Seq Length
451 236 451 301

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100183354|Ga0068869_1001833542
Length 299
Sequence VPELPDITAYIEALKIKILGQPIEDIRLSSPFLLRSVDPPLSEASGKKVTDLRRLGKRIVFGLEGDLFLIIHLMIAGRFHWKENRPKPNRQTLASFFFPSGTLLLTEAGSKKRAALYFVRGEAALAKHDPGGIEIFETDLEGFKAQLTKENHTLKRSLTDPHFFSGIGNAYSDEILHAARLSPLKLTSKLDDEEIKRLFEATQETLRLWSERLCREATENFPEKVTAFRKDMAVHGRYNLPCPRCATPVQRIVYAANEANYCPTCQTGGRLLADRALSRLLKQDWPRTLEELEQRRSET

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.89
Rhizosphere 98.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10161577 3300005295 Bacteria 1558
2 Ga0070676_10000005 3300005328 Bacteria 76787
3 Ga0070690_100081961 3300005330 Bacteria 2112
4 Ga0070670_100009066 3300005331 Bacteria 8501
5 Ga0068869_100001008 3300005334 Bacteria 16373
6 Ga0068869_100022076 3300005334 Bacteria 4383
7 Ga0068869_100110011 3300005334 Bacteria 2095
8 Ga0068869_100183354 3300005334 Bacteria 1642
9 Ga0070680_100000094 3300005336 Bacteria 50344
10 Ga0070680_100014463 3300005336 Bacteria 6172
11 Ga0070682_100001484 3300005337 Bacteria 13159
12 Ga0068868_100038163 3300005338 Bacteria 3728
13 Ga0070660_100002067 3300005339 Bacteria 13860
14 Ga0070689_100003437 3300005340 Bacteria 10539
15 Ga0070689_100020800 3300005340 Unclassified 4875
16 Ga0070689_100086795 3300005340 Bacteria 2461
17 Ga0070661_100097596 3300005344 Bacteria 2182
18 Ga0070661_100101373 3300005344 Unclassified 2142
19 Ga0070669_100154647 3300005353 Bacteria 1777
20 Ga0070675_100000093 3300005354 Bacteria 51263
21 Ga0070675_100002006 3300005354 Bacteria 15103
22 Ga0070675_100008197 3300005354 Bacteria 8105
23 Ga0070671_100007337 3300005355 Bacteria 8805
24 Ga0070671_100059748 3300005355 Bacteria 3173
25 Ga0070673_100015681 3300005364 Bacteria 5331
26 Ga0070673_100026376 3300005364 Bacteria 4291
27 Ga0070688_100006751 3300005365 Bacteria 6154
28 Ga0070688_100055978 3300005365 Unclassified 2475
29 Ga0070659_100001808 3300005366 Bacteria 15387
30 Ga0070667_100026133 3300005367 Unclassified 4855
31 Ga0070703_10004352 3300005406 Bacteria 3990
32 Ga0070701_10010232 3300005438 Bacteria 4139
33 Ga0070700_100065214 3300005441 Bacteria 2308
34 Ga0070694_100001583 3300005444 Bacteria 13379
35 Ga0070694_100003088 3300005444 Bacteria 9916
36 Ga0070694_100009510 3300005444 Bacteria 5963
37 Ga0070708_100053949 3300005445 Bacteria 3569
38 Ga0070708_100143987 3300005445 Bacteria 2212
39 Ga0070708_100186633 3300005445 Bacteria 1939
40 Ga0070662_100115199 3300005457 Bacteria 2053
41 Ga0070681_10005820 3300005458 Bacteria 11930
42 Ga0068867_100014308 3300005459 Bacteria 5620
43 Ga0070685_10008821 3300005466 Bacteria 5196
44 Ga0070706_100021548 3300005467 Bacteria 5934
45 Ga0070706_100222420 3300005467 Unclassified 1762
46 Ga0070698_100002474 3300005471 Bacteria 20388
47 Ga0070698_100008152 3300005471 Bacteria 11328
48 Ga0070698_100096813 3300005471 Bacteria 2927
49 Ga0070699_100002410 3300005518 Bacteria 16786
50 Ga0070699_100219363 3300005518 Bacteria 1695
51 Ga0070679_100001113 3300005530 Bacteria 23470
52 Ga0070697_100089908 3300005536 Bacteria 2537
53 Ga0070697_100114368 3300005536 Bacteria 2252
54 Ga0068853_100000121 3300005539 Bacteria 52919
55 Ga0068853_100148833 3300005539 Unclassified 2106
56 Ga0070672_100032261 3300005543 Bacteria 3951
57 Ga0070672_100250360 3300005543 Bacteria 1492
58 Ga0070686_100009567 3300005544 Bacteria 5449
59 Ga0070695_100000651 3300005545 Bacteria 18462
60 Ga0070695_100005037 3300005545 Bacteria 7785
61 Ga0070696_100001520 3300005546 Bacteria 15227
62 Ga0070696_100001591 3300005546 Bacteria 14883
63 Ga0070696_100046621 3300005546 Bacteria 3006
64 Ga0070693_100000104 3300005547 Bacteria 37548
65 Ga0070693_100064243 3300005547 Bacteria 2142
66 Ga0070704_100001206 3300005549 Bacteria 13566
67 Ga0070704_100005650 3300005549 Bacteria 7301
68 Ga0070704_100115738 3300005549 Bacteria 2049
69 Ga0070664_100004339 3300005564 Bacteria 11401
70 Ga0070664_100015379 3300005564 Bacteria 6257
71 Ga0070664_100084936 3300005564 Bacteria 2733
72 Ga0070664_100253928 3300005564 Bacteria 1581
73 Ga0068857_100045108 3300005577 Bacteria 3910
74 Ga0068857_100081035 3300005577 Bacteria 2898
75 Ga0068857_100543429 3300005577 Bacteria 1094
76 Ga0068854_100001779 3300005578 Bacteria 13117
77 Ga0068856_100039030 3300005614 Bacteria 4662
78 Ga0070702_100055585 3300005615 Bacteria 2283
79 Ga0068852_100430389 3300005616 Bacteria 1303
80 Ga0068859_100000052 3300005617 Bacteria 130816
81 Ga0068859_100008877 3300005617 Bacteria 10148
82 Ga0068859_100197542 3300005617 Bacteria 2096
83 Ga0068859_100327946 3300005617 Bacteria 1625
84 Ga0068864_100000991 3300005618 Bacteria 23779
85 Ga0068864_100023199 3300005618 Bacteria 5208
86 Ga0068864_100083081 3300005618 Bacteria 2812
87 Ga0068864_100167819 3300005618 Bacteria 1999
88 Ga0068864_100178609 3300005618 Bacteria 1939
89 Ga0068866_10060184 3300005718 Bacteria 1968
90 Ga0068861_100013310 3300005719 Bacteria 5756
91 Ga0068861_100022028 3300005719 Bacteria 4585
92 Ga0068861_100320755 3300005719 Unclassified 1349
93 Ga0068861_100419060 3300005719 Bacteria 1193
94 Ga0068870_10001078 3300005840 Bacteria 10846
95 Ga0068863_100001065 3300005841 Bacteria 27415
96 Ga0068863_100013195 3300005841 Bacteria 7970
97 Ga0068863_100127140 3300005841 Bacteria 2432
98 Ga0068860_100001147 3300005843 Bacteria 29074
99 Ga0068860_100011929 3300005843 Bacteria 8566
100 Ga0068860_100072354 3300005843 Bacteria 3276
101 Ga0068860_100202310 3300005843 Bacteria 1925
102 Ga0068862_100007842 3300005844 Bacteria 8832
103 Ga0068862_100081360 3300005844 Bacteria 2810
104 Ga0081540_1035484 3300005983 Bacteria 2673
105 Ga0081539_10005135 3300005985 Bacteria 13662
106 Ga0081539_10044741 3300005985 Bacteria 2553
107 Ga0070717_10007221 3300006028 Bacteria 8241
108 Ga0097621_100132708 3300006237 Bacteria 2121
109 Ga0068871_100061012 3300006358 Unclassified 3078
110 Ga0075428_100007746 3300006844 Bacteria 11901
111 Ga0075428_100019947 3300006844 Bacteria 7423
112 Ga0075428_100071976 3300006844 Bacteria 3778
113 Ga0075428_100232413 3300006844 Bacteria 1990
114 Ga0075431_100049069 3300006847 Bacteria 4354
115 Ga0075431_100347888 3300006847 Bacteria 1491
116 Ga0075433_10002568 3300006852 Bacteria 13825
117 Ga0075433_10003988 3300006852 Bacteria 11426
118 Ga0075433_10006413 3300006852 Bacteria 9302
119 Ga0075433_10028738 3300006852 Bacteria 4730
120 Ga0075433_10039060 3300006852 Bacteria 4102
121 Ga0075433_10048427 3300006852 Bacteria 3695
122 Ga0075433_10157695 3300006852 Bacteria 2019
123 Ga0075433_10194553 3300006852 Bacteria 1804
124 Ga0075434_100000173 3300006871 Bacteria 41641
125 Ga0075434_100006678 3300006871 Bacteria 10594
126 Ga0075434_100011629 3300006871 Bacteria 8312
127 Ga0075434_100012189 3300006871 Bacteria 8146
128 Ga0075434_100027494 3300006871 Bacteria 5586
129 Ga0075434_100144671 3300006871 Bacteria 2397
130 Ga0075434_100209897 3300006871 Bacteria 1967
131 Ga0075434_100282981 3300006871 Bacteria 1678
132 Ga0075429_100004094 3300006880 Bacteria 12488
133 Ga0075429_100008520 3300006880 Bacteria 8921
134 Ga0075429_100089753 3300006880 Bacteria 2679
135 Ga0075429_100496885 3300006880 Bacteria 1069
136 Ga0068865_100006363 3300006881 Bacteria 7197
137 Ga0075436_100012956 3300006914 Bacteria 5716
138 Ga0075436_100072703 3300006914 Bacteria 2380
139 Ga0097620_100000052 3300006931 Bacteria 130816
140 Ga0097620_100008878 3300006931 Bacteria 10148
141 Ga0097620_100197529 3300006931 Bacteria 2096
142 Ga0097620_100327941 3300006931 Bacteria 1625
143 Ga0075435_100008724 3300007076 Bacteria 7295
144 Ga0075435_100015026 3300007076 Bacteria 5810
145 Ga0075435_100099936 3300007076 Unclassified 2403
146 Ga0075435_100119815 3300007076 Bacteria 2195
147 Ga0075435_100132398 3300007076 Bacteria 2087
148 Ga0075435_100187763 3300007076 Bacteria 1748
149 Ga0099794_10031334 3300007265 Bacteria 2489
150 Ga0099794_10035125 3300007265 Bacteria 2365
151 Ga0111539_10002676 3300009094 Bacteria 23598
152 Ga0111539_10015093 3300009094 Bacteria 9627
153 Ga0111539_10224959 3300009094 Bacteria 2185
154 Ga0111539_10432917 3300009094 Bacteria 1532
155 Ga0111539_10733666 3300009094 Bacteria 1150
156 Ga0105247_10027869 3300009101 Bacteria 3416
157 Ga0114129_10000196 3300009147 Bacteria 67316
158 Ga0114129_10004645 3300009147 Bacteria 19383
159 Ga0114129_10033511 3300009147 Bacteria 7259
160 Ga0114129_10114092 3300009147 Bacteria 3725
161 Ga0114129_10153114 3300009147 Bacteria 3155
162 Ga0114129_10183587 3300009147 Bacteria 2845
163 Ga0114129_10317170 3300009147 Bacteria 2073
164 Ga0114129_10809807 3300009147 Bacteria 1194
165 Ga0105241_10001344 3300009174 Bacteria 18669
166 Ga0105242_10224126 3300009176 Bacteria 1682
167 Ga0105248_10000212 3300009177 Bacteria 67170
168 Ga0105248_10032363 3300009177 Bacteria 5845
169 Ga0105248_10220902 3300009177 Bacteria 2133
170 Ga0105248_10532548 3300009177 Bacteria 1325
171 Ga0105238_10012264 3300009551 Bacteria 8644
172 Ga0105238_10031381 3300009551 Bacteria 5409
173 Ga0105246_10001224 3300011119 Bacteria 15031
174 Ga0157373_10000101 3300013100 Bacteria 68799
175 Ga0157370_10399992 3300013104 Bacteria 1264
176 Ga0157369_10012134 3300013105 Bacteria 9783
177 Ga0157378_10051450 3300013297 Bacteria 3666
178 Ga0157378_10078144 3300013297 Bacteria 2984
179 Ga0157378_10472579 3300013297 Bacteria 1248
180 Ga0163162_10007685 3300013306 Bacteria 10499
181 Ga0157375_10000265 3300013308 Bacteria 47566
182 Ga0157375_10057297 3300013308 Bacteria 3851
183 Ga0157375_10311757 3300013308 Bacteria 1738
184 Ga0163163_10061103 3300014325 Unclassified 3733
185 Ga0163163_10082319 3300014325 Bacteria 3222
186 Ga0163163_10274708 3300014325 Bacteria 1736
187 Ga0157380_10137154 3300014326 Bacteria 2096
188 Ga0157377_10052255 3300014745 Bacteria 2307
189 Ga0157379_10000041 3300014968 Bacteria 78644
190 Ga0157376_10075268 3300014969 Unclassified 2881
191 Ga0163161_10326665 3300017792 Unclassified 1214
192 Ga0207656_10009483 3300025321 Bacteria 3617
193 Ga0207642_10022772 3300025899 Bacteria 2491
194 Ga0207710_10019346 3300025900 Bacteria 2905
195 Ga0207688_10008825 3300025901 Bacteria 5486
196 Ga0207645_10000391 3300025907 Bacteria 36044
197 Ga0207645_10381824 3300025907 Unclassified 946
198 Ga0207643_10000150 3300025908 Bacteria 47605
199 Ga0207684_10043490 3300025910 Bacteria 3809
200 Ga0207654_10018432 3300025911 Bacteria 3663
201 Ga0207707_10000076 3300025912 Bacteria 100491
202 Ga0207695_10031728 3300025913 Bacteria 5790
203 Ga0207660_10000022 3300025917 Bacteria 72537
204 Ga0207660_10020973 3300025917 Bacteria 4390
205 Ga0207657_10000005 3300025919 Bacteria 213481
206 Ga0207649_10116065 3300025920 Unclassified 1797
207 Ga0207652_10000060 3300025921 Bacteria 113511
208 Ga0207646_10358730 3300025922 Unclassified 1317
209 Ga0207681_10033868 3300025923 Bacteria 3354
210 Ga0207681_10065496 3300025923 Bacteria 2512
211 Ga0207681_10112620 3300025923 Unclassified 1982
212 Ga0207694_10025139 3300025924 Bacteria 4525
213 Ga0207650_10062777 3300025925 Bacteria 2776
214 Ga0207650_10194459 3300025925 Bacteria 1622
215 Ga0207659_10009073 3300025926 Bacteria 6206
216 Ga0207659_10019145 3300025926 Bacteria 4499
217 Ga0207644_10065913 3300025931 Bacteria 2635
218 Ga0207644_10127930 3300025931 Bacteria 1941
219 Ga0207690_10058708 3300025932 Bacteria 2603
220 Ga0207706_10294918 3300025933 Bacteria 1413
221 Ga0207670_10014882 3300025936 Bacteria 4632
222 Ga0207670_10280024 3300025936 Unclassified 1299
223 Ga0207669_10048075 3300025937 Bacteria 2532
224 Ga0207704_10035881 3300025938 Bacteria 2847
225 Ga0207691_10039227 3300025940 Unclassified 4381
226 Ga0207691_10061287 3300025940 Bacteria 3418
227 Ga0207691_10262978 3300025940 Bacteria 1487
228 Ga0207711_10001894 3300025941 Bacteria 19053
229 Ga0207711_10210998 3300025941 Bacteria 1773
230 Ga0207711_10358926 3300025941 Bacteria 1350
231 Ga0207689_10000050 3300025942 Bacteria 88556
232 Ga0207689_10067567 3300025942 Bacteria 2937
233 Ga0207679_10005826 3300025945 Bacteria 7739
234 Ga0207679_10057987 3300025945 Bacteria 2867
235 Ga0207679_10100124 3300025945 Bacteria 2264
236 Ga0207651_10004259 3300025960 Bacteria 7182
237 Ga0207651_10010563 3300025960 Bacteria 5122
238 Ga0207651_10021089 3300025960 Bacteria 3950
239 Ga0207651_10157031 3300025960 Unclassified 1778
240 Ga0207640_10011686 3300025981 Bacteria 4977
241 Ga0207658_10086366 3300025986 Bacteria 2419
242 Ga0207703_10039749 3300026035 Bacteria 3760
243 Ga0207639_10006144 3300026041 Bacteria 8153
244 Ga0207678_10001742 3300026067 Bacteria 19912
245 Ga0207678_10209386 3300026067 Bacteria 1668
246 Ga0207708_10102419 3300026075 Bacteria 2217
247 Ga0207702_10015942 3300026078 Bacteria 6222
248 Ga0207641_10000819 3300026088 Bacteria 33028
249 Ga0207648_10005797 3300026089 Bacteria 12374
250 Ga0207676_10025585 3300026095 Bacteria 4380
251 Ga0207676_10176534 3300026095 Bacteria 1866
252 Ga0207674_10000075 3300026116 Bacteria 105297
253 Ga0207674_10000906 3300026116 Bacteria 38641
254 Ga0207675_100005409 3300026118 Bacteria 12234
255 Ga0207675_100022912 3300026118 Bacteria 5808
256 Ga0207675_100082767 3300026118 Bacteria 3010
257 Ga0207675_100371497 3300026118 Bacteria 1405
258 Ga0207675_100426745 3300026118 Bacteria 1310
259 Ga0207698_10148454 3300026142 Bacteria 2031
260 Ga0209995_1007015 3300027471 Bacteria 1815
261 Ga0209968_1003702 3300027526 Bacteria 2292
262 Ga0209970_1000190 3300027614 Bacteria 9760
263 Ga0209983_1000129 3300027665 Bacteria 13497
264 Ga0209971_1000134 3300027682 Bacteria 22022
265 Ga0209966_1000135 3300027695 Bacteria 31056
266 Ga0209998_10000003 3300027717 Bacteria 110511
267 Ga0209998_10027579 3300027717 Bacteria 1245
268 Ga0209974_10003673 3300027876 Bacteria 5510
269 Ga0207428_10000013 3300027907 Bacteria 346742
270 Ga0268265_10013823 3300028380 Bacteria 5494
271 Ga0268265_10015853 3300028380 Bacteria 5168
272 Ga0268265_10120053 3300028380 Bacteria 2164
273 Ga0268265_10153201 3300028380 Unclassified 1947
274 Ga0268265_10162951 3300028380 Bacteria 1897
275 Ga0268264_10005613 3300028381 Bacteria 10627
276 Ga0268264_10069602 3300028381 Bacteria 2976
277 Ga0268264_10320646 3300028381 Bacteria 1465
278 Ga0307408_100039921 3300031548 Bacteria 3321
279 Ga0307405_10034026 3300031731 Bacteria 3028
280 Ga0307405_10125695 3300031731 Unclassified 1763
281 Ga0307413_10008744 3300031824 Bacteria 4802
282 Ga0307410_10097097 3300031852 Bacteria 2104
283 Ga0307410_10154654 3300031852 Bacteria 1711
284 Ga0307406_10043419 3300031901 Bacteria 2811
285 Ga0307406_10170548 3300031901 Bacteria 1574
286 Ga0307407_10129824 3300031903 Bacteria 1610
287 Ga0307412_10023441 3300031911 Bacteria 3798
288 Ga0307409_100032282 3300031995 Bacteria 3794
289 Ga0307409_100206455 3300031995 Bacteria 1762
290 Ga0307409_100761979 3300031995 Bacteria 972
291 Ga0307416_100035557 3300032002 Bacteria 3806
292 Ga0307416_100302296 3300032002 Bacteria 1591
293 Ga0307414_10121059 3300032004 Bacteria 2012
294 Ga0307411_10009688 3300032005 Bacteria 5085
295 Ga0307411_10141000 3300032005 Bacteria 1777
296 Ga0307415_100011455 3300032126 Bacteria 5076
297 Ga0373926_0040603 3300035083 Bacteria 1661
298 Ga0373940_0039486 3300035088 Bacteria 1292
299 Ga0373952_0004330 3300035092 Bacteria 2573
300 Ga0373923_0013237 3300035111 Bacteria 3070
301 Ga0373932_0066900 3300035112 Bacteria 1105
302 Ga0373945_0043474 3300035116 Bacteria 1630
303 Ga0373953_0055774 3300035117 Bacteria 1605
304 Ga0373954_0155912 3300035118 Bacteria 1116
305 Ga0373943_0000254 3300035170 Bacteria 21923
306 Ga0373943_0063384 3300035170 Bacteria 1853
307 Ga0373946_0003845 3300035171 Bacteria 5333
308 Ga0373955_0050775 3300035172 Bacteria 2257
309 Ga0373931_0003405 3300035691 Bacteria 7138
310 Ga0373931_0009904 3300035691 Bacteria 4566
311 Ga0373931_0314678 3300035691 Bacteria 970
312 Ga0373935_0137112 3300035692 Bacteria 1649
313 Ga0373935_0181949 3300035692 Bacteria 1444
314 Ga0373927_0001368 3300035695 Bacteria 18354
315 Ga0373927_0003584 3300035695 Bacteria 11078
316 Ga0373933_0021515 3300035724 Bacteria 3664
317 Ga0373947_0000807 3300035725 Bacteria 18874
318 Ga0373937_0036694 3300036401 Bacteria 4467
319 Ga0373925_0000440 3300037068 Bacteria 41982
320 Ga0395905_0622416 3300037471 Bacteria 981
321 Ga0439455_0020602 3300042012 Bacteria 1565
322 Ga0451577_0004974 3300042876 Bacteria 13794
323 Ga0451577_0111428 3300042876 Bacteria 2448
324 Ga0451577_0157058 3300042876 Bacteria 2047
325 Ga0451576_0006928 3300045051 Bacteria 13727
326 Ga0451576_0024082 3300045051 Bacteria 6578
327 Ga0451576_0045720 3300045051 Bacteria 4609
328 Ga0451576_0063246 3300045051 Bacteria 3857
329 Ga0451576_0157353 3300045051 Bacteria 2371
330 Ga0451576_0239099 3300045051 Bacteria 1897
331 Ga0451576_0600138 3300045051 Bacteria 1157
332 Ga0495603_0002828 3300046455 Bacteria 10255
333 Ga0495629_0004250 3300046459 Bacteria 10733
334 Ga0495580_0004828 3300046472 Bacteria 11284
335 Ga0495580_0273952 3300046472 Bacteria 1152
336 Ga0495582_0042547 3300046473 Bacteria 2501
337 Ga0495639_0000310 3300046475 Bacteria 23757
338 Ga0495620_0001420 3300046515 Bacteria 14378
339 Ga0495630_0007671 3300046517 Bacteria 7716
340 Ga0495643_0004342 3300046522 Bacteria 9949
341 Ga0495665_0000149 3300046531 Bacteria 34379
342 Ga0495586_0092815 3300046535 Unclassified 1669
343 Ga0495659_0061084 3300046664 Bacteria 1392
344 Ga0495588_0003518 3300046674 Bacteria 6834
345 Ga0495658_0001588 3300046683 Bacteria 11855
346 Ga0495658_0095320 3300046683 Bacteria 1769
347 Ga0495613_0149627 3300046689 Bacteria 1666
348 Ga0495600_0190249 3300046809 Bacteria 1320
349 Ga0495581_0002436 3300047315 Bacteria 10516
350 Ga0495674_0025894 3300047319 Bacteria 5370
351 Ga0495593_0009884 3300047673 Bacteria 5535
352 Ga0495614_0118803 3300048089 Bacteria 1164
353 Ga0496102_0020813 3300048905 Bacteria 5798
354 Ga0496103_0041949 3300048906 Bacteria 2814
355 Ga0496106_0095374 3300048909 Bacteria 2301
356 Ga0496112_0025398 3300048915 Bacteria 5688
357 Ga0501299_006006 3300049522 Bacteria 1891
358 Ga0501034_0080842 3300049571 Bacteria 3253
359 Ga0501038_0030496 3300049574 Bacteria 4771
360 Ga0501038_0071737 3300049574 Bacteria 2937
361 Ga0501039_0083161 3300049575 Bacteria 2493
362 Ga0501039_0161219 3300049575 Bacteria 1763
363 Ga0501040_0025476 3300049576 Bacteria 3976
364 Ga0501040_0037311 3300049576 Bacteria 3301
365 Ga0501040_0075101 3300049576 Bacteria 2336
366 Ga0501040_0089420 3300049576 Bacteria 2139
367 Ga0501042_0317175 3300049578 Bacteria 1126
368 Ga0501046_0061500 3300049580 Bacteria 2935
369 Ga0501046_0093304 3300049580 Bacteria 2314
370 Ga0501046_0167994 3300049580 Bacteria 1648
371 Ga0501071_0111918 3300049587 Bacteria 2018
372 Ga0501072_0015010 3300049588 Bacteria 5938
373 Ga0501072_0307774 3300049588 Bacteria 1260
374 Ga0501074_0008955 3300049590 Bacteria 7259
375 Ga0501074_0038449 3300049590 Bacteria 3468
376 Ga0501076_0052381 3300049592 Bacteria 3233
377 Ga0501076_0244301 3300049592 Bacteria 1469
378 Ga0501077_0000252 3300049593 Bacteria 31743
379 Ga0501233_019266 3300049668 Bacteria 1444
380 Ga0501079_0092174 3300049741 Bacteria 2347
381 Ga0501080_0026168 3300049742 Bacteria 5419
382 Ga0501080_0222508 3300049742 Bacteria 1727
383 Ga0501081_0296109 3300049743 Bacteria 1186
384 Ga0501083_0105761 3300049744 Bacteria 1853
385 Ga0501283_006947 3300049779 Bacteria 1600
386 Ga0501045_0002568 3300049824 Bacteria 12384
387 Ga0501045_0029216 3300049824 Bacteria 3983
388 Ga0501045_0109455 3300049824 Bacteria 2048
389 Ga0501045_0195682 3300049824 Bacteria 1507
390 nmdc:mga05p37_125370_c1 3300050507 Bacteria 3154
391 nmdc:mga05p37_176_c1 3300050507 Bacteria 62648
392 nmdc:mga05p37_197355_c1 3300050507 Bacteria 2440
393 nmdc:mga05p37_24502_c1 3300050507 Bacteria 7335
394 nmdc:mga05p37_2559_c1 3300050507 Bacteria 21147
395 nmdc:mga05p37_25960_c1 3300050507 Bacteria 7123
396 nmdc:mga05p37_39738_c1 3300050507 Bacteria 5776
397 nmdc:mga05p37_487785_c1 3300050507 Bacteria 1417
398 nmdc:mga09592_27260_c1 3300050508 Bacteria 4741
399 nmdc:mga09592_509069_c1 3300050508 Bacteria 1036
400 nmdc:mga09592_820_c1 3300050508 Bacteria 24055
401 nmdc:mga0qj67_280065_c1 3300050509 Bacteria 1352
402 nmdc:mga06r32_103645_c1 3300050510 Bacteria 2793
403 nmdc:mga06r32_120224_c1 3300050510 Bacteria 2591
404 nmdc:mga06r32_351654_c1 3300050510 Bacteria 1458
405 nmdc:mga08y16_154593_c1 3300050511 Bacteria 2384
406 nmdc:mga08y16_185384_c1 3300050511 Bacteria 2160
407 nmdc:mga08y16_6756_c1 3300050511 Bacteria 12035
408 nmdc:mga0n895_165202_c1 3300050512 Bacteria 2245
409 nmdc:mga0n895_21298_c1 3300050512 Bacteria 6058
410 nmdc:mga0n895_343_c1 3300050512 Bacteria 31158
411 nmdc:mga0n895_361300_c1 3300050512 Bacteria 1470
412 nmdc:mga0n895_4328_c1 3300050512 Bacteria 11641
413 nmdc:mga0n895_51877_c1 3300050512 Bacteria 4025
414 nmdc:mga0n895_99400_c1 3300050512 Bacteria 2918
415 nmdc:mga0rr50_130503_c1 3300050513 Bacteria 2012
416 nmdc:mga0rr50_2481_c1 3300050513 Bacteria 10419
417 nmdc:mga0rr50_278214_c1 3300050513 Unclassified 1396
418 nmdc:mga0rr50_335478_c1 3300050513 Bacteria 1270
419 nmdc:mga0rr50_92887_c1 3300050513 Unclassified 2353
420 nmdc:mga08x19_28083_c1 3300050514 Bacteria 3522
421 nmdc:mga08x19_308729_c1 3300050514 Bacteria 1099
422 nmdc:mga08x19_40228_c1 3300050514 Bacteria 2975
423 nmdc:mga08x19_86657_c1 3300050514 Bacteria 2062
424 nmdc:mga0a205_102043_c1 3300050515 Bacteria 2768
425 nmdc:mga0a205_16563_c1 3300050515 Bacteria 6905
426 nmdc:mga0a205_203981_c1 3300050515 Bacteria 1867
427 nmdc:mga0a205_29051_c1 3300050515 Bacteria 5290
428 nmdc:mga0a205_291617_c1 3300050515 Bacteria 1506
429 nmdc:mga0a205_292356_c1 3300050515 Bacteria 1503
430 nmdc:mga0a205_32939_c1 3300050515 Bacteria 4969
431 nmdc:mga0a205_6559_c1 3300050515 Bacteria 10525
432 nmdc:mga0a205_688_c1 3300050515 Bacteria 27014
433 nmdc:mga0a205_69486_c1 3300050515 Bacteria 3401
434 nmdc:mga0a205_76086_c1 3300050515 Bacteria 3243
435 Ga0495619_0122185 3300053085 Bacteria 1786
436 Ga0495619_0192307 3300053085 Bacteria 1412
437 Ga0500628_012292 3300053129 Bacteria 1574
438 Ga0501084_0029628 3300054114 Bacteria 4579
439 Ga0501084_0150117 3300054114 Bacteria 1964
440 Ga0501084_0151551 3300054114 Bacteria 1954
441 Ga0590071_000131 3300059421 Bacteria 20987
442 Ga0590074_001356 3300059423 Bacteria 3917
443 Ga0590075_002796 3300059424 Bacteria 4164
444 Ga0590075_003125 3300059424 Bacteria 3935
445 Ga0590077_002401 3300059426 Bacteria 4021
446 Ga0501082_0007016 3300060353 Bacteria 9721
447 Ga0501082_0096978 3300060353 Bacteria 2549
448 Ga0530510_0018989 3300061734 Bacteria 4876
449 Ga0530510_0087395 3300061734 Bacteria 2272
450 Ga0530510_0128967 3300061734 Bacteria 1860
451 Ga0530510_0188834 3300061734 Bacteria 1529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_278214_c1 nmdc:mga0rr50_278214_c1_512_1321 265
2 3300049587 Ga0501071_0111918 Ga0501071_0111918_1183_1986 267
3 3300035691 Ga0373931_0314678 Ga0373931_0314678_20_829 269
4 3300005336 Ga0070680_100014463 Ga0070680_1000144634 283
5 3300025917 Ga0207660_10020973 Ga0207660_100209732 283
6 3300025923 Ga0207681_10065496 Ga0207681_100654962 283
7 3300025942 Ga0207689_10067567 Ga0207689_100675672 283
8 3300005328 Ga0070676_10000005 Ga0070676_1000000515 288
9 3300005334 Ga0068869_100001008 Ga0068869_1000010083 288
10 3300005336 Ga0070680_100000094 Ga0070680_10000009437 288
11 3300005337 Ga0070682_100001484 Ga0070682_10000148411 288
12 3300005338 Ga0068868_100038163 Ga0068868_1000381633 288
13 3300005339 Ga0070660_100002067 Ga0070660_10000206713 288
14 3300005340 Ga0070689_100003437 Ga0070689_1000034374 288
15 3300005355 Ga0070671_100059748 Ga0070671_1000597484 288
16 3300005364 Ga0070673_100026376 Ga0070673_1000263764 288
17 3300005366 Ga0070659_100001808 Ga0070659_1000018085 288
18 3300005406 Ga0070703_10004352 Ga0070703_100043524 288
19 3300005438 Ga0070701_10010232 Ga0070701_100102323 288
20 3300005444 Ga0070694_100001583 Ga0070694_1000015834 288
21 3300005445 Ga0070708_100053949 Ga0070708_1000539494 288
22 3300005458 Ga0070681_10005820 Ga0070681_1000582011 288
23 3300005459 Ga0068867_100014308 Ga0068867_1000143085 288
24 3300005530 Ga0070679_100001113 Ga0070679_10000111311 288
25 3300005539 Ga0068853_100000121 Ga0068853_1000001212 288
26 3300005545 Ga0070695_100005037 Ga0070695_1000050376 288
27 3300005546 Ga0070696_100001591 Ga0070696_10000159114 288
28 3300005547 Ga0070693_100000104 Ga0070693_10000010428 288
29 3300005549 Ga0070704_100001206 Ga0070704_1000012065 288
30 3300005564 Ga0070664_100084936 Ga0070664_1000849362 288
31 3300005577 Ga0068857_100045108 Ga0068857_1000451084 288
32 3300005578 Ga0068854_100001779 Ga0068854_1000017793 288
33 3300005614 Ga0068856_100039030 Ga0068856_1000390302 288
34 3300005615 Ga0070702_100055585 Ga0070702_1000555852 288
35 3300005616 Ga0068852_100430389 Ga0068852_1004303891 288
36 3300005618 Ga0068864_100000991 Ga0068864_10000099116 288
37 3300005719 Ga0068861_100013310 Ga0068861_1000133105 288
38 3300005840 Ga0068870_10001078 Ga0068870_100010789 288
39 3300005841 Ga0068863_100013195 Ga0068863_1000131957 288
40 3300005843 Ga0068860_100011929 Ga0068860_1000119297 288
41 3300005844 Ga0068862_100007842 Ga0068862_1000078422 288
42 3300009174 Ga0105241_10001344 Ga0105241_1000134414 288
43 3300013100 Ga0157373_10000101 Ga0157373_1000010145 288
44 3300013105 Ga0157369_10012134 Ga0157369_100121344 288
45 3300013297 Ga0157378_10051450 Ga0157378_100514504 288
46 3300006852 Ga0075433_10048427 Ga0075433_100484272 289
47 3300006914 Ga0075436_100012956 Ga0075436_1000129564 289
48 3300009177 Ga0105248_10220902 Ga0105248_102209022 289
49 3300013308 Ga0157375_10057297 Ga0157375_100572972 289
50 3300025901 Ga0207688_10008825 Ga0207688_100088252 289
51 3300025907 Ga0207645_10000391 Ga0207645_100003913 289
52 3300025908 Ga0207643_10000150 Ga0207643_1000015012 289
53 3300025911 Ga0207654_10018432 Ga0207654_100184323 289
54 3300025912 Ga0207707_10000076 Ga0207707_1000007611 289
55 3300025917 Ga0207660_10000022 Ga0207660_1000002267 289
56 3300025919 Ga0207657_10000005 Ga0207657_10000005126 289
57 3300025921 Ga0207652_10000060 Ga0207652_10000060102 289
58 3300025932 Ga0207690_10058708 Ga0207690_100587082 289
59 3300025936 Ga0207670_10014882 Ga0207670_100148824 289
60 3300025941 Ga0207711_10210998 Ga0207711_102109982 289
61 3300025942 Ga0207689_10000050 Ga0207689_1000005053 289
62 3300025945 Ga0207679_10005826 Ga0207679_100058262 289
63 3300025960 Ga0207651_10004259 Ga0207651_100042592 289
64 3300025981 Ga0207640_10011686 Ga0207640_100116864 289
65 3300026041 Ga0207639_10006144 Ga0207639_100061444 289
66 3300026067 Ga0207678_10001742 Ga0207678_1000174213 289
67 3300026075 Ga0207708_10102419 Ga0207708_101024192 289
68 3300026078 Ga0207702_10015942 Ga0207702_100159425 289
69 3300026089 Ga0207648_10005797 Ga0207648_100057975 289
70 3300026116 Ga0207674_10000075 Ga0207674_1000007547 289
71 3300026118 Ga0207675_100022912 Ga0207675_1000229125 289
72 3300026142 Ga0207698_10148454 Ga0207698_101484542 289
73 3300028380 Ga0268265_10015853 Ga0268265_100158532 289
74 3300028381 Ga0268264_10069602 Ga0268264_100696022 289
75 3300035088 Ga0373940_0039486 Ga0373940_0039486_133_1098 289
76 3300035092 Ga0373952_0004330 Ga0373952_0004330_609_1574 289
77 3300035691 Ga0373931_0003405 Ga0373931_0003405_869_1834 289
78 3300042012 Ga0439455_0020602 Ga0439455_0020602_297_1262 289
79 3300042876 Ga0451577_0004974 Ga0451577_0004974_7651_8616 289
80 3300045051 Ga0451576_0045720 Ga0451576_0045720_203_1168 289
81 3300048905 Ga0496102_0020813 Ga0496102_0020813_2734_3699 289
82 3300048906 Ga0496103_0041949 Ga0496103_0041949_34_999 289
83 3300048909 Ga0496106_0095374 Ga0496106_0095374_606_1571 289
84 3300049574 Ga0501038_0030496 Ga0501038_0030496_1606_2505 289
85 3300049576 Ga0501040_0089420 Ga0501040_0089420_747_1646 289
86 3300049580 Ga0501046_0061500 Ga0501046_0061500_1881_2780 289
87 3300049590 Ga0501074_0008955 Ga0501074_0008955_3289_4188 289
88 3300049590 Ga0501074_0038449 Ga0501074_0038449_2379_3278 289
89 3300049593 Ga0501077_0000252 Ga0501077_0000252_4105_5004 289
90 3300049824 Ga0501045_0002568 Ga0501045_0002568_8054_8953 289
91 3300050514 nmdc:mga08x19_40228_c1 nmdc:mga08x19_40228_c1_760_1725 289
92 3300054114 Ga0501084_0029628 Ga0501084_0029628_1245_2144 289
93 3300060353 Ga0501082_0096978 Ga0501082_0096978_1334_2233 289
94 3300061734 Ga0530510_0018989 Ga0530510_0018989_2664_3563 289
95 3300031824 Ga0307413_10008744 Ga0307413_100087444 291
96 3300032005 Ga0307411_10141000 Ga0307411_101410002 291
97 3300060353 Ga0501082_0007016 Ga0501082_0007016_4979_5854 291
98 3300005444 Ga0070694_100009510 Ga0070694_1000095102 292
99 3300005545 Ga0070695_100000651 Ga0070695_1000006517 292
100 3300027471 Ga0209995_1007015 Ga0209995_10070152 292
101 3300027526 Ga0209968_1003702 Ga0209968_10037022 292
102 3300027614 Ga0209970_1000190 Ga0209970_10001903 292
103 3300027665 Ga0209983_1000129 Ga0209983_100012911 292
104 3300027682 Ga0209971_1000134 Ga0209971_100013414 292
105 3300027695 Ga0209966_1000135 Ga0209966_100013519 292
106 3300027717 Ga0209998_10000003 Ga0209998_1000000339 292
107 3300027876 Ga0209974_10003673 Ga0209974_100036734 292
108 3300042876 Ga0451577_0111428 Ga0451577_0111428_453_1331 292
109 3300045051 Ga0451576_0063246 Ga0451576_0063246_410_1309 292
110 3300005467 Ga0070706_100222420 Ga0070706_1002224202 293
111 3300025922 Ga0207646_10358730 Ga0207646_103587302 293
112 3300046515 Ga0495620_0001420 Ga0495620_0001420_5288_6181 293
113 3300031995 Ga0307409_100761979 Ga0307409_1007619791 294
114 3300037471 Ga0395905_0622416 Ga0395905_0622416_39_923 294
115 3300006028 Ga0070717_10007221 Ga0070717_100072214 297
116 3300009176 Ga0105242_10224126 Ga0105242_102241263 297
117 3300013104 Ga0157370_10399992 Ga0157370_103999922 297
118 3300014325 Ga0163163_10274708 Ga0163163_102747082 297
119 3300031995 Ga0307409_100206455 Ga0307409_1002064553 297
120 3300049522 Ga0501299_006006 Ga0501299_006006_949_1848 297
121 3300049571 Ga0501034_0080842 Ga0501034_0080842_2317_3216 297
122 3300049668 Ga0501233_019266 Ga0501233_019266_500_1399 297
123 3300049824 Ga0501045_0195682 Ga0501045_0195682_138_1037 297
124 3300005719 Ga0068861_100320755 Ga0068861_1003207552 298
125 3300006844 Ga0075428_100007746 Ga0075428_1000077465 298
126 3300006844 Ga0075428_100232413 Ga0075428_1002324132 298
127 3300013306 Ga0163162_10007685 Ga0163162_100076856 298
128 3300042876 Ga0451577_0157058 Ga0451577_0157058_200_1105 298
129 3300046809 Ga0495600_0190249 Ga0495600_0190249_72_980 298
130 3300050507 nmdc:mga05p37_39738_c1 nmdc:mga05p37_39738_c1_911_1807 298
131 3300050515 nmdc:mga0a205_292356_c1 nmdc:mga0a205_292356_c1_38_934 298
132 3300005330 Ga0070690_100081961 Ga0070690_1000819612 299
133 3300005334 Ga0068869_100183354 Ga0068869_1001833542 299
134 3300005340 Ga0070689_100020800 Ga0070689_1000208003 299
135 3300005340 Ga0070689_100086795 Ga0070689_1000867952 299
136 3300005344 Ga0070661_100101373 Ga0070661_1001013732 299
137 3300005354 Ga0070675_100000093 Ga0070675_10000009312 299
138 3300005354 Ga0070675_100002006 Ga0070675_1000020064 299
139 3300005355 Ga0070671_100007337 Ga0070671_1000073375 299
140 3300005365 Ga0070688_100006751 Ga0070688_1000067514 299
141 3300005365 Ga0070688_100055978 Ga0070688_1000559783 299
142 3300005367 Ga0070667_100026133 Ga0070667_1000261332 299
143 3300005441 Ga0070700_100065214 Ga0070700_1000652141 299
144 3300005444 Ga0070694_100003088 Ga0070694_1000030887 299
145 3300005466 Ga0070685_10008821 Ga0070685_100088212 299
146 3300005471 Ga0070698_100002474 Ga0070698_10000247412 299
147 3300005518 Ga0070699_100002410 Ga0070699_1000024109 299
148 3300005544 Ga0070686_100009567 Ga0070686_1000095673 299
149 3300005546 Ga0070696_100001520 Ga0070696_1000015205 299
150 3300005549 Ga0070704_100005650 Ga0070704_1000056505 299
151 3300005564 Ga0070664_100004339 Ga0070664_1000043392 299
152 3300005564 Ga0070664_100253928 Ga0070664_1002539282 299
153 3300005577 Ga0068857_100543429 Ga0068857_1005434291 299
154 3300005617 Ga0068859_100008877 Ga0068859_1000088772 299
155 3300005617 Ga0068859_100197542 Ga0068859_1001975423 299
156 3300005618 Ga0068864_100083081 Ga0068864_1000830812 299
157 3300005618 Ga0068864_100167819 Ga0068864_1001678192 299
158 3300005841 Ga0068863_100001065 Ga0068863_1000010655 299
159 3300005843 Ga0068860_100001147 Ga0068860_1000011477 299
160 3300005843 Ga0068860_100202310 Ga0068860_1002023102 299
161 3300005985 Ga0081539_10005135 Ga0081539_100051358 299
162 3300005985 Ga0081539_10044741 Ga0081539_100447412 299
163 3300006237 Ga0097621_100132708 Ga0097621_1001327082 299
164 3300006358 Ga0068871_100061012 Ga0068871_1000610122 299
165 3300006852 Ga0075433_10006413 Ga0075433_100064135 299
166 3300006852 Ga0075433_10194553 Ga0075433_101945532 299
167 3300006871 Ga0075434_100012189 Ga0075434_1000121895 299
168 3300006880 Ga0075429_100089753 Ga0075429_1000897532 299
169 3300006931 Ga0097620_100008878 Ga0097620_1000088787 299
170 3300006931 Ga0097620_100197529 Ga0097620_1001975293 299
171 3300007265 Ga0099794_10031334 Ga0099794_100313343 299
172 3300009094 Ga0111539_10015093 Ga0111539_100150936 299
173 3300009101 Ga0105247_10027869 Ga0105247_100278694 299
174 3300009177 Ga0105248_10000212 Ga0105248_1000021256 299
175 3300013297 Ga0157378_10472579 Ga0157378_104725792 299
176 3300013308 Ga0157375_10000265 Ga0157375_1000026539 299
177 3300013308 Ga0157375_10311757 Ga0157375_103117571 299
178 3300014325 Ga0163163_10061103 Ga0163163_100611032 299
179 3300014325 Ga0163163_10082319 Ga0163163_100823193 299
180 3300014326 Ga0157380_10137154 Ga0157380_101371542 299
181 3300014745 Ga0157377_10052255 Ga0157377_100522552 299
182 3300014968 Ga0157379_10000041 Ga0157379_1000004120 299
183 3300014969 Ga0157376_10075268 Ga0157376_100752682 299
184 3300017792 Ga0163161_10326665 Ga0163161_103266651 299
185 3300025900 Ga0207710_10019346 Ga0207710_100193462 299
186 3300025907 Ga0207645_10381824 Ga0207645_103818241 299
187 3300025920 Ga0207649_10116065 Ga0207649_101160652 299
188 3300025923 Ga0207681_10112620 Ga0207681_101126202 299
189 3300025926 Ga0207659_10019145 Ga0207659_100191452 299
190 3300025931 Ga0207644_10065913 Ga0207644_100659132 299
191 3300025936 Ga0207670_10280024 Ga0207670_102800242 299
192 3300025940 Ga0207691_10039227 Ga0207691_100392274 299
193 3300025941 Ga0207711_10001894 Ga0207711_100018943 299
194 3300025945 Ga0207679_10100124 Ga0207679_101001242 299
195 3300025960 Ga0207651_10157031 Ga0207651_101570312 299
196 3300025986 Ga0207658_10086366 Ga0207658_100863662 299
197 3300026088 Ga0207641_10000819 Ga0207641_100008194 299
198 3300026095 Ga0207676_10176534 Ga0207676_101765343 299
199 3300026118 Ga0207675_100426745 Ga0207675_1004267451 299
200 3300027717 Ga0209998_10027579 Ga0209998_100275791 299
201 3300028380 Ga0268265_10153201 Ga0268265_101532012 299
202 3300028381 Ga0268264_10005613 Ga0268264_100056133 299
203 3300028381 Ga0268264_10320646 Ga0268264_103206462 299
204 3300031548 Ga0307408_100039921 Ga0307408_1000399211 299
205 3300031731 Ga0307405_10034026 Ga0307405_100340263 299
206 3300031852 Ga0307410_10097097 Ga0307410_100970972 299
207 3300031852 Ga0307410_10154654 Ga0307410_101546541 299
208 3300031901 Ga0307406_10043419 Ga0307406_100434192 299
209 3300031901 Ga0307406_10170548 Ga0307406_101705482 299
210 3300031903 Ga0307407_10129824 Ga0307407_101298242 299
211 3300031911 Ga0307412_10023441 Ga0307412_100234413 299
212 3300031995 Ga0307409_100032282 Ga0307409_1000322823 299
213 3300032002 Ga0307416_100035557 Ga0307416_1000355573 299
214 3300032004 Ga0307414_10121059 Ga0307414_101210593 299
215 3300032126 Ga0307415_100011455 Ga0307415_1000114553 299
216 3300035083 Ga0373926_0040603 Ga0373926_0040603_22_921 299
217 3300035116 Ga0373945_0043474 Ga0373945_0043474_10_909 299
218 3300035170 Ga0373943_0000254 Ga0373943_0000254_11558_12457 299
219 3300035171 Ga0373946_0003845 Ga0373946_0003845_4366_5265 299
220 3300035692 Ga0373935_0137112 Ga0373935_0137112_35_934 299
221 3300035695 Ga0373927_0003584 Ga0373927_0003584_10107_11006 299
222 3300035725 Ga0373947_0000807 Ga0373947_0000807_4493_5392 299
223 3300037068 Ga0373925_0000440 Ga0373925_0000440_24059_24958 299
224 3300045051 Ga0451576_0024082 Ga0451576_0024082_4202_5113 299
225 3300046455 Ga0495603_0002828 Ga0495603_0002828_3661_4560 299
226 3300046459 Ga0495629_0004250 Ga0495629_0004250_763_1662 299
227 3300046473 Ga0495582_0042547 Ga0495582_0042547_60_959 299
228 3300046475 Ga0495639_0000310 Ga0495639_0000310_13932_14831 299
229 3300046517 Ga0495630_0007671 Ga0495630_0007671_5787_6686 299
230 3300046531 Ga0495665_0000149 Ga0495665_0000149_974_1873 299
231 3300046674 Ga0495588_0003518 Ga0495588_0003518_940_1839 299
232 3300046683 Ga0495658_0001588 Ga0495658_0001588_1066_1965 299
233 3300047315 Ga0495581_0002436 Ga0495581_0002436_4643_5542 299
234 3300047673 Ga0495593_0009884 Ga0495593_0009884_1543_2442 299
235 3300048089 Ga0495614_0118803 Ga0495614_0118803_35_934 299
236 3300049574 Ga0501038_0071737 Ga0501038_0071737_976_1875 299
237 3300049575 Ga0501039_0083161 Ga0501039_0083161_487_1386 299
238 3300049576 Ga0501040_0075101 Ga0501040_0075101_955_1854 299
239 3300049588 Ga0501072_0015010 Ga0501072_0015010_4334_5233 299
240 3300049588 Ga0501072_0307774 Ga0501072_0307774_302_1210 299
241 3300049592 Ga0501076_0052381 Ga0501076_0052381_1764_2663 299
242 3300049741 Ga0501079_0092174 Ga0501079_0092174_1135_2034 299
243 3300049742 Ga0501080_0026168 Ga0501080_0026168_898_1797 299
244 3300049744 Ga0501083_0105761 Ga0501083_0105761_172_1071 299
245 3300049779 Ga0501283_006947 Ga0501283_006947_51_950 299
246 3300049824 Ga0501045_0029216 Ga0501045_0029216_2410_3309 299
247 3300050511 nmdc:mga08y16_154593_c1 nmdc:mga08y16_154593_c1_304_1203 299
248 3300050511 nmdc:mga08y16_185384_c1 nmdc:mga08y16_185384_c1_727_1626 299
249 3300050512 nmdc:mga0n895_99400_c1 nmdc:mga0n895_99400_c1_1034_1933 299
250 3300050515 nmdc:mga0a205_102043_c1 nmdc:mga0a205_102043_c1_875_1774 299
251 3300053085 Ga0495619_0122185 Ga0495619_0122185_495_1394 299
252 3300053129 Ga0500628_012292 Ga0500628_012292_141_1040 299
253 3300054114 Ga0501084_0151551 Ga0501084_0151551_781_1680 299
254 3300059421 Ga0590071_000131 Ga0590071_000131_2234_3133 299
255 3300059424 Ga0590075_003125 Ga0590075_003125_2292_3191 299
256 3300061734 Ga0530510_0128967 Ga0530510_0128967_345_1244 299
257 3300005445 Ga0070708_100186633 Ga0070708_1001866333 300
258 3300006844 Ga0075428_100019947 Ga0075428_1000199472 300
259 3300006852 Ga0075433_10003988 Ga0075433_100039889 300
260 3300006852 Ga0075433_10028738 Ga0075433_100287385 300
261 3300006871 Ga0075434_100006678 Ga0075434_1000066782 300
262 3300006871 Ga0075434_100209897 Ga0075434_1002098972 300
263 3300007076 Ga0075435_100099936 Ga0075435_1000999362 300
264 3300007076 Ga0075435_100187763 Ga0075435_1001877632 300
265 3300009147 Ga0114129_10809807 Ga0114129_108098071 300
266 3300009551 Ga0105238_10012264 Ga0105238_100122643 300
267 3300025913 Ga0207695_10031728 Ga0207695_100317282 300
268 3300035692 Ga0373935_0181949 Ga0373935_0181949_89_994 300
269 3300046522 Ga0495643_0004342 Ga0495643_0004342_4354_5256 300
270 3300049824 Ga0501045_0109455 Ga0501045_0109455_389_1291 300
271 3300050507 nmdc:mga05p37_2559_c1 nmdc:mga05p37_2559_c1_497_1399 300
272 3300050512 nmdc:mga0n895_4328_c1 nmdc:mga0n895_4328_c1_1755_2657 300
273 3300050513 nmdc:mga0rr50_335478_c1 nmdc:mga0rr50_335478_c1_198_1100 300
274 3300050513 nmdc:mga0rr50_92887_c1 nmdc:mga0rr50_92887_c1_1023_1928 300
275 3300050515 nmdc:mga0a205_16563_c1 nmdc:mga0a205_16563_c1_783_1685 300
276 3300050515 nmdc:mga0a205_6559_c1 nmdc:mga0a205_6559_c1_4173_5075 300
277 3300061734 Ga0530510_0087395 Ga0530510_0087395_1261_2163 300
278 3300005331 Ga0070670_100009066 Ga0070670_1000090669 301
279 3300005334 Ga0068869_100110011 Ga0068869_1001100112 301
280 3300005344 Ga0070661_100097596 Ga0070661_1000975962 301
281 3300005364 Ga0070673_100015681 Ga0070673_1000156814 301
282 3300005543 Ga0070672_100032261 Ga0070672_1000322614 301
283 3300005543 Ga0070672_100250360 Ga0070672_1002503601 301
284 3300005564 Ga0070664_100015379 Ga0070664_1000153792 301
285 3300005617 Ga0068859_100327946 Ga0068859_1003279462 301
286 3300005618 Ga0068864_100178609 Ga0068864_1001786092 301
287 3300005718 Ga0068866_10060184 Ga0068866_100601842 301
288 3300005719 Ga0068861_100419060 Ga0068861_1004190602 301
289 3300005843 Ga0068860_100072354 Ga0068860_1000723542 301
290 3300006847 Ga0075431_100347888 Ga0075431_1003478883 301
291 3300006881 Ga0068865_100006363 Ga0068865_1000063632 301
292 3300006931 Ga0097620_100327941 Ga0097620_1003279412 301
293 3300009094 Ga0111539_10224959 Ga0111539_102249591 301
294 3300009094 Ga0111539_10733666 Ga0111539_107336661 301
295 3300009147 Ga0114129_10114092 Ga0114129_101140922 301
296 3300009147 Ga0114129_10317170 Ga0114129_103171702 301
297 3300009177 Ga0105248_10032363 Ga0105248_100323637 301
298 3300009551 Ga0105238_10031381 Ga0105238_100313815 301
299 3300025321 Ga0207656_10009483 Ga0207656_100094833 301
300 3300025899 Ga0207642_10022772 Ga0207642_100227722 301
301 3300025924 Ga0207694_10025139 Ga0207694_100251393 301
302 3300025925 Ga0207650_10062777 Ga0207650_100627772 301
303 3300025931 Ga0207644_10127930 Ga0207644_101279302 301
304 3300025938 Ga0207704_10035881 Ga0207704_100358812 301
305 3300025940 Ga0207691_10061287 Ga0207691_100612872 301
306 3300025940 Ga0207691_10262978 Ga0207691_102629782 301
307 3300025945 Ga0207679_10057987 Ga0207679_100579872 301
308 3300025960 Ga0207651_10010563 Ga0207651_100105632 301
309 3300026095 Ga0207676_10025585 Ga0207676_100255854 301
310 3300026118 Ga0207675_100005409 Ga0207675_1000054094 301
311 3300031731 Ga0307405_10125695 Ga0307405_101256952 301
312 3300032002 Ga0307416_100302296 Ga0307416_1003022962 301
313 3300032005 Ga0307411_10009688 Ga0307411_100096883 301
314 3300035111 Ga0373923_0013237 Ga0373923_0013237_1885_2790 301
315 3300035117 Ga0373953_0055774 Ga0373953_0055774_173_1078 301
316 3300035118 Ga0373954_0155912 Ga0373954_0155912_160_1065 301
317 3300035170 Ga0373943_0063384 Ga0373943_0063384_224_1138 301
318 3300035172 Ga0373955_0050775 Ga0373955_0050775_721_1626 301
319 3300035695 Ga0373927_0001368 Ga0373927_0001368_12696_13607 301
320 3300035724 Ga0373933_0021515 Ga0373933_0021515_1120_2025 301
321 3300036401 Ga0373937_0036694 Ga0373937_0036694_369_1274 301
322 3300045051 Ga0451576_0600138 Ga0451576_0600138_37_942 301
323 3300046535 Ga0495586_0092815 Ga0495586_0092815_582_1487 301
324 3300046683 Ga0495658_0095320 Ga0495658_0095320_317_1222 301
325 3300046689 Ga0495613_0149627 Ga0495613_0149627_393_1298 301
326 3300047319 Ga0495674_0025894 Ga0495674_0025894_2923_3834 301
327 3300048915 Ga0496112_0025398 Ga0496112_0025398_3815_4780 301
328 3300050510 nmdc:mga06r32_351654_c1 nmdc:mga06r32_351654_c1_116_1021 301
329 3300050512 nmdc:mga0n895_51877_c1 nmdc:mga0n895_51877_c1_2081_3046 301
330 3300050515 nmdc:mga0a205_203981_c1 nmdc:mga0a205_203981_c1_815_1780 301
331 3300053085 Ga0495619_0192307 Ga0495619_0192307_160_1065 301
332 3300005354 Ga0070675_100008197 Ga0070675_1000081974 302
333 3300005577 Ga0068857_100081035 Ga0068857_1000810352 302
334 3300005618 Ga0068864_100023199 Ga0068864_1000231994 302
335 3300011119 Ga0105246_10001224 Ga0105246_1000122415 302
336 3300025923 Ga0207681_10033868 Ga0207681_100338682 302
337 3300025926 Ga0207659_10009073 Ga0207659_100090737 302
338 3300025960 Ga0207651_10021089 Ga0207651_100210892 302
339 3300026035 Ga0207703_10039749 Ga0207703_100397493 302
340 3300026116 Ga0207674_10000906 Ga0207674_1000090643 302
341 3300028380 Ga0268265_10162951 Ga0268265_101629512 302
342 3300005457 Ga0070662_100115199 Ga0070662_1001151992 303
343 3300005617 Ga0068859_100000052 Ga0068859_10000005256 303
344 3300006931 Ga0097620_100000052 Ga0097620_10000005256 303
345 3300009177 Ga0105248_10532548 Ga0105248_105325482 303
346 3300025925 Ga0207650_10194459 Ga0207650_101944591 303
347 3300025933 Ga0207706_10294918 Ga0207706_102949182 303
348 3300025941 Ga0207711_10358926 Ga0207711_103589262 303
349 3300026067 Ga0207678_10209386 Ga0207678_102093862 303
350 3300045051 Ga0451576_0157353 Ga0451576_0157353_659_1570 303
351 3300046472 Ga0495580_0273952 Ga0495580_0273952_120_1031 303
352 3300049580 Ga0501046_0093304 Ga0501046_0093304_92_1003 303
353 3300049743 Ga0501081_0296109 Ga0501081_0296109_56_967 303
354 3300050508 nmdc:mga09592_509069_c1 nmdc:mga09592_509069_c1_32_943 303
355 3300054114 Ga0501084_0150117 Ga0501084_0150117_630_1541 303
356 3300005467 Ga0070706_100021548 Ga0070706_1000215482 304
357 3300005471 Ga0070698_100008152 Ga0070698_10000815214 304
358 3300005549 Ga0070704_100115738 Ga0070704_1001157382 304
359 3300009094 Ga0111539_10432917 Ga0111539_104329172 304
360 3300009147 Ga0114129_10000196 Ga0114129_100001969 304
361 3300025910 Ga0207684_10043490 Ga0207684_100434903 304
362 3300045051 Ga0451576_0006928 Ga0451576_0006928_3081_3995 304
363 3300050507 nmdc:mga05p37_176_c1 nmdc:mga05p37_176_c1_59322_60236 304
364 3300050510 nmdc:mga06r32_103645_c1 nmdc:mga06r32_103645_c1_1607_2521 304
365 3300050515 nmdc:mga0a205_32939_c1 nmdc:mga0a205_32939_c1_2079_2993 304
366 3300059423 Ga0590074_001356 Ga0590074_001356_2509_3426 305
367 3300059424 Ga0590075_002796 Ga0590075_002796_3208_4125 305
368 3300059426 Ga0590077_002401 Ga0590077_002401_57_974 305
369 3300005539 Ga0068853_100148833 Ga0068853_1001488331 306
370 3300005471 Ga0070698_100096813 Ga0070698_1000968132 308
371 3300005518 Ga0070699_100219363 Ga0070699_1002193632 308
372 3300005536 Ga0070697_100114368 Ga0070697_1001143682 308
373 3300049575 Ga0501039_0161219 Ga0501039_0161219_171_1097 308
374 3300049576 Ga0501040_0037311 Ga0501040_0037311_1200_2126 308
375 3300049578 Ga0501042_0317175 Ga0501042_0317175_57_983 308
376 3300049580 Ga0501046_0167994 Ga0501046_0167994_246_1172 308
377 3300049742 Ga0501080_0222508 Ga0501080_0222508_783_1709 308
378 3300061734 Ga0530510_0188834 Ga0530510_0188834_388_1314 308
379 3300005334 Ga0068869_100022076 Ga0068869_1000220766 309
380 3300005546 Ga0070696_100046621 Ga0070696_1000466215 309
381 3300005547 Ga0070693_100064243 Ga0070693_1000642432 309
382 3300005719 Ga0068861_100022028 Ga0068861_1000220283 309
383 3300026118 Ga0207675_100082767 Ga0207675_1000827672 309
384 3300028380 Ga0268265_10013823 Ga0268265_100138232 309
385 3300006871 Ga0075434_100144671 Ga0075434_1001446712 311
386 3300009147 Ga0114129_10033511 Ga0114129_100335114 311
387 3300050507 nmdc:mga05p37_24502_c1 nmdc:mga05p37_24502_c1_3129_4064 311
388 3300050512 nmdc:mga0n895_165202_c1 nmdc:mga0n895_165202_c1_1039_1974 311
389 3300050515 nmdc:mga0a205_291617_c1 nmdc:mga0a205_291617_c1_136_1071 311
390 3300050514 nmdc:mga08x19_86657_c1 nmdc:mga08x19_86657_c1_977_1936 312
391 3300049576 Ga0501040_0025476 Ga0501040_0025476_844_1806 315
392 3300005295 Ga0065707_10161577 Ga0065707_101615771 319
393 3300005353 Ga0070669_100154647 Ga0070669_1001546472 319
394 3300005445 Ga0070708_100143987 Ga0070708_1001439872 319
395 3300005536 Ga0070697_100089908 Ga0070697_1000899082 319
396 3300005841 Ga0068863_100127140 Ga0068863_1001271402 319
397 3300005844 Ga0068862_100081360 Ga0068862_1000813602 319
398 3300005983 Ga0081540_1035484 Ga0081540_10354841 319
399 3300006844 Ga0075428_100071976 Ga0075428_1000719765 319
400 3300006847 Ga0075431_100049069 Ga0075431_1000490692 319
401 3300006852 Ga0075433_10002568 Ga0075433_1000256812 319
402 3300006852 Ga0075433_10039060 Ga0075433_100390604 319
403 3300006852 Ga0075433_10157695 Ga0075433_101576952 319
404 3300006871 Ga0075434_100000173 Ga0075434_10000017319 319
405 3300006871 Ga0075434_100011629 Ga0075434_1000116296 319
406 3300006871 Ga0075434_100027494 Ga0075434_1000274946 319
407 3300006871 Ga0075434_100282981 Ga0075434_1002829811 319
408 3300006880 Ga0075429_100004094 Ga0075429_10000409412 319
409 3300006880 Ga0075429_100008520 Ga0075429_1000085206 319
410 3300006880 Ga0075429_100496885 Ga0075429_1004968851 319
411 3300006914 Ga0075436_100072703 Ga0075436_1000727033 319
412 3300007076 Ga0075435_100008724 Ga0075435_1000087242 319
413 3300007076 Ga0075435_100015026 Ga0075435_1000150264 319
414 3300007076 Ga0075435_100119815 Ga0075435_1001198152 319
415 3300007076 Ga0075435_100132398 Ga0075435_1001323983 319
416 3300007265 Ga0099794_10035125 Ga0099794_100351252 319
417 3300009094 Ga0111539_10002676 Ga0111539_1000267613 319
418 3300009147 Ga0114129_10004645 Ga0114129_100046455 319
419 3300009147 Ga0114129_10153114 Ga0114129_101531143 319
420 3300009147 Ga0114129_10183587 Ga0114129_101835873 319
421 3300013297 Ga0157378_10078144 Ga0157378_100781444 319
422 3300025937 Ga0207669_10048075 Ga0207669_100480752 319
423 3300026118 Ga0207675_100371497 Ga0207675_1003714972 319
424 3300027907 Ga0207428_10000013 Ga0207428_10000013177 319
425 3300028380 Ga0268265_10120053 Ga0268265_101200531 319
426 3300035112 Ga0373932_0066900 Ga0373932_0066900_89_1048 319
427 3300035691 Ga0373931_0009904 Ga0373931_0009904_2870_3829 319
428 3300045051 Ga0451576_0239099 Ga0451576_0239099_125_1084 319
429 3300046472 Ga0495580_0004828 Ga0495580_0004828_6088_7047 319
430 3300046664 Ga0495659_0061084 Ga0495659_0061084_299_1258 319
431 3300049592 Ga0501076_0244301 Ga0501076_0244301_212_1171 319
432 3300050507 nmdc:mga05p37_125370_c1 nmdc:mga05p37_125370_c1_781_1740 319
433 3300050507 nmdc:mga05p37_197355_c1 nmdc:mga05p37_197355_c1_507_1466 319
434 3300050507 nmdc:mga05p37_25960_c1 nmdc:mga05p37_25960_c1_5803_6762 319
435 3300050507 nmdc:mga05p37_487785_c1 nmdc:mga05p37_487785_c1_154_1113 319
436 3300050508 nmdc:mga09592_27260_c1 nmdc:mga09592_27260_c1_3117_4076 319
437 3300050508 nmdc:mga09592_820_c1 nmdc:mga09592_820_c1_14649_15608 319
438 3300050509 nmdc:mga0qj67_280065_c1 nmdc:mga0qj67_280065_c1_282_1241 319
439 3300050510 nmdc:mga06r32_120224_c1 nmdc:mga06r32_120224_c1_282_1241 319
440 3300050511 nmdc:mga08y16_6756_c1 nmdc:mga08y16_6756_c1_7917_8876 319
441 3300050512 nmdc:mga0n895_21298_c1 nmdc:mga0n895_21298_c1_1118_2077 319
442 3300050512 nmdc:mga0n895_343_c1 nmdc:mga0n895_343_c1_23032_23991 319
443 3300050512 nmdc:mga0n895_361300_c1 nmdc:mga0n895_361300_c1_460_1419 319
444 3300050513 nmdc:mga0rr50_130503_c1 nmdc:mga0rr50_130503_c1_933_1892 319
445 3300050513 nmdc:mga0rr50_2481_c1 nmdc:mga0rr50_2481_c1_1037_1996 319
446 3300050514 nmdc:mga08x19_28083_c1 nmdc:mga08x19_28083_c1_2320_3279 319
447 3300050514 nmdc:mga08x19_308729_c1 nmdc:mga08x19_308729_c1_130_1089 319
448 3300050515 nmdc:mga0a205_29051_c1 nmdc:mga0a205_29051_c1_3486_4445 319
449 3300050515 nmdc:mga0a205_688_c1 nmdc:mga0a205_688_c1_18754_19713 319
450 3300050515 nmdc:mga0a205_69486_c1 nmdc:mga0a205_69486_c1_1757_2716 319
451 3300050515 nmdc:mga0a205_76086_c1 nmdc:mga0a205_76086_c1_889_1848 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

239

268

0.95

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

133

212

0.95

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

1

109

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.8901 2 267
1k82-assembly4.cif.gz_D crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna 0.8837 2 267
1tdz-assembly1.cif.gz_A crystal structure complex between the lactococcus lactis fpg (mutm) and a fapy-dg containing dna 0.8796 3 267
1kfv-assembly2.cif.gz_B crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna. 0.877 3 267
1tdz-assembly1.cif.gz_A crystal structure complex between the lactococcus lactis fpg (mutm) and a fapy-dg containing dna 0.8702 3 267
ID Description Score Start End Superfamily
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9128 133 267 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8913 133 267 1.10.8.50
af_L0T864_10_149_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8863 133 274 1.10.8.50
1ee8B01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.882 2 122 3.20.190.10
af_L0T864_10_149_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8741 133 274 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A7C4U9B8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9959 1 267 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A2V6X5E8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9905 1 214 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7C4U9B8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9885 1 267 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A2V6X5E8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9859 1 214 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7Y1SVG2-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9791 1 210 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039

Feature Viewer

pLDDT pTM Quality
88.1 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map