F446728

General Info

Members Datasets Scaffolds Average Seq Length
451 279 416 348

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100362874|Ga0070667_1003628742
Length 370
Sequence MWYNTRVTEMIGIEYPIMQGPFGGNFSSVDLVAAVSNAGGLGGFGAYTLSPQEIVELDKKLKTSTNKPYNLNLWVSDHDTVNGTVSDEQFEQVKKLFKPYFDEAGIPLPDKPAPFVPRFENQVQVILDIQPRVFSFVFGVPSKEILEQCRKVGIITAGGATTIDEALALEAAGVDIIIASGCEAGGHRPSFLDSAELSLTGTFVLVQLIKEKVKCPVVAAGGIANGRGVAAALTLGAEGVQIGTAFLATEESGALPEHKKMLLSNPGKYTALSRAFTGRLGRGIANKITSEMPATEKQVLPFPLQGNFMSTLRSAAIDQKKWDLVFFWSGQIAPVLTHKKVATLMQSLVEETNSILHQESNNVMNLNIAN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
4 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
5 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
6 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
7 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
8 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
9 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
10 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
11 2738541278 Niastella sp. CF465 Isolate Unclassified
12 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
13 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
14 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
15 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
16 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
17 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
18 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
19 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
20 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
21 2818991444 Filimonas endophytica 3197 Isolate Unclassified
22 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
23 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
24 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
25 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
26 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
27 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
28 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
29 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
30 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
31 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
32 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
33 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
34 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
35 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
38 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
39 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
40 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
41 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
42 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
59 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
129 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
192 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
195 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
247 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
248 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
251 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
252 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
253 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
260 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
261 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
266 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
267 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
268 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
269 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
270 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
279 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.8
Metatranscriptomes 0.44
Isolates 7.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.96
Nodule 0
Rhizoplane 2.22
Rhizosphere 68.07
Stem 0
Stem Tuber 0
Unclassified 13.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3895340 2162886007 Bacteria 17367
2 JGI24741J21665_1012486 3300001915 Bacteria 1458
3 JGI24740J21852_10000378 3300001979 Bacteria 19079
4 JGI24739J22299_10000101 3300001989 Bacteria 25628
5 JGI24739J22299_10014595 3300001989 Bacteria 2856
6 JGI24737J22298_10000292 3300001990 Bacteria 16623
7 JGI24735J21928_10000020 3300002067 Bacteria 108706
8 JGI25162J39368_1000005 3300002737 Bacteria 435925
9 JGI25154J39366_1000021 3300002738 Bacteria 221559
10 JGI25164J39214_1001232 3300002772 Bacteria 6835
11 JGI25150J39212_1000019 3300002774 Bacteria 135244
12 JGI25151J46595_10000074 3300003187 Bacteria 135244
13 JGI25165J46597_1000922 3300003214 Bacteria 20351
14 JGI25153J46596_10000056 3300003215 Bacteria 135244
15 JGI25153J46596_10000412 3300003215 Bacteria 28300
16 rootH1_10018639 3300003316 Bacteria 7418
17 rootH2_10061212 3300003320 Unclassified 1645
18 rootH2_10064075 3300003320 Bacteria 4575
19 rootH2_10180862 3300003320 Bacteria 2836
20 rootL2_10002261 3300003322 Bacteria 14026
21 rootL2_10102431 3300003322 Bacteria 9028
22 rootL2_10212707 3300003322 Bacteria 5930
23 rootL2_10279198 3300003322 Bacteria 2026
24 rootL2_10290559 3300003322 Bacteria 2324
25 rootL2_10327244 3300003322 Bacteria 3119
26 rootH1_10008230 3300003323 Bacteria 8124
27 rootH1_10009456 3300003323 Bacteria 35353
28 rootH1_10012489 3300003323 Bacteria 43167
29 rootH1_10015682 3300003323 Bacteria 9007
30 JGI25160J50197_1012838 3300003354 Unclassified 2885
31 JGI25160J50197_1016575 3300003354 Unclassified 2370
32 Ga0055526_1009278 3300003771 Unclassified 4766
33 Ga0055536_1000010 3300003781 Bacteria 304614
34 Ga0055530_10000816 3300003791 Bacteria 25857
35 Ga0055531_10000225 3300003794 Bacteria 62492
36 Ga0055543_1014502 3300004625 Bacteria 1535
37 Ga0065165_1000127 3300005262 Bacteria 129837
38 Ga0065165_1026558 3300005262 Bacteria 1903
39 Ga0065714_10002550 3300005288 Bacteria 28774
40 Ga0065704_10000227 3300005289 Bacteria 66518
41 Ga0065704_10000319 3300005289 Bacteria 45335
42 Ga0065704_10078708 3300005289 Bacteria 4354
43 Ga0070676_10000901 3300005328 Bacteria 14713
44 Ga0070683_100087114 3300005329 Bacteria 2928
45 Ga0068869_100296686 3300005334 Bacteria 1304
46 Ga0070682_100000201 3300005337 Bacteria 44117
47 Ga0070682_100031716 3300005337 Bacteria 3197
48 Ga0070682_100169889 3300005337 Bacteria 1514
49 Ga0068868_100010751 3300005338 Bacteria 6635
50 Ga0068868_100036844 3300005338 Bacteria 3789
51 Ga0070669_100069558 3300005353 Bacteria 2600
52 Ga0070671_100002405 3300005355 Bacteria 14467
53 Ga0070671_100018094 3300005355 Bacteria 5720
54 Ga0070671_100326314 3300005355 Bacteria 1308
55 Ga0070674_100017936 3300005356 Bacteria 4463
56 Ga0070674_100031413 3300005356 Bacteria 3519
57 Ga0070673_100019297 3300005364 Bacteria 4893
58 Ga0070667_100263761 3300005367 Unclassified 1543
59 Ga0070667_100362874 3300005367 Bacteria 1313
60 Ga0070710_10098286 3300005437 Bacteria 1739
61 Ga0070694_100164468 3300005444 Bacteria 1631
62 Ga0070678_100060776 3300005456 Bacteria 2783
63 Ga0070662_100000449 3300005457 Bacteria 24260
64 Ga0070662_100223916 3300005457 Bacteria 1502
65 Ga0070681_10105029 3300005458 Bacteria 2767
66 Ga0068867_100014731 3300005459 Bacteria 5541
67 Ga0068867_100068529 3300005459 Bacteria 2648
68 Ga0068853_100053996 3300005539 Unclassified 3462
69 Ga0070672_100070607 3300005543 Bacteria 2775
70 Ga0070665_100000125 3300005548 Bacteria 146809
71 Ga0070665_100010549 3300005548 Bacteria 9351
72 Ga0070665_100085608 3300005548 Bacteria 3157
73 Ga0070704_100210039 3300005549 Bacteria 1577
74 Ga0068855_100002223 3300005563 Bacteria 24009
75 Ga0068855_100011059 3300005563 Bacteria 10888
76 Ga0068855_100046847 3300005563 Bacteria 5110
77 Ga0068855_100059214 3300005563 Bacteria 4482
78 Ga0068855_100090376 3300005563 Bacteria 3534
79 Ga0070664_100053760 3300005564 Bacteria 3415
80 Ga0070664_100176674 3300005564 Bacteria 1896
81 Ga0068856_100019518 3300005614 Bacteria 6580
82 Ga0068856_100043373 3300005614 Bacteria 4426
83 Ga0068856_100319387 3300005614 Bacteria 1570
84 Ga0068852_100000437 3300005616 Bacteria 27641
85 Ga0068852_100017647 3300005616 Bacteria 5605
86 Ga0068859_100000060 3300005617 Bacteria 113756
87 Ga0068864_100004208 3300005618 Bacteria 11839
88 Ga0068864_100085267 3300005618 Bacteria 2777
89 Ga0068870_10015225 3300005840 Bacteria 3645
90 Ga0068863_100007997 3300005841 Bacteria 10336
91 Ga0068863_100035349 3300005841 Unclassified 4759
92 Ga0068860_100016827 3300005843 Bacteria 7129
93 Ga0068860_100021357 3300005843 Bacteria 6268
94 Ga0075366_10003002 3300006195 Bacteria 8799
95 Ga0097621_100000212 3300006237 Bacteria 38270
96 Ga0068871_100007233 3300006358 Bacteria 7919
97 Ga0068871_100007236 3300006358 Bacteria 7918
98 Ga0075434_100305204 3300006871 Bacteria 1612
99 Ga0068865_100000112 3300006881 Bacteria 41532
100 Ga0097620_100000060 3300006931 Bacteria 113756
101 Ga0105244_10000007 3300009036 Bacteria 352275
102 Ga0105244_10000050 3300009036 Bacteria 138868
103 Ga0105240_10001161 3300009093 Bacteria 46154
104 Ga0105240_10010344 3300009093 Bacteria 13123
105 Ga0105240_10015281 3300009093 Bacteria 10447
106 Ga0105240_10131596 3300009093 Bacteria 3000
107 Ga0105240_10539673 3300009093 Unclassified 1292
108 Ga0111539_10106769 3300009094 Bacteria 3285
109 Ga0111539_10132686 3300009094 Bacteria 2917
110 Ga0105247_10006269 3300009101 Bacteria 7376
111 Ga0114129_10329537 3300009147 Bacteria 2027
112 Ga0105241_10000217 3300009174 Bacteria 43160
113 Ga0105241_10003854 3300009174 Bacteria 11115
114 Ga0105241_10013756 3300009174 Bacteria 5928
115 Ga0105241_10020888 3300009174 Bacteria 4841
116 Ga0105241_10038160 3300009174 Bacteria 3622
117 Ga0105248_10009738 3300009177 Bacteria 10586
118 Ga0105237_10000926 3300009545 Bacteria 39497
119 Ga0105237_10002186 3300009545 Bacteria 24493
120 Ga0105237_10035039 3300009545 Bacteria 5079
121 Ga0105237_10052939 3300009545 Bacteria 4072
122 Ga0105238_10020289 3300009551 Bacteria 6766
123 Ga0105238_10083143 3300009551 Bacteria 3191
124 Ga0105249_10004078 3300009553 Bacteria 12605
125 Ga0105239_10000032 3300010375 Bacteria 225528
126 Ga0105239_10000430 3300010375 Bacteria 61162
127 Ga0105239_10003456 3300010375 Bacteria 19331
128 Ga0105239_10085913 3300010375 Bacteria 3468
129 Ga0105239_10482695 3300010375 Bacteria 1408
130 Ga0105246_10036735 3300011119 Bacteria 3284
131 Ga0105246_10042633 3300011119 Bacteria 3074
132 Ga0157373_10000105 3300013100 Bacteria 65415
133 Ga0157373_10085779 3300013100 Bacteria 2219
134 Ga0157371_10002711 3300013102 Bacteria 16716
135 Ga0157371_10004489 3300013102 Bacteria 12171
136 Ga0157371_10057409 3300013102 Bacteria 2761
137 Ga0157371_10059477 3300013102 Bacteria 2709
138 Ga0157371_10223682 3300013102 Bacteria 1352
139 Ga0157370_10006497 3300013104 Bacteria 12879
140 Ga0157370_10006924 3300013104 Bacteria 12395
141 Ga0157370_10022918 3300013104 Bacteria 6207
142 Ga0157370_10038218 3300013104 Bacteria 4644
143 Ga0157370_10171359 3300013104 Bacteria 2017
144 Ga0157369_10050461 3300013105 Bacteria 4506
145 Ga0157369_10107324 3300013105 Bacteria 2970
146 Ga0157369_10199788 3300013105 Bacteria 2099
147 Ga0157374_10000887 3300013296 Bacteria 26128
148 Ga0157374_10003360 3300013296 Bacteria 13437
149 Ga0157374_10009697 3300013296 Bacteria 8267
150 Ga0157374_10045472 3300013296 Bacteria 4064
151 Ga0157374_10056925 3300013296 Bacteria 3651
152 Ga0157374_10150756 3300013296 Bacteria 2260
153 Ga0157374_10160441 3300013296 Bacteria 2190
154 Ga0157378_10146852 3300013297 Bacteria 2194
155 Ga0163162_10000005 3300013306 Bacteria 447195
156 Ga0163162_10001980 3300013306 Bacteria 19236
157 Ga0163162_10002463 3300013306 Bacteria 17470
158 Ga0163162_10007312 3300013306 Bacteria 10732
159 Ga0163162_10332028 3300013306 Bacteria 1653
160 Ga0157372_10010830 3300013307 Bacteria 9709
161 Ga0157372_10019538 3300013307 Bacteria 7303
162 Ga0157372_10031687 3300013307 Bacteria 5789
163 Ga0157372_10038047 3300013307 Bacteria 5309
164 Ga0157372_10358907 3300013307 Bacteria 1698
165 Ga0157375_10000128 3300013308 Bacteria 75062
166 Ga0157375_10017370 3300013308 Bacteria 6490
167 Ga0157375_10036720 3300013308 Bacteria 4689
168 Ga0163163_10002524 3300014325 Bacteria 15490
169 Ga0163163_10016161 3300014325 Bacteria 6927
170 Ga0163163_10065516 3300014325 Bacteria 3606
171 Ga0157380_10005293 3300014326 Bacteria 9017
172 Ga0182008_10000012 3300014497 Bacteria 297475
173 Ga0182008_10000526 3300014497 Bacteria 28702
174 Ga0157377_10016475 3300014745 Bacteria 3802
175 Ga0157377_10155757 3300014745 Bacteria 1416
176 Ga0157379_10027982 3300014968 Bacteria 5017
177 Ga0157376_10004264 3300014969 Bacteria 9926
178 Ga0157376_10053012 3300014969 Bacteria 3375
179 Ga0182006_1000109 3300015261 Bacteria 89541
180 Ga0163161_10000098 3300017792 Bacteria 84811
181 Ga0163161_10002143 3300017792 Bacteria 14236
182 Ga0206351_10887789 3300020077 Bacteria 1649
183 Ga0209436_100353 3300025208 Bacteria 20730
184 Ga0207427_100243 3300025231 Bacteria 43831
185 Ga0209437_100034 3300025233 Bacteria 494007
186 Ga0209437_100043 3300025233 Bacteria 440454
187 Ga0207425_1000007 3300025245 Bacteria 777411
188 Ga0209646_1000050 3300025246 Bacteria 296599
189 Ga0209646_1002199 3300025246 Bacteria 4503
190 Ga0209026_1000240 3300025250 Bacteria 71671
191 Ga0209129_1000006 3300025258 Bacteria 777761
192 Ga0209129_1011530 3300025258 Bacteria 2103
193 Ga0209233_1000038 3300025261 Bacteria 548972
194 Ga0209673_1018853 3300025273 Bacteria 2495
195 Ga0209130_1001245 3300025284 Bacteria 17842
196 Ga0209675_1000088 3300025291 Bacteria 147320
197 Ga0209676_1000009 3300025292 Bacteria 981719
198 Ga0209025_1000025 3300025294 Bacteria 524454
199 Ga0209025_1004607 3300025294 Bacteria 11804
200 Ga0209564_1002532 3300025295 Bacteria 14101
201 Ga0209758_1000016 3300025297 Bacteria 778557
202 Ga0209758_1001281 3300025297 Bacteria 31000
203 Ga0209758_1002502 3300025297 Bacteria 18663
204 Ga0209758_1004388 3300025297 Bacteria 11777
205 Ga0209050_1000103 3300025298 Bacteria 229225
206 Ga0209050_1000892 3300025298 Bacteria 39709
207 Ga0207426_1000293 3300025302 Bacteria 98805
208 Ga0207426_1000329 3300025302 Bacteria 90476
209 Ga0207426_1000814 3300025302 Bacteria 33494
210 Ga0207426_1003611 3300025302 Bacteria 8206
211 Ga0209257_1000006 3300025304 Bacteria 1570111
212 Ga0209257_1000008 3300025304 Bacteria 1294570
213 Ga0207655_1000066 3300025728 Bacteria 246358
214 Ga0207655_1000489 3300025728 Bacteria 51011
215 Ga0207682_10011125 3300025893 Bacteria 3521
216 Ga0207710_10006203 3300025900 Bacteria 5115
217 Ga0207680_10000018 3300025903 Bacteria 94318
218 Ga0207647_10000117 3300025904 Bacteria 61849
219 Ga0207647_10055401 3300025904 Bacteria 2437
220 Ga0207645_10000167 3300025907 Bacteria 52468
221 Ga0207654_10002034 3300025911 Bacteria 10375
222 Ga0207654_10003949 3300025911 Bacteria 7466
223 Ga0207654_10018059 3300025911 Bacteria 3698
224 Ga0207654_10203482 3300025911 Bacteria 1305
225 Ga0207707_10075845 3300025912 Bacteria 2934
226 Ga0207695_10000636 3300025913 Bacteria 70234
227 Ga0207695_10015460 3300025913 Bacteria 8984
228 Ga0207695_10016628 3300025913 Bacteria 8600
229 Ga0207695_10027138 3300025913 Bacteria 6379
230 Ga0207695_10200240 3300025913 Unclassified 1911
231 Ga0207671_10001573 3300025914 Bacteria 26010
232 Ga0207671_10006721 3300025914 Bacteria 10185
233 Ga0207671_10010844 3300025914 Bacteria 7476
234 Ga0207671_10016784 3300025914 Bacteria 5676
235 Ga0207671_10055986 3300025914 Unclassified 2922
236 Ga0207662_10026625 3300025918 Bacteria 3336
237 Ga0207646_10163416 3300025922 Bacteria 2010
238 Ga0207694_10069689 3300025924 Bacteria 2747
239 Ga0207694_10141300 3300025924 Bacteria 1936
240 Ga0207644_10174804 3300025931 Bacteria 1679
241 Ga0207644_10295437 3300025931 Bacteria 1304
242 Ga0207706_10000044 3300025933 Bacteria 123576
243 Ga0207669_10011035 3300025937 Bacteria 4377
244 Ga0207704_10000062 3300025938 Bacteria 76334
245 Ga0207691_10066245 3300025940 Bacteria 3268
246 Ga0207689_10005537 3300025942 Bacteria 11277
247 Ga0207689_10329236 3300025942 Bacteria 1268
248 Ga0207661_10078090 3300025944 Bacteria 2724
249 Ga0207679_10286227 3300025945 Bacteria 1415
250 Ga0207667_10005479 3300025949 Bacteria 15471
251 Ga0207667_10013556 3300025949 Bacteria 9319
252 Ga0207667_10057281 3300025949 Bacteria 4091
253 Ga0207667_10153405 3300025949 Bacteria 2370
254 Ga0207677_10007569 3300026023 Bacteria 6024
255 Ga0207677_10114203 3300026023 Bacteria 2017
256 Ga0207703_10008799 3300026035 Bacteria 7959
257 Ga0207639_10031689 3300026041 Unclassified 3887
258 Ga0207639_10112844 3300026041 Bacteria 2219
259 Ga0207639_10207583 3300026041 Bacteria 1684
260 Ga0207708_10235908 3300026075 Bacteria 1470
261 Ga0207702_10055529 3300026078 Bacteria 3359
262 Ga0207702_10078968 3300026078 Bacteria 2850
263 Ga0207641_10000308 3300026088 Bacteria 60892
264 Ga0207648_10002072 3300026089 Bacteria 21869
265 Ga0207676_10020747 3300026095 Bacteria 4811
266 Ga0207674_10061408 3300026116 Bacteria 3797
267 Ga0207683_10017087 3300026121 Bacteria 6175
268 Ga0207683_10211641 3300026121 Unclassified 1765
269 Ga0207698_10006511 3300026142 Bacteria 7294
270 Ga0207698_10185927 3300026142 Bacteria 1845
271 Ga0268266_10000132 3300028379 Bacteria 145563
272 Ga0268265_10140305 3300028380 Unclassified 2023
273 Ga0268264_10010010 3300028381 Bacteria 7850
274 Ga0307517_10001156 3300028786 Bacteria 44560
275 Ga0307517_10002382 3300028786 Bacteria 30251
276 Ga0307515_10000021 3300028794 Bacteria 406008
277 Ga0307515_10001368 3300028794 Bacteria 55146
278 Ga0307515_10057090 3300028794 Bacteria 5657
279 Ga0316176_1002742 3300030732 Bacteria 81202
280 Ga0265760_10021557 3300031090 Bacteria 1865
281 Ga0265327_10000614 3300031251 Bacteria 58841
282 Ga0265327_10008663 3300031251 Bacteria 7530
283 Ga0307509_10175102 3300031507 Unclassified 2019
284 Ga0307412_10000181 3300031911 Bacteria 44202
285 Ga0307412_10002601 3300031911 Bacteria 10028
286 Ga0307412_10033153 3300031911 Bacteria 3280
287 Ga0307414_10003855 3300032004 Bacteria 8067
288 Ga0307414_10035583 3300032004 Bacteria 3315
289 Ga0307414_10433863 3300032004 Bacteria 1148
290 Ga0307411_10000001 3300032005 Bacteria 931810
291 Ga0307507_10006210 3300033179 Bacteria 18600
292 Ga0307510_10008532 3300033180 Bacteria 12219
293 Ga0436365_1855810 3300039437 Bacteria 52011
294 Ga0439436_0010287 3300041404 Bacteria 2857
295 Ga0439447_001000 3300041407 Bacteria 10331
296 Ga0439465_0012886 3300041413 Bacteria 2613
297 Ga0439445_0000466 3300042004 Bacteria 8204
298 Ga0439457_005335 3300042014 Bacteria 3248
299 Ga0466969_0000086 3300044656 Bacteria 48155
300 Ga0466972_0000024 3300044658 Bacteria 187985
301 Ga0466972_0000047 3300044658 Bacteria 122901
302 Ga0466972_0014265 3300044658 Bacteria 3982
303 Ga0466972_0071768 3300044658 Bacteria 1651
304 Ga0466972_0165610 3300044658 Bacteria 1038
305 Ga0466966_0000366 3300044684 Bacteria 29439
306 Ga0466968_0022057 3300044735 Unclassified 2585
307 Ga0466970_0003592 3300044765 Bacteria 7562
308 Ga0466959_0000053 3300045049 Bacteria 81055
309 Ga0495627_000002 3300046453 Bacteria 903861
310 Ga0495638_0109105 3300046460 Bacteria 1646
311 Ga0495651_0061544 3300046462 Bacteria 2873
312 Ga0495650_0000349 3300046471 Bacteria 81735
313 Ga0495585_0000194 3300046492 Bacteria 62923
314 Ga0495585_0000390 3300046492 Bacteria 42425
315 Ga0495596_0002535 3300046500 Bacteria 9767
316 Ga0495583_0054279 3300046506 Bacteria 1815
317 Ga0495606_0000009 3300046507 Bacteria 306313
318 Ga0495606_0065017 3300046507 Bacteria 2319
319 Ga0495610_0005395 3300046512 Bacteria 9111
320 Ga0495616_0000760 3300046513 Bacteria 23568
321 Ga0495632_0001272 3300046519 Bacteria 21347
322 Ga0495648_0007260 3300046524 Bacteria 8894
323 Ga0495648_0015185 3300046524 Bacteria 5607
324 Ga0495663_0008660 3300046525 Bacteria 2822
325 Ga0495652_0189110 3300046529 Bacteria 1573
326 Ga0495654_0000001 3300046530 Bacteria 1513197
327 Ga0495609_0002310 3300046538 Bacteria 11796
328 Ga0495609_0010405 3300046538 Bacteria 4461
329 Ga0495622_0020325 3300046557 Bacteria 3092
330 Ga0495633_0000635 3300046558 Bacteria 32762
331 Ga0495656_0083250 3300046615 Bacteria 1448
332 Ga0495668_0000011 3300046616 Bacteria 472186
333 Ga0495668_0002055 3300046616 Bacteria 17479
334 Ga0495668_0082217 3300046616 Unclassified 1767
335 Ga0495625_0000007 3300046660 Bacteria 565749
336 Ga0495625_0000449 3300046660 Bacteria 61892
337 Ga0495625_0002698 3300046660 Bacteria 18870
338 Ga0495625_0098607 3300046660 Bacteria 2010
339 Ga0495625_0125635 3300046660 Bacteria 1742
340 Ga0495661_0002322 3300046665 Bacteria 14673
341 Ga0495661_0059605 3300046665 Bacteria 2271
342 Ga0495658_0022819 3300046683 Bacteria 3314
343 Ga0495649_0000007 3300046694 Bacteria 518037
344 Ga0495683_0047361 3300047323 Bacteria 2158
345 Ga0495687_003188 3300047443 Bacteria 12180
346 Ga0495687_065410 3300047443 Bacteria 1480
347 Ga0495673_0022823 3300047469 Bacteria 3059
348 Ga0495686_0000095 3300047472 Bacteria 184643
349 Ga0495686_0003272 3300047472 Bacteria 14174
350 Ga0495686_0013274 3300047472 Bacteria 5720
351 Ga0495686_0099035 3300047472 Bacteria 1760
352 Ga0495686_0188266 3300047472 Bacteria 1191
353 Ga0496101_0114470 3300048904 Bacteria 2034
354 Ga0496101_0268811 3300048904 Bacteria 1331
355 Ga0496102_0167178 3300048905 Bacteria 2070
356 Ga0496104_0189748 3300048907 Unclassified 1966
357 Ga0496105_0049889 3300048908 Bacteria 3457
358 Ga0496109_0363329 3300048912 Bacteria 1368
359 Ga0496112_0052797 3300048915 Bacteria 3990
360 Ga0496113_0033727 3300048916 Bacteria 3730
361 Ga0496115_0122858 3300048918 Bacteria 2137
362 Ga0496116_0000022 3300048919 Bacteria 482506
363 Ga0496116_0000030 3300048919 Bacteria 420761
364 Ga0496117_0000074 3300048920 Bacteria 232732
365 Ga0496117_0046316 3300048920 Bacteria 3129
366 Ga0496118_0002167 3300048921 Bacteria 27343
367 Ga0496118_0176668 3300048921 Bacteria 1296
368 Ga0496119_0000017 3300048922 Bacteria 309779
369 Ga0496122_0000354 3300048925 Bacteria 98798
370 Ga0496122_0069386 3300048925 Bacteria 2524
371 Ga0496124_0001335 3300048927 Bacteria 37051
372 Ga0496125_0000156 3300048928 Bacteria 151400
373 Ga0496125_0011589 3300048928 Bacteria 8808
374 Ga0496125_0016744 3300048928 Bacteria 7030
375 Ga0496125_0208824 3300048928 Bacteria 1270
376 Ga0496126_0002108 3300048929 Bacteria 27861
377 Ga0496126_0002759 3300048929 Bacteria 23173
378 Ga0496126_0041898 3300048929 Bacteria 4233
379 Ga0501217_003818 3300049661 Bacteria 3062
380 Ga0501249_002848 3300049679 Bacteria 3483
381 Ga0501219_000073 3300049703 Bacteria 17142
382 Ga0501225_0003492 3300049705 Bacteria 4749
383 Ga0501241_000015 3300049758 Bacteria 100297
384 Ga0501266_000005 3300049763 Bacteria 346750
385 Ga0501269_000518 3300049766 Bacteria 7767
386 Ga0501284_00004 3300050005 Bacteria 211793
387 nmdc:mga03n38_109716_c1 3300050490 Bacteria 1342
388 nmdc:mga03n38_38877_c1 3300050490 Bacteria 2060
389 nmdc:mga0k408_593_c1 3300050493 Bacteria 8798
390 nmdc:mga07m45_67768_c1 3300050496 Bacteria 2028
391 nmdc:mga05p37_74222_c1 3300050507 Bacteria 4186
392 nmdc:mga0n895_375757_c1 3300050512 Bacteria 1438
393 Ga0500578_0000469 3300053086 Bacteria 49263
394 Ga0500644_0000081 3300053088 Bacteria 58662
395 Ga0500644_0006080 3300053088 Bacteria 3078
396 Ga0500646_0002450 3300053090 Bacteria 4822
397 Ga0500583_0000430 3300053092 Bacteria 13289
398 Ga0500583_0002383 3300053092 Bacteria 5635
399 Ga0500651_0001281 3300053093 Bacteria 12520
400 Ga0500641_0000040 3300053096 Bacteria 68174
401 Ga0500641_0063527 3300053096 Bacteria 1541
402 Ga0500569_000526 3300053109 Bacteria 6379
403 Ga0500572_019466 3300053111 Bacteria 1773
404 Ga0500608_045966 3300053122 Bacteria 2097
405 Ga0500614_003967 3300053123 Bacteria 3158
406 Ga0500618_000010 3300053125 Bacteria 203909
407 Ga0500642_0013139 3300053130 Bacteria 3032
408 Ga0500655_006127 3300053133 Bacteria 2167
409 Ga0500658_0000024 3300053134 Bacteria 117952
410 Ga0500559_0019805 3300053136 Bacteria 2843
411 Ga0500568_0026112 3300053139 Unclassified 2454
412 Ga0500588_0000977 3300053146 Bacteria 5113
413 Ga0500616_0000004 3300053153 Bacteria 1002714
414 Ga0500616_0007935 3300053153 Bacteria 6668
415 Ga0500616_0073592 3300053153 Bacteria 1734
416 Ga0500622_0004151 3300053156 Bacteria 9271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026075 Ga0207708_10235908 Ga0207708_102359081 295
2 3300044735 Ga0466968_0022057 Ga0466968_0022057_1584_2567 306
3 3300044658 Ga0466972_0165610 Ga0466972_0165610_66_1001 309
4 3300053096 Ga0500641_0063527 Ga0500641_0063527_441_1451 309
5 3300053130 Ga0500642_0013139 Ga0500642_0013139_1016_2026 309
6 3300014969 Ga0157376_10053012 Ga0157376_100530125 310
7 3300025304 Ga0209257_1000006 Ga0209257_10000061063 310
8 3300046507 Ga0495606_0065017 Ga0495606_0065017_1338_2300 310
9 3300044658 Ga0466972_0071768 Ga0466972_0071768_605_1549 311
10 3300047472 Ga0495686_0188266 Ga0495686_0188266_126_1127 311
11 3300053122 Ga0500608_045966 Ga0500608_045966_1104_2045 311
12 3300003316 rootH1_10018639 rootH1_100186395 312
13 3300003794 Ga0055531_10000225 Ga0055531_1000022543 312
14 3300025304 Ga0209257_1000008 Ga0209257_1000008555 312
15 3300048904 Ga0496101_0268811 Ga0496101_0268811_213_1295 314
16 3300048929 Ga0496126_0041898 Ga0496126_0041898_1277_2359 314
17 3300046524 Ga0495648_0015185 Ga0495648_0015185_1409_2491 316
18 3300053092 Ga0500583_0002383 Ga0500583_0002383_1966_3048 316
19 3300053156 Ga0500622_0004151 Ga0500622_0004151_364_1446 316
20 3300009545 Ga0105237_10035039 Ga0105237_100350392 321
21 3300044658 Ga0466972_0000024 Ga0466972_0000024_48147_49172 321
22 3300044765 Ga0466970_0003592 Ga0466970_0003592_4565_5590 321
23 3300003354 JGI25160J50197_1016575 JGI25160J50197_10165752 322
24 3300044658 Ga0466972_0014265 Ga0466972_0014265_2655_3731 322
25 3300053136 Ga0500559_0019805 Ga0500559_0019805_1335_2405 323
26 3300001989 JGI24739J22299_10000101 JGI24739J22299_1000010121 324
27 3300003771 Ga0055526_1009278 Ga0055526_10092782 324
28 3300004625 Ga0055543_1014502 Ga0055543_10145021 324
29 3300005262 Ga0065165_1000127 Ga0065165_100012752 324
30 3300025273 Ga0209673_1018853 Ga0209673_10188532 324
31 3300025295 Ga0209564_1002532 Ga0209564_100253213 324
32 3300025297 Ga0209758_1002502 Ga0209758_10025025 324
33 3300025297 Ga0209758_1004388 Ga0209758_10043887 324
34 3300025302 Ga0207426_1000329 Ga0207426_100032946 324
35 3300025302 Ga0207426_1003611 Ga0207426_10036114 324
36 3300053109 Ga0500569_000526 Ga0500569_000526_3688_4776 324
37 3300053153 Ga0500616_0073592 Ga0500616_0073592_227_1315 324
38 3300009093 Ga0105240_10001161 Ga0105240_1000116139 325
39 3300009174 Ga0105241_10020888 Ga0105241_100208886 325
40 3300009551 Ga0105238_10020289 Ga0105238_100202896 325
41 3300013307 Ga0157372_10358907 Ga0157372_103589072 325
42 3300025913 Ga0207695_10000636 Ga0207695_1000063655 325
43 3300025914 Ga0207671_10055986 Ga0207671_100559863 325
44 3300025924 Ga0207694_10141300 Ga0207694_101413002 325
45 3300046492 Ga0495585_0000390 Ga0495585_0000390_27953_29038 325
46 3300046524 Ga0495648_0007260 Ga0495648_0007260_192_1277 325
47 3300046557 Ga0495622_0020325 Ga0495622_0020325_1961_3046 325
48 3300046616 Ga0495668_0000011 Ga0495668_0000011_85721_86806 325
49 3300046660 Ga0495625_0002698 Ga0495625_0002698_1656_2741 325
50 3300046683 Ga0495658_0022819 Ga0495658_0022819_1026_2111 325
51 3300053086 Ga0500578_0000469 Ga0500578_0000469_33032_34120 325
52 3300053123 Ga0500614_003967 Ga0500614_003967_1202_2287 325
53 3300031251 Ga0265327_10008663 Ga0265327_100086638 326
54 3300009177 Ga0105248_10009738 Ga0105248_100097387 328
55 3300013296 Ga0157374_10009697 Ga0157374_100096972 328
56 3300014325 Ga0163163_10002524 Ga0163163_100025243 328
57 3300046512 Ga0495610_0005395 Ga0495610_0005395_4175_5251 328
58 3300046616 Ga0495668_0002055 Ga0495668_0002055_1053_2138 328
59 3300046665 Ga0495661_0059605 Ga0495661_0059605_966_2042 328
60 3300048912 Ga0496109_0363329 Ga0496109_0363329_29_1126 328
61 3300005337 Ga0070682_100031716 Ga0070682_1000317165 330
62 3300013102 Ga0157371_10004489 Ga0157371_1000448911 330
63 3300013104 Ga0157370_10006924 Ga0157370_1000692411 330
64 3300048919 Ga0496116_0000030 Ga0496116_0000030_58260_59345 330
65 3300048920 Ga0496117_0046316 Ga0496117_0046316_1876_2961 330
66 3300048921 Ga0496118_0176668 Ga0496118_0176668_120_1205 330
67 3300048929 Ga0496126_0002759 Ga0496126_0002759_18955_20040 330
68 3300003322 rootL2_10279198 rootL2_102791981 332
69 iso_pu_bacteria 2818991444 2819587346 332
70 iso_pu_bacteria 2896109856 2896112172 332
71 iso_pu_bacteria 2582581278 2585145336 333
72 iso_pu_bacteria 2585428095 2587868023 333
73 iso_pu_bacteria 2585428115 2587943289 333
74 iso_pu_bacteria 2585428183 2588213822 333
75 iso_pu_bacteria 2585428184 2588218560 333
76 iso_pu_bacteria 2585428185 2588225758 333
77 iso_pu_bacteria 2738541278 2738731140 333
78 iso_pu_bacteria 2765235839 2765573236 333
79 iso_pu_bacteria 2775506739 2775672564 333
80 iso_pu_bacteria 2818991460 2819677950 333
81 iso_pu_bacteria 2889290771 2889291088 333
82 iso_pu_bacteria 2919097161 2919100618 333
83 iso_pu_bacteria 2585428187 2588233785 334
84 iso_pu_bacteria 2599185184 2599481265 334
85 iso_pu_bacteria 2738541279 2738734483 334
86 iso_pu_bacteria 2738541285 2738767242 334
87 iso_pu_bacteria 2738543007 2739216065 334
88 iso_pu_bacteria 2739367874 2740057741 334
89 iso_pu_bacteria 2928078545 2928081862 334
90 iso_pu_bacteria 2928147474 2928151885 334
91 iso_pu_bacteria 2932082852 2932087193 334
92 iso_pu_bacteria 2945924605 2945927893 334
93 3300025294 Ga0209025_1004607 Ga0209025_10046073 335
94 3300026121 Ga0207683_10211641 Ga0207683_102116412 335
95 3300053088 Ga0500644_0000081 Ga0500644_0000081_45674_46750 335
96 iso_pu_bacteria 2739367857 2740000990 335
97 iso_pu_bacteria 2739367858 2740005806 335
98 iso_pu_bacteria 2857618242 2857618252 335
99 iso_pu_bacteria 2919191525 2919195566 335
100 iso_pu_bacteria 2919437846 2919439111 335
101 iso_pu_bacteria 2929150217 2929153849 335
102 iso_pu_bacteria 2929921140 2929922526 335
103 iso_pu_bacteria 8003151029 8003156374 335
104 iso_pu_bacteria 8056440228 8056441011 335
105 3300003320 rootH2_10064075 rootH2_100640756 336
106 3300003322 rootL2_10002261 rootL2_1000226113 336
107 3300003322 rootL2_10102431 rootL2_101024312 336
108 3300005843 Ga0068860_100021357 Ga0068860_1000213573 336
109 3300013306 Ga0163162_10007312 Ga0163162_100073123 336
110 3300028381 Ga0268264_10010010 Ga0268264_100100104 336
111 3300050490 nmdc:mga03n38_38877_c1 nmdc:mga03n38_38877_c1_766_1842 336
112 3300001915 JGI24741J21665_1012486 JGI24741J21665_10124861 337
113 3300003322 rootL2_10212707 rootL2_102127073 337
114 3300003322 rootL2_10327244 rootL2_103272443 337
115 3300003323 rootH1_10008230 rootH1_100082306 337
116 3300003323 rootH1_10012489 rootH1_1001248929 337
117 3300003323 rootH1_10015682 rootH1_100156826 337
118 3300005338 Ga0068868_100036844 Ga0068868_1000368445 337
119 3300005353 Ga0070669_100069558 Ga0070669_1000695583 337
120 3300005457 Ga0070662_100000449 Ga0070662_10000044910 337
121 3300005563 Ga0068855_100002223 Ga0068855_10000222320 337
122 3300005614 Ga0068856_100019518 Ga0068856_1000195183 337
123 3300006871 Ga0075434_100305204 Ga0075434_1003052041 337
124 3300009036 Ga0105244_10000050 Ga0105244_10000050116 337
125 3300009094 Ga0111539_10106769 Ga0111539_101067695 337
126 3300009147 Ga0114129_10329537 Ga0114129_103295372 337
127 3300009174 Ga0105241_10000217 Ga0105241_1000021728 337
128 3300009174 Ga0105241_10038160 Ga0105241_100381601 337
129 3300013100 Ga0157373_10085779 Ga0157373_100857792 337
130 3300013102 Ga0157371_10059477 Ga0157371_100594773 337
131 3300013104 Ga0157370_10038218 Ga0157370_100382183 337
132 3300013105 Ga0157369_10107324 Ga0157369_101073243 337
133 3300013307 Ga0157372_10019538 Ga0157372_100195382 337
134 3300013308 Ga0157375_10000128 Ga0157375_1000012813 337
135 3300014326 Ga0157380_10005293 Ga0157380_1000529311 337
136 3300014745 Ga0157377_10016475 Ga0157377_100164754 337
137 3300017792 Ga0163161_10002143 Ga0163161_100021438 337
138 3300025728 Ga0207655_1000489 Ga0207655_100048940 337
139 3300025904 Ga0207647_10000117 Ga0207647_1000011739 337
140 3300025911 Ga0207654_10002034 Ga0207654_100020346 337
141 3300025911 Ga0207654_10203482 Ga0207654_102034821 337
142 3300025913 Ga0207695_10015460 Ga0207695_100154603 337
143 3300025933 Ga0207706_10000044 Ga0207706_1000004410 337
144 3300025949 Ga0207667_10013556 Ga0207667_100135566 337
145 3300026023 Ga0207677_10114203 Ga0207677_101142032 337
146 3300026078 Ga0207702_10078968 Ga0207702_100789683 337
147 3300026116 Ga0207674_10061408 Ga0207674_100614084 337
148 3300031911 Ga0307412_10002601 Ga0307412_1000260111 337
149 3300041413 Ga0439465_0012886 Ga0439465_0012886_321_1394 337
150 3300046453 Ga0495627_000002 Ga0495627_000002_196269_197342 337
151 3300046500 Ga0495596_0002535 Ga0495596_0002535_6813_7886 337
152 3300046525 Ga0495663_0008660 Ga0495663_0008660_661_1734 337
153 3300046530 Ga0495654_0000001 Ga0495654_0000001_1232702_1233775 337
154 3300046615 Ga0495656_0083250 Ga0495656_0083250_37_1122 337
155 3300047472 Ga0495686_0000095 Ga0495686_0000095_167590_168663 337
156 3300047472 Ga0495686_0099035 Ga0495686_0099035_230_1303 337
157 3300048928 Ga0496125_0016744 Ga0496125_0016744_4722_5798 337
158 3300049758 Ga0501241_000015 Ga0501241_000015_30971_32044 337
159 3300049766 Ga0501269_000518 Ga0501269_000518_6631_7704 337
160 3300050490 nmdc:mga03n38_109716_c1 nmdc:mga03n38_109716_c1_186_1259 337
161 3300050507 nmdc:mga05p37_74222_c1 nmdc:mga05p37_74222_c1_2312_3427 337
162 3300050512 nmdc:mga0n895_375757_c1 nmdc:mga0n895_375757_c1_38_1123 337
163 3300001989 JGI24739J22299_10014595 JGI24739J22299_100145953 338
164 3300001990 JGI24737J22298_10000292 JGI24737J22298_100002927 338
165 3300002067 JGI24735J21928_10000020 JGI24735J21928_1000002073 338
166 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005273 338
167 3300002772 JGI25164J39214_1001232 JGI25164J39214_10012322 338
168 3300003214 JGI25165J46597_1000922 JGI25165J46597_100092223 338
169 3300003320 rootH2_10061212 rootH2_100612122 338
170 3300003320 rootH2_10180862 rootH2_101808623 338
171 3300003323 rootH1_10009456 rootH1_100094568 338
172 3300003781 Ga0055536_1000010 Ga0055536_100001093 338
173 3300003791 Ga0055530_10000816 Ga0055530_1000081611 338
174 3300005289 Ga0065704_10078708 Ga0065704_100787083 338
175 3300005328 Ga0070676_10000901 Ga0070676_1000090110 338
176 3300005329 Ga0070683_100087114 Ga0070683_1000871143 338
177 3300005337 Ga0070682_100000201 Ga0070682_10000020117 338
178 3300005338 Ga0068868_100010751 Ga0068868_1000107511 338
179 3300005355 Ga0070671_100002405 Ga0070671_1000024059 338
180 3300005355 Ga0070671_100018094 Ga0070671_1000180946 338
181 3300005355 Ga0070671_100326314 Ga0070671_1003263141 338
182 3300005356 Ga0070674_100017936 Ga0070674_1000179363 338
183 3300005364 Ga0070673_100019297 Ga0070673_1000192973 338
184 3300005437 Ga0070710_10098286 Ga0070710_100982862 338
185 3300005444 Ga0070694_100164468 Ga0070694_1001644682 338
186 3300005456 Ga0070678_100060776 Ga0070678_1000607761 338
187 3300005459 Ga0068867_100014731 Ga0068867_1000147313 338
188 3300005539 Ga0068853_100053996 Ga0068853_1000539965 338
189 3300005543 Ga0070672_100070607 Ga0070672_1000706073 338
190 3300005548 Ga0070665_100000125 Ga0070665_10000012594 338
191 3300005548 Ga0070665_100010549 Ga0070665_1000105495 338
192 3300005548 Ga0070665_100085608 Ga0070665_1000856084 338
193 3300005549 Ga0070704_100210039 Ga0070704_1002100391 338
194 3300005563 Ga0068855_100011059 Ga0068855_1000110596 338
195 3300005563 Ga0068855_100046847 Ga0068855_1000468478 338
196 3300005564 Ga0070664_100053760 Ga0070664_1000537602 338
197 3300005614 Ga0068856_100043373 Ga0068856_1000433732 338
198 3300005614 Ga0068856_100319387 Ga0068856_1003193871 338
199 3300005616 Ga0068852_100000437 Ga0068852_10000043719 338
200 3300005840 Ga0068870_10015225 Ga0068870_100152253 338
201 3300005841 Ga0068863_100035349 Ga0068863_1000353491 338
202 3300006237 Ga0097621_100000212 Ga0097621_10000021219 338
203 3300006358 Ga0068871_100007236 Ga0068871_1000072367 338
204 3300006881 Ga0068865_100000112 Ga0068865_10000011231 338
205 3300009093 Ga0105240_10010344 Ga0105240_1001034414 338
206 3300009094 Ga0111539_10132686 Ga0111539_101326864 338
207 3300009174 Ga0105241_10013756 Ga0105241_100137568 338
208 3300009545 Ga0105237_10002186 Ga0105237_1000218614 338
209 3300009545 Ga0105237_10052939 Ga0105237_100529393 338
210 3300009551 Ga0105238_10083143 Ga0105238_100831432 338
211 3300010375 Ga0105239_10000032 Ga0105239_10000032113 338
212 3300010375 Ga0105239_10085913 Ga0105239_100859133 338
213 3300010375 Ga0105239_10482695 Ga0105239_104826951 338
214 3300011119 Ga0105246_10042633 Ga0105246_100426332 338
215 3300013102 Ga0157371_10057409 Ga0157371_100574091 338
216 3300013102 Ga0157371_10223682 Ga0157371_102236821 338
217 3300013104 Ga0157370_10171359 Ga0157370_101713592 338
218 3300013105 Ga0157369_10050461 Ga0157369_100504614 338
219 3300013105 Ga0157369_10199788 Ga0157369_101997881 338
220 3300013296 Ga0157374_10000887 Ga0157374_1000088718 338
221 3300013296 Ga0157374_10003360 Ga0157374_100033609 338
222 3300013296 Ga0157374_10045472 Ga0157374_100454725 338
223 3300013296 Ga0157374_10150756 Ga0157374_101507562 338
224 3300013296 Ga0157374_10160441 Ga0157374_101604412 338
225 3300013306 Ga0163162_10000005 Ga0163162_1000000549 338
226 3300013306 Ga0163162_10001980 Ga0163162_100019808 338
227 3300013306 Ga0163162_10332028 Ga0163162_103320282 338
228 3300013307 Ga0157372_10031687 Ga0157372_100316874 338
229 3300013307 Ga0157372_10038047 Ga0157372_100380474 338
230 3300013308 Ga0157375_10017370 Ga0157375_100173706 338
231 3300013308 Ga0157375_10036720 Ga0157375_100367204 338
232 3300014325 Ga0163163_10065516 Ga0163163_100655163 338
233 3300014969 Ga0157376_10004264 Ga0157376_1000426411 338
234 3300015261 Ga0182006_1000109 Ga0182006_100010953 338
235 3300017792 Ga0163161_10000098 Ga0163161_1000009811 338
236 3300020077 Ga0206351_10887789 Ga0206351_108877892 338
237 3300025231 Ga0207427_100243 Ga0207427_10024317 338
238 3300025233 Ga0209437_100034 Ga0209437_100034368 338
239 3300025233 Ga0209437_100043 Ga0209437_100043134 338
240 3300025258 Ga0209129_1011530 Ga0209129_10115302 338
241 3300025261 Ga0209233_1000038 Ga0209233_1000038368 338
242 3300025291 Ga0209675_1000088 Ga0209675_1000088113 338
243 3300025292 Ga0209676_1000009 Ga0209676_1000009782 338
244 3300025298 Ga0209050_1000103 Ga0209050_100010391 338
245 3300025893 Ga0207682_10011125 Ga0207682_100111252 338
246 3300025904 Ga0207647_10055401 Ga0207647_100554011 338
247 3300025907 Ga0207645_10000167 Ga0207645_1000016749 338
248 3300025911 Ga0207654_10018059 Ga0207654_100180594 338
249 3300025913 Ga0207695_10016628 Ga0207695_100166284 338
250 3300025914 Ga0207671_10001573 Ga0207671_1000157327 338
251 3300025914 Ga0207671_10006721 Ga0207671_100067214 338
252 3300025914 Ga0207671_10010844 Ga0207671_100108441 338
253 3300025922 Ga0207646_10163416 Ga0207646_101634162 338
254 3300025924 Ga0207694_10069689 Ga0207694_100696893 338
255 3300025931 Ga0207644_10295437 Ga0207644_102954371 338
256 3300025937 Ga0207669_10011035 Ga0207669_100110353 338
257 3300025938 Ga0207704_10000062 Ga0207704_1000006225 338
258 3300025940 Ga0207691_10066245 Ga0207691_100662452 338
259 3300025944 Ga0207661_10078090 Ga0207661_100780903 338
260 3300025949 Ga0207667_10005479 Ga0207667_1000547914 338
261 3300026023 Ga0207677_10007569 Ga0207677_100075698 338
262 3300026041 Ga0207639_10031689 Ga0207639_100316894 338
263 3300026041 Ga0207639_10112844 Ga0207639_101128442 338
264 3300026078 Ga0207702_10055529 Ga0207702_100555296 338
265 3300026089 Ga0207648_10002072 Ga0207648_100020723 338
266 3300026121 Ga0207683_10017087 Ga0207683_100170878 338
267 3300026142 Ga0207698_10185927 Ga0207698_101859272 338
268 3300028379 Ga0268266_10000132 Ga0268266_1000013280 338
269 3300031090 Ga0265760_10021557 Ga0265760_100215572 338
270 3300031911 Ga0307412_10033153 Ga0307412_100331532 338
271 3300039437 Ga0436365_1855810 Ga0436365_1855810_20492_21637 338
272 3300042004 Ga0439445_0000466 Ga0439445_0000466_3024_4100 338
273 3300046471 Ga0495650_0000349 Ga0495650_0000349_53771_54847 338
274 3300046492 Ga0495585_0000194 Ga0495585_0000194_47878_48954 338
275 3300046506 Ga0495583_0054279 Ga0495583_0054279_305_1381 338
276 3300046507 Ga0495606_0000009 Ga0495606_0000009_274786_275862 338
277 3300046513 Ga0495616_0000760 Ga0495616_0000760_17805_18881 338
278 3300046519 Ga0495632_0001272 Ga0495632_0001272_1477_2553 338
279 3300046538 Ga0495609_0010405 Ga0495609_0010405_2807_3883 338
280 3300046558 Ga0495633_0000635 Ga0495633_0000635_152_1228 338
281 3300046616 Ga0495668_0082217 Ga0495668_0082217_585_1739 338
282 3300046660 Ga0495625_0000007 Ga0495625_0000007_56910_57986 338
283 3300046660 Ga0495625_0000449 Ga0495625_0000449_60598_61674 338
284 3300046665 Ga0495661_0002322 Ga0495661_0002322_8443_9519 338
285 3300046694 Ga0495649_0000007 Ga0495649_0000007_377429_378505 338
286 3300047443 Ga0495687_003188 Ga0495687_003188_1753_2829 338
287 3300047443 Ga0495687_065410 Ga0495687_065410_244_1320 338
288 3300047469 Ga0495673_0022823 Ga0495673_0022823_254_1330 338
289 3300047472 Ga0495686_0013274 Ga0495686_0013274_1058_2158 338
290 3300048904 Ga0496101_0114470 Ga0496101_0114470_788_1927 338
291 3300048905 Ga0496102_0167178 Ga0496102_0167178_786_1862 338
292 3300048907 Ga0496104_0189748 Ga0496104_0189748_805_1944 338
293 3300048908 Ga0496105_0049889 Ga0496105_0049889_1230_2369 338
294 3300048915 Ga0496112_0052797 Ga0496112_0052797_1618_2757 338
295 3300048916 Ga0496113_0033727 Ga0496113_0033727_1618_2757 338
296 3300048918 Ga0496115_0122858 Ga0496115_0122858_454_1593 338
297 3300048919 Ga0496116_0000022 Ga0496116_0000022_99858_100934 338
298 3300048920 Ga0496117_0000074 Ga0496117_0000074_103263_104339 338
299 3300048921 Ga0496118_0002167 Ga0496118_0002167_19524_20600 338
300 3300048922 Ga0496119_0000017 Ga0496119_0000017_128311_129387 338
301 3300048925 Ga0496122_0000354 Ga0496122_0000354_15386_16462 338
302 3300048925 Ga0496122_0069386 Ga0496122_0069386_1379_2473 338
303 3300048927 Ga0496124_0001335 Ga0496124_0001335_21685_22761 338
304 3300048928 Ga0496125_0000156 Ga0496125_0000156_35450_36544 338
305 3300048928 Ga0496125_0011589 Ga0496125_0011589_3436_4512 338
306 3300048929 Ga0496126_0002108 Ga0496126_0002108_20788_21864 338
307 3300049661 Ga0501217_003818 Ga0501217_003818_329_1405 338
308 3300049703 Ga0501219_000073 Ga0501219_000073_10189_11289 338
309 3300050005 Ga0501284_00004 Ga0501284_00004_176512_177612 338
310 3300050496 nmdc:mga07m45_67768_c1 nmdc:mga07m45_67768_c1_535_1611 338
311 3300053133 Ga0500655_006127 Ga0500655_006127_23_1102 338
312 3300053139 Ga0500568_0026112 Ga0500568_0026112_1120_2244 338
313 3300053153 Ga0500616_0007935 Ga0500616_0007935_2048_3124 338
314 iso_pu_bacteria 2585428182 2588209537 338
315 iso_pu_bacteria 2816332188 2816873645 338
316 2162886007 SwRhRL2b_contig_3895340 SwRhRL2b_0721.00004640 339
317 3300001979 JGI24740J21852_10000378 JGI24740J21852_1000037812 339
318 3300002738 JGI25154J39366_1000021 JGI25154J39366_100002151 339
319 3300002774 JGI25150J39212_1000019 JGI25150J39212_100001952 339
320 3300003187 JGI25151J46595_10000074 JGI25151J46595_1000007452 339
321 3300003215 JGI25153J46596_10000056 JGI25153J46596_1000005652 339
322 3300003215 JGI25153J46596_10000412 JGI25153J46596_1000041210 339
323 3300003322 rootL2_10290559 rootL2_102905592 339
324 3300003354 JGI25160J50197_1012838 JGI25160J50197_10128382 339
325 3300005262 Ga0065165_1026558 Ga0065165_10265582 339
326 3300005288 Ga0065714_10002550 Ga0065714_1000255025 339
327 3300005289 Ga0065704_10000227 Ga0065704_1000022762 339
328 3300005289 Ga0065704_10000319 Ga0065704_1000031938 339
329 3300005334 Ga0068869_100296686 Ga0068869_1002966861 339
330 3300005337 Ga0070682_100169889 Ga0070682_1001698891 339
331 3300005356 Ga0070674_100031413 Ga0070674_1000314133 339
332 3300005367 Ga0070667_100263761 Ga0070667_1002637612 339
333 3300005367 Ga0070667_100362874 Ga0070667_1003628742 339
334 3300005457 Ga0070662_100223916 Ga0070662_1002239161 339
335 3300005458 Ga0070681_10105029 Ga0070681_101050292 339
336 3300005459 Ga0068867_100068529 Ga0068867_1000685292 339
337 3300005563 Ga0068855_100059214 Ga0068855_1000592142 339
338 3300005563 Ga0068855_100090376 Ga0068855_1000903765 339
339 3300005564 Ga0070664_100176674 Ga0070664_1001766742 339
340 3300005616 Ga0068852_100017647 Ga0068852_1000176473 339
341 3300005617 Ga0068859_100000060 Ga0068859_10000006051 339
342 3300005618 Ga0068864_100004208 Ga0068864_10000420812 339
343 3300005618 Ga0068864_100085267 Ga0068864_1000852673 339
344 3300005841 Ga0068863_100007997 Ga0068863_10000799711 339
345 3300005843 Ga0068860_100016827 Ga0068860_1000168278 339
346 3300006195 Ga0075366_10003002 Ga0075366_100030028 339
347 3300006358 Ga0068871_100007233 Ga0068871_10000723310 339
348 3300006931 Ga0097620_100000060 Ga0097620_10000006051 339
349 3300009036 Ga0105244_10000007 Ga0105244_1000000793 339
350 3300009093 Ga0105240_10015281 Ga0105240_1001528113 339
351 3300009093 Ga0105240_10131596 Ga0105240_101315963 339
352 3300009093 Ga0105240_10539673 Ga0105240_105396732 339
353 3300009101 Ga0105247_10006269 Ga0105247_100062694 339
354 3300009174 Ga0105241_10003854 Ga0105241_1000385410 339
355 3300009545 Ga0105237_10000926 Ga0105237_1000092610 339
356 3300009553 Ga0105249_10004078 Ga0105249_100040786 339
357 3300010375 Ga0105239_10000430 Ga0105239_1000043065 339
358 3300010375 Ga0105239_10003456 Ga0105239_100034565 339
359 3300011119 Ga0105246_10036735 Ga0105246_100367353 339
360 3300013100 Ga0157373_10000105 Ga0157373_1000010520 339
361 3300013102 Ga0157371_10002711 Ga0157371_100027112 339
362 3300013104 Ga0157370_10006497 Ga0157370_100064978 339
363 3300013104 Ga0157370_10022918 Ga0157370_100229187 339
364 3300013296 Ga0157374_10056925 Ga0157374_100569252 339
365 3300013297 Ga0157378_10146852 Ga0157378_101468522 339
366 3300013306 Ga0163162_10002463 Ga0163162_100024638 339
367 3300013307 Ga0157372_10010830 Ga0157372_100108308 339
368 3300014325 Ga0163163_10016161 Ga0163163_100161612 339
369 3300014497 Ga0182008_10000012 Ga0182008_10000012152 339
370 3300014497 Ga0182008_10000526 Ga0182008_1000052613 339
371 3300014745 Ga0157377_10155757 Ga0157377_101557572 339
372 3300014968 Ga0157379_10027982 Ga0157379_100279826 339
373 3300025208 Ga0209436_100353 Ga0209436_1003535 339
374 3300025245 Ga0207425_1000007 Ga0207425_1000007267 339
375 3300025246 Ga0209646_1000050 Ga0209646_1000050204 339
376 3300025246 Ga0209646_1002199 Ga0209646_10021992 339
377 3300025250 Ga0209026_1000240 Ga0209026_100024032 339
378 3300025258 Ga0209129_1000006 Ga0209129_1000006267 339
379 3300025284 Ga0209130_1001245 Ga0209130_10012454 339
380 3300025294 Ga0209025_1000025 Ga0209025_100002597 339
381 3300025297 Ga0209758_1000016 Ga0209758_1000016267 339
382 3300025297 Ga0209758_1001281 Ga0209758_100128128 339
383 3300025298 Ga0209050_1000892 Ga0209050_100089228 339
384 3300025302 Ga0207426_1000293 Ga0207426_100029364 339
385 3300025302 Ga0207426_1000814 Ga0207426_10008146 339
386 3300025728 Ga0207655_1000066 Ga0207655_1000066175 339
387 3300025900 Ga0207710_10006203 Ga0207710_100062034 339
388 3300025903 Ga0207680_10000018 Ga0207680_1000001864 339
389 3300025911 Ga0207654_10003949 Ga0207654_100039494 339
390 3300025912 Ga0207707_10075845 Ga0207707_100758452 339
391 3300025913 Ga0207695_10027138 Ga0207695_100271383 339
392 3300025913 Ga0207695_10200240 Ga0207695_102002403 339
393 3300025914 Ga0207671_10016784 Ga0207671_100167843 339
394 3300025918 Ga0207662_10026625 Ga0207662_100266253 339
395 3300025931 Ga0207644_10174804 Ga0207644_101748042 339
396 3300025942 Ga0207689_10005537 Ga0207689_100055377 339
397 3300025942 Ga0207689_10329236 Ga0207689_103292361 339
398 3300025945 Ga0207679_10286227 Ga0207679_102862271 339
399 3300025949 Ga0207667_10057281 Ga0207667_100572813 339
400 3300025949 Ga0207667_10153405 Ga0207667_101534053 339
401 3300026035 Ga0207703_10008799 Ga0207703_100087993 339
402 3300026041 Ga0207639_10207583 Ga0207639_102075832 339
403 3300026088 Ga0207641_10000308 Ga0207641_1000030815 339
404 3300026095 Ga0207676_10020747 Ga0207676_100207472 339
405 3300026142 Ga0207698_10006511 Ga0207698_100065114 339
406 3300028380 Ga0268265_10140305 Ga0268265_101403052 339
407 3300028786 Ga0307517_10001156 Ga0307517_100011564 339
408 3300028786 Ga0307517_10002382 Ga0307517_100023823 339
409 3300028794 Ga0307515_10000021 Ga0307515_10000021147 339
410 3300028794 Ga0307515_10001368 Ga0307515_1000136837 339
411 3300028794 Ga0307515_10057090 Ga0307515_100570904 339
412 3300030732 Ga0316176_1002742 Ga0316176_100274234 339
413 3300031251 Ga0265327_10000614 Ga0265327_1000061443 339
414 3300031507 Ga0307509_10175102 Ga0307509_101751022 339
415 3300031911 Ga0307412_10000181 Ga0307412_1000018110 339
416 3300032004 Ga0307414_10003855 Ga0307414_100038559 339
417 3300032004 Ga0307414_10035583 Ga0307414_100355832 339
418 3300032004 Ga0307414_10433863 Ga0307414_104338631 339
419 3300032005 Ga0307411_10000001 Ga0307411_10000001751 339
420 3300033179 Ga0307507_10006210 Ga0307507_100062107 339
421 3300033180 Ga0307510_10008532 Ga0307510_100085326 339
422 3300041404 Ga0439436_0010287 Ga0439436_0010287_1437_2522 339
423 3300041407 Ga0439447_001000 Ga0439447_001000_5069_6154 339
424 3300042014 Ga0439457_005335 Ga0439457_005335_1237_2322 339
425 3300044656 Ga0466969_0000086 Ga0466969_0000086_22614_23702 339
426 3300044658 Ga0466972_0000047 Ga0466972_0000047_30263_31351 339
427 3300044684 Ga0466966_0000366 Ga0466966_0000366_24695_25783 339
428 3300045049 Ga0466959_0000053 Ga0466959_0000053_75404_76492 339
429 3300046460 Ga0495638_0109105 Ga0495638_0109105_142_1227 339
430 3300046462 Ga0495651_0061544 Ga0495651_0061544_14_1099 339
431 3300046529 Ga0495652_0189110 Ga0495652_0189110_97_1182 339
432 3300046538 Ga0495609_0002310 Ga0495609_0002310_2011_3096 339
433 3300046660 Ga0495625_0098607 Ga0495625_0098607_405_1490 339
434 3300046660 Ga0495625_0125635 Ga0495625_0125635_285_1370 339
435 3300047323 Ga0495683_0047361 Ga0495683_0047361_1024_2109 339
436 3300047472 Ga0495686_0003272 Ga0495686_0003272_3530_4615 339
437 3300048928 Ga0496125_0208824 Ga0496125_0208824_39_1124 339
438 3300049679 Ga0501249_002848 Ga0501249_002848_2058_3143 339
439 3300049705 Ga0501225_0003492 Ga0501225_0003492_2507_3586 339
440 3300049763 Ga0501266_000005 Ga0501266_000005_233104_234189 339
441 3300050493 nmdc:mga0k408_593_c1 nmdc:mga0k408_593_c1_800_1885 339
442 3300053088 Ga0500644_0006080 Ga0500644_0006080_675_1760 339
443 3300053090 Ga0500646_0002450 Ga0500646_0002450_24_1109 339
444 3300053092 Ga0500583_0000430 Ga0500583_0000430_10813_11898 339
445 3300053093 Ga0500651_0001281 Ga0500651_0001281_5562_6656 339
446 3300053096 Ga0500641_0000040 Ga0500641_0000040_12317_13402 339
447 3300053111 Ga0500572_019466 Ga0500572_019466_455_1543 339
448 3300053125 Ga0500618_000010 Ga0500618_000010_91457_92542 339
449 3300053134 Ga0500658_0000024 Ga0500658_0000024_70004_71089 339
450 3300053146 Ga0500588_0000977 Ga0500588_0000977_2536_3621 339
451 3300053153 Ga0500616_0000004 Ga0500616_0000004_141199_142284 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03060

NMO

Nitronate monooxygenase

4

351

0.95

PF04481

DUF561

Protein of unknown function (DUF561)

159

260

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qit-assembly1.cif.gz_B crystal structure of nitroalkane oxidase from pseudomonas aeruginosa in mutant complex form 0.911 6 332
4q4k-assembly1.cif.gz_A crystal structure of nitronate monooxygenase from pseudomonas aeruginosa pao1 0.9089 6 333
4qiu-assembly1.cif.gz_B crystal structure of nitroalkane oxidase from pseudomonas aeruginosa in mutant complex form 0.9041 6 333
3bw2-assembly1.cif.gz_A-2 crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes 0.8827 16 338
5lsm-assembly6.cif.gz_E crystal structure of nitronate monooxygenase (so_0471) from shewanella oneidensis mr-1 0.8824 6 331
ID Description Score Start End Superfamily
af_Q2FZX9_3_354_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9128 4 337 3.20.20.70
4qisA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8994 6 331 3.20.20.70
af_Q2FZX9_3_354_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8974 4 337 3.20.20.70
af_I6X5C5_6_344_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8902 16 328 3.20.20.70
5lsmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8782 6 328 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1N7EZ58-F1-model_v4 deleted 0.9835 1 337
AF-A0A0C1DDG5-F1-model_v4 deleted 0.9772 149 336
AF-A0A1N7EZ58-F1-model_v4 deleted 0.9749 1 337
AF-A0A2V9X7U7-F1-model_v4 Propionate 3-nitronate monooxygenase 0.9681 136 334 GO:0009636
GO:0018580
GO:0051213
AF-A0A0C1DDG5-F1-model_v4 deleted 0.967 149 336

Feature Viewer

pLDDT pTM Quality
94.44 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map