F446741

General Info

Members Datasets Scaffolds Average Seq Length
451 244 902 87

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10179373|Ga0070681_101793732
Length 100
Sequence MTTKLHEMADPQRDPPRHTPEQLRWLLTARARPGQPGSAAVSVLARNAMIPELAFDMMVDWHPGAEAADVEGRALVILSLLFKELAAECDRAASARFRQG

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
216 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
225 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
226 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
229 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
230 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
235 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
236 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
237 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
240 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
243 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.97
Nodule 0
Rhizoplane 4.66
Rhizosphere 76.5
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10179373 3300005458 Bacteria 2039
2 JGI25153J46596_10054457 3300003215 Bacteria 1126
3 Ga0055530_10000039 3300003791 Bacteria 115587
4 Ga0055531_10003500 3300003794 Bacteria 9985
5 Ga0055531_10107172 3300003794 Bacteria 564
6 Ga0055543_1004683 3300004625 Bacteria 3660
7 Ga0065165_1000950 3300005262 Bacteria 36689
8 Ga0070658_10264203 3300005327 Bacteria 1462
9 Ga0070683_100911911 3300005329 Bacteria 843
10 Ga0070670_100000013 3300005331 Bacteria 250768
11 Ga0070670_100183683 3300005331 Bacteria 1816
12 Ga0070670_100548696 3300005331 Bacteria 1031
13 Ga0068869_100193305 3300005334 Bacteria 1601
14 Ga0070666_10108615 3300005335 Bacteria 1917
15 Ga0070666_10368197 3300005335 Unclassified 1030
16 Ga0070666_10736164 3300005335 Bacteria 724
17 Ga0070666_11026381 3300005335 Bacteria 612
18 Ga0070666_11462157 3300005335 Unclassified 511
19 Ga0070680_100040606 3300005336 Bacteria 3768
20 Ga0070680_100095120 3300005336 Bacteria 2469
21 Ga0068868_101864973 3300005338 Bacteria 569
22 Ga0070660_100470286 3300005339 Bacteria 1044
23 Ga0070691_10007251 3300005341 Bacteria 5075
24 Ga0070661_100086998 3300005344 Bacteria 2311
25 Ga0070661_101646375 3300005344 Bacteria 543
26 Ga0070692_10481433 3300005345 Unclassified 800
27 Ga0070668_100000377 3300005347 Bacteria 29471
28 Ga0070668_100021679 3300005347 Bacteria 4854
29 Ga0070669_100021376 3300005353 Bacteria 4623
30 Ga0070671_100001863 3300005355 Bacteria 16101
31 Ga0070671_100193746 3300005355 Bacteria 1723
32 Ga0070674_100366273 3300005356 Bacteria 1168
33 Ga0070673_100097990 3300005364 Bacteria 2409
34 Ga0070673_101172899 3300005364 Bacteria 719
35 Ga0070667_100000233 3300005367 Bacteria 63545
36 Ga0070667_100012553 3300005367 Bacteria 7006
37 Ga0070667_100018639 3300005367 Bacteria 5757
38 Ga0070667_100039600 3300005367 Bacteria 3951
39 Ga0070663_100146975 3300005455 Bacteria 1804
40 Ga0070663_101399750 3300005455 Bacteria 619
41 Ga0070678_100054133 3300005456 Bacteria 2922
42 Ga0070678_101471822 3300005456 Bacteria 637
43 Ga0070678_101866199 3300005456 Bacteria 567
44 Ga0070662_100152226 3300005457 Bacteria 1802
45 Ga0070662_100671208 3300005457 Bacteria 875
46 Ga0070706_102128685 3300005467 Bacteria 507
47 Ga0070698_101939774 3300005471 Bacteria 542
48 Ga0070679_100071019 3300005530 Bacteria 3472
49 Ga0070684_100650726 3300005535 Bacteria 981
50 Ga0070684_101906355 3300005535 Bacteria 561
51 Ga0068853_102481090 3300005539 Bacteria 502
52 Ga0070665_100000311 3300005548 Bacteria 75738
53 Ga0070665_100000874 3300005548 Bacteria 38823
54 Ga0070665_100081129 3300005548 Bacteria 3249
55 Ga0070665_100208908 3300005548 Bacteria 1953
56 Ga0068855_100041873 3300005563 Bacteria 5428
57 Ga0068855_100050245 3300005563 Bacteria 4915
58 Ga0068855_100105871 3300005563 Bacteria 3234
59 Ga0068855_100220955 3300005563 Bacteria 2124
60 Ga0068855_100466571 3300005563 Bacteria 1376
61 Ga0068855_101497389 3300005563 Bacteria 693
62 Ga0070664_100270747 3300005564 Bacteria 1530
63 Ga0070664_100340649 3300005564 Bacteria 1362
64 Ga0070664_101873926 3300005564 Bacteria 569
65 Ga0068854_100317487 3300005578 Bacteria 1265
66 Ga0068856_100420618 3300005614 Bacteria 1356
67 Ga0068856_100519342 3300005614 Bacteria 1212
68 Ga0068856_101437366 3300005614 Bacteria 704
69 Ga0068856_101615066 3300005614 Bacteria 661
70 Ga0068852_100170427 3300005616 Bacteria 2040
71 Ga0068852_100884307 3300005616 Bacteria 910
72 Ga0068859_100001382 3300005617 Bacteria 24687
73 Ga0068864_100000142 3300005618 Bacteria 69641
74 Ga0068864_100006231 3300005618 Bacteria 9784
75 Ga0068864_100008998 3300005618 Bacteria 8234
76 Ga0068864_100029280 3300005618 Bacteria 4661
77 Ga0068864_100056913 3300005618 Bacteria 3378
78 Ga0068864_100530808 3300005618 Bacteria 1135
79 Ga0068861_100805922 3300005719 Bacteria 882
80 Ga0068863_100000091 3300005841 Bacteria 98724
81 Ga0068863_100000220 3300005841 Bacteria 60987
82 Ga0068863_100154098 3300005841 Bacteria 2200
83 Ga0068863_100158806 3300005841 Bacteria 2165
84 Ga0068863_100233514 3300005841 Bacteria 1774
85 Ga0068863_101240502 3300005841 Bacteria 752
86 Ga0068863_102164593 3300005841 Bacteria 566
87 Ga0068858_100000059 3300005842 Bacteria 117158
88 Ga0068858_100021652 3300005842 Bacteria 6009
89 Ga0068858_100371565 3300005842 Bacteria 1371
90 Ga0068860_100000895 3300005843 Bacteria 33072
91 Ga0068860_100072239 3300005843 Bacteria 3279
92 Ga0068860_100264752 3300005843 Bacteria 1676
93 Ga0068860_100726637 3300005843 Bacteria 1004
94 Ga0068862_100000849 3300005844 Bacteria 30047
95 Ga0068862_100719802 3300005844 Bacteria 968
96 Ga0068862_100724167 3300005844 Bacteria 966
97 Ga0068862_101611943 3300005844 Bacteria 656
98 Ga0075368_10016145 3300006042 Bacteria 2780
99 Ga0075363_100106190 3300006048 Bacteria 1558
100 Ga0075364_10000439 3300006051 Bacteria 20830
101 Ga0070715_11036059 3300006163 Bacteria 513
102 Ga0075362_10093484 3300006177 Bacteria 1398
103 Ga0075362_10214515 3300006177 Bacteria 939
104 Ga0075367_10004606 3300006178 Bacteria 6751
105 Ga0075366_10064191 3300006195 Bacteria 2184
106 Ga0097621_100578995 3300006237 Bacteria 1024
107 Ga0075370_10060466 3300006353 Bacteria 2158
108 Ga0075370_10484733 3300006353 Bacteria 745
109 Ga0075370_10937584 3300006353 Bacteria 530
110 Ga0068871_100139528 3300006358 Bacteria 2061
111 Ga0068871_100638682 3300006358 Bacteria 971
112 Ga0068865_100000811 3300006881 Bacteria 17577
113 Ga0068865_101036298 3300006881 Bacteria 720
114 Ga0097620_100001382 3300006931 Bacteria 24687
115 Ga0105250_10020075 3300009092 Bacteria 2702
116 Ga0105250_10622598 3300009092 Bacteria 502
117 Ga0105240_10049647 3300009093 Bacteria 5294
118 Ga0105240_10069871 3300009093 Bacteria 4346
119 Ga0105240_10112151 3300009093 Bacteria 3297
120 Ga0105240_10347014 3300009093 Bacteria 1685
121 Ga0105240_10451163 3300009093 Bacteria 1439
122 Ga0105240_10662059 3300009093 Bacteria 1143
123 Ga0105240_11228863 3300009093 Bacteria 793
124 Ga0105240_12323577 3300009093 Bacteria 555
125 Ga0105245_10800092 3300009098 Bacteria 981
126 Ga0105247_10073222 3300009101 Bacteria 2146
127 Ga0105243_11176031 3300009148 Bacteria 779
128 Ga0105241_10528888 3300009174 Bacteria 1055
129 Ga0105248_10018028 3300009177 Bacteria 7793
130 Ga0105248_10029388 3300009177 Bacteria 6131
131 Ga0105248_10032481 3300009177 Bacteria 5834
132 Ga0105248_10046997 3300009177 Bacteria 4840
133 Ga0105248_10124679 3300009177 Bacteria 2906
134 Ga0105248_10440680 3300009177 Bacteria 1467
135 Ga0105248_10633385 3300009177 Bacteria 1206
136 Ga0105248_12580695 3300009177 Unclassified 579
137 Ga0105237_10177864 3300009545 Bacteria 2128
138 Ga0105237_10193637 3300009545 Bacteria 2033
139 Ga0105237_11955786 3300009545 Bacteria 595
140 Ga0105238_10024908 3300009551 Bacteria 6098
141 Ga0105238_10331115 3300009551 Bacteria 1510
142 Ga0105238_12578952 3300009551 Bacteria 544
143 Ga0105249_10000422 3300009553 Bacteria 40318
144 Ga0105249_10142621 3300009553 Bacteria 2299
145 Ga0105249_11317400 3300009553 Bacteria 794
146 Ga0105239_10862847 3300010375 Bacteria 1038
147 Ga0157373_10234792 3300013100 Bacteria 1295
148 Ga0157369_10532767 3300013105 Bacteria 1214
149 Ga0157369_10846097 3300013105 Bacteria 939
150 Ga0157369_11548090 3300013105 Bacteria 674
151 Ga0157369_12018992 3300013105 Bacteria 585
152 Ga0163162_10088198 3300013306 Bacteria 3182
153 Ga0163162_10100150 3300013306 Bacteria 2989
154 Ga0163162_10829360 3300013306 Bacteria 1041
155 Ga0163162_11147349 3300013306 Bacteria 881
156 Ga0157372_10069866 3300013307 Bacteria 3950
157 Ga0157375_10389448 3300013308 Bacteria 1560
158 Ga0157375_11771508 3300013308 Bacteria 732
159 Ga0163163_10003890 3300014325 Bacteria 12727
160 Ga0163163_10181916 3300014325 Bacteria 2149
161 Ga0163163_10471764 3300014325 Bacteria 1316
162 Ga0163163_10521214 3300014325 Bacteria 1251
163 Ga0163163_11076639 3300014325 Bacteria 867
164 Ga0163163_12690824 3300014325 Bacteria 555
165 Ga0157380_10562181 3300014326 Bacteria 1121
166 Ga0157377_11277102 3300014745 Unclassified 573
167 Ga0157379_10008768 3300014968 Bacteria 8819
168 Ga0157379_10014981 3300014968 Bacteria 6801
169 Ga0157379_10103497 3300014968 Bacteria 2555
170 Ga0157379_10367179 3300014968 Bacteria 1319
171 Ga0157379_11838384 3300014968 Bacteria 596
172 Ga0206356_11714731 3300020070 Bacteria 946
173 Ga0213876_10010224 3300021384 Bacteria 5040
174 Ga0213876_10014822 3300021384 Bacteria 4132
175 Ga0213875_10085557 3300021388 Bacteria 1471
176 Ga0209026_1001553 3300025250 Bacteria 9950
177 Ga0209758_1000885 3300025297 Bacteria 41066
178 Ga0209050_1000073 3300025298 Bacteria 292046
179 Ga0209257_1000099 3300025304 Bacteria 255304
180 Ga0209257_1012735 3300025304 Bacteria 3842
181 Ga0207696_1031856 3300025711 Bacteria 1591
182 Ga0207710_10038800 3300025900 Bacteria 2106
183 Ga0207680_10038958 3300025903 Bacteria 2754
184 Ga0207680_10282078 3300025903 Bacteria 1154
185 Ga0207680_10414328 3300025903 Unclassified 953
186 Ga0207654_10503138 3300025911 Bacteria 856
187 Ga0207707_10080330 3300025912 Bacteria 2847
188 Ga0207707_10152296 3300025912 Bacteria 2021
189 Ga0207695_10000321 3300025913 Bacteria 116087
190 Ga0207695_10003676 3300025913 Bacteria 21385
191 Ga0207695_10048532 3300025913 Bacteria 4482
192 Ga0207695_10071035 3300025913 Bacteria 3556
193 Ga0207695_10408006 3300025913 Bacteria 1243
194 Ga0207695_11000171 3300025913 Bacteria 716
195 Ga0207695_11032086 3300025913 Bacteria 702
196 Ga0207660_10011492 3300025917 Bacteria 5766
197 Ga0207660_10110085 3300025917 Bacteria 2071
198 Ga0207657_10964177 3300025919 Bacteria 655
199 Ga0207649_10471359 3300025920 Bacteria 951
200 Ga0207649_11464586 3300025920 Bacteria 540
201 Ga0207649_11577936 3300025920 Bacteria 520
202 Ga0207681_10272312 3300025923 Bacteria 1329
203 Ga0207681_11638275 3300025923 Bacteria 538
204 Ga0207694_10324470 3300025924 Bacteria 1271
205 Ga0207694_10793330 3300025924 Bacteria 800
206 Ga0207650_10000016 3300025925 Bacteria 361958
207 Ga0207650_10072965 3300025925 Bacteria 2584
208 Ga0207650_10731382 3300025925 Bacteria 837
209 Ga0207687_10518726 3300025927 Bacteria 996
210 Ga0207644_10008430 3300025931 Bacteria 6745
211 Ga0207644_10092810 3300025931 Bacteria 2253
212 Ga0207644_10987720 3300025931 Bacteria 706
213 Ga0207690_10315683 3300025932 Bacteria 1227
214 Ga0207706_10184296 3300025933 Bacteria 1833
215 Ga0207706_10447164 3300025933 Bacteria 1118
216 Ga0207669_10374194 3300025937 Bacteria 1108
217 Ga0207704_10003237 3300025938 Bacteria 7378
218 Ga0207704_10960919 3300025938 Bacteria 721
219 Ga0207711_10018782 3300025941 Bacteria 5748
220 Ga0207711_10026775 3300025941 Bacteria 4840
221 Ga0207711_10350342 3300025941 Bacteria 1367
222 Ga0207711_10457559 3300025941 Bacteria 1188
223 Ga0207689_10066099 3300025942 Bacteria 2974
224 Ga0207661_11061966 3300025944 Bacteria 746
225 Ga0207679_10235238 3300025945 Bacteria 1549
226 Ga0207679_10565339 3300025945 Bacteria 1022
227 Ga0207679_12162888 3300025945 Bacteria 505
228 Ga0207667_10108344 3300025949 Bacteria 2866
229 Ga0207667_10182995 3300025949 Bacteria 2151
230 Ga0207667_10240311 3300025949 Bacteria 1853
231 Ga0207667_11113952 3300025949 Bacteria 772
232 Ga0207651_10478151 3300025960 Bacteria 1073
233 Ga0207712_10010326 3300025961 Bacteria 5928
234 Ga0207668_10000088 3300025972 Bacteria 69295
235 Ga0207668_10000183 3300025972 Bacteria 42578
236 Ga0207668_10002474 3300025972 Bacteria 10782
237 Ga0207640_10621836 3300025981 Bacteria 917
238 Ga0207658_10000875 3300025986 Bacteria 25122
239 Ga0207658_10004424 3300025986 Bacteria 9773
240 Ga0207658_10168173 3300025986 Bacteria 1803
241 Ga0207658_10169771 3300025986 Bacteria 1796
242 Ga0207658_11333327 3300025986 Bacteria 656
243 Ga0207703_10000049 3300026035 Bacteria 149817
244 Ga0207703_10002367 3300026035 Bacteria 16403
245 Ga0207703_10003104 3300026035 Bacteria 14035
246 Ga0207703_10698685 3300026035 Bacteria 964
247 Ga0207703_12142818 3300026035 Bacteria 535
248 Ga0207639_12200082 3300026041 Bacteria 513
249 Ga0207678_10508794 3300026067 Bacteria 1050
250 Ga0207702_10190865 3300026078 Bacteria 1893
251 Ga0207702_10457467 3300026078 Bacteria 1239
252 Ga0207702_11400920 3300026078 Bacteria 693
253 Ga0207641_10000011 3300026088 Bacteria 384362
254 Ga0207641_10000578 3300026088 Bacteria 40331
255 Ga0207641_10023127 3300026088 Bacteria 5120
256 Ga0207641_10102663 3300026088 Bacteria 2522
257 Ga0207641_10131561 3300026088 Bacteria 2247
258 Ga0207641_10998985 3300026088 Bacteria 833
259 Ga0207641_12079864 3300026088 Bacteria 569
260 Ga0207676_10000073 3300026095 Bacteria 101510
261 Ga0207676_10000117 3300026095 Bacteria 69834
262 Ga0207676_10005953 3300026095 Bacteria 8601
263 Ga0207676_10011648 3300026095 Bacteria 6289
264 Ga0207676_10888835 3300026095 Bacteria 873
265 Ga0207676_11432721 3300026095 Bacteria 687
266 Ga0207676_11469625 3300026095 Bacteria 678
267 Ga0207676_12100517 3300026095 Bacteria 563
268 Ga0207674_10509491 3300026116 Bacteria 1162
269 Ga0207675_100968068 3300026118 Bacteria 869
270 Ga0207683_10086015 3300026121 Bacteria 2795
271 Ga0207683_11600401 3300026121 Bacteria 601
272 Ga0207698_10012451 3300026142 Bacteria 5568
273 Ga0207698_11913103 3300026142 Bacteria 608
274 Ga0207698_12056843 3300026142 Unclassified 585
275 Ga0209813_10005867 3300027866 Bacteria 3008
276 Ga0268266_10001223 3300028379 Bacteria 31520
277 Ga0268266_10055734 3300028379 Bacteria 3398
278 Ga0268266_10067126 3300028379 Bacteria 3104
279 Ga0268266_10537393 3300028379 Bacteria 1119
280 Ga0268266_10699927 3300028379 Bacteria 976
281 Ga0268265_10001166 3300028380 Bacteria 23019
282 Ga0268265_10823087 3300028380 Bacteria 906
283 Ga0268264_10000068 3300028381 Bacteria 275708
284 Ga0268264_10017092 3300028381 Bacteria 5940
285 Ga0268264_10142234 3300028381 Bacteria 2141
286 Ga0268264_12246688 3300028381 Bacteria 553
287 Ga0307517_10002588 3300028786 Bacteria 28810
288 Ga0307517_10039630 3300028786 Bacteria 5166
289 Ga0307517_10178568 3300028786 Bacteria 1376
290 Ga0307511_10018131 3300030521 Bacteria 6734
291 Ga0307513_10000636 3300031456 Bacteria 50426
292 Ga0307513_10000793 3300031456 Bacteria 45951
293 Ga0307508_10654207 3300031616 Bacteria 656
294 Ga0307510_10003534 3300033180 Bacteria 18228
295 Ga0373938_0216747 3300034957 Bacteria 536
296 Ga0373960_0207012 3300035121 Unclassified 696
297 Ga0373943_0028671 3300035170 Bacteria 2625
298 Ga0373946_0249556 3300035171 Bacteria 865
299 Ga0373927_0012241 3300035695 Bacteria 5707
300 Ga0373925_0000089 3300037068 Bacteria 98449
301 Ga0373925_0414497 3300037068 Bacteria 1100
302 Ga0395899_0000052 3300037312 Bacteria 221643
303 Ga0395899_0472379 3300037312 Bacteria 818
304 Ga0395900_0000002 3300037418 Bacteria 671103
305 Ga0395900_0964072 3300037418 Bacteria 774
306 Ga0395898_0180706 3300037466 Bacteria 2016
307 Ga0395905_0006846 3300037471 Bacteria 11397
308 Ga0395905_0346955 3300037471 Bacteria 1376
309 Ga0395905_0720097 3300037471 Bacteria 900
310 Ga0395905_0774548 3300037471 Bacteria 862
311 Ga0436364_1214495 3300037853 Bacteria 2972
312 Ga0395901_0000013 3300038443 Bacteria 375733
313 Ga0395901_0543863 3300038443 Bacteria 1178
314 Ga0395901_1403668 3300038443 Bacteria 657
315 Ga0436365_0523162 3300039437 Bacteria 6964
316 Ga0436365_0533422 3300039437 Bacteria 9963
317 Ga0439436_0087776 3300041404 Bacteria 866
318 Ga0439442_025132 3300042002 Bacteria 1239
319 Ga0439445_0135226 3300042004 Bacteria 713
320 Ga0466972_0223115 3300044658 Bacteria 882
321 Ga0466965_0446941 3300044683 Bacteria 719
322 Ga0466966_0311601 3300044684 Bacteria 946
323 Ga0466964_0625198 3300044706 Bacteria 593
324 Ga0466970_0392206 3300044765 Bacteria 791
325 Ga0466957_0118975 3300044842 Bacteria 1683
326 Ga0466957_0277439 3300044842 Bacteria 1121
327 Ga0466957_0535946 3300044842 Bacteria 815
328 Ga0466957_1245545 3300044842 Bacteria 539
329 Ga0466958_1023586 3300045836 Bacteria 539
330 Ga0495629_1059517 3300046459 Unclassified 526
331 Ga0495585_0168168 3300046492 Bacteria 1134
332 Ga0495585_0407695 3300046492 Bacteria 654
333 Ga0495585_0489078 3300046492 Bacteria 586
334 Ga0495583_0082677 3300046506 Bacteria 1393
335 Ga0495583_0406347 3300046506 Bacteria 535
336 Ga0495610_0114067 3300046512 Bacteria 1193
337 Ga0495620_0019961 3300046515 Bacteria 3282
338 Ga0495630_1304532 3300046517 Bacteria 547
339 Ga0495643_0012690 3300046522 Bacteria 5074
340 Ga0495642_0003507 3300046528 Bacteria 6179
341 Ga0495642_0077647 3300046528 Bacteria 1395
342 Ga0495642_0164813 3300046528 Bacteria 962
343 Ga0495654_0026010 3300046530 Bacteria 3013
344 Ga0495609_0025572 3300046538 Bacteria 2706
345 Ga0495621_0517817 3300046539 Bacteria 516
346 Ga0495597_0005477 3300046542 Bacteria 6715
347 Ga0495645_0029919 3300046543 Bacteria 3966
348 Ga0495645_0588584 3300046543 Bacteria 686
349 Ga0495622_0017724 3300046557 Bacteria 3314
350 Ga0495668_0066807 3300046616 Bacteria 1978
351 Ga0495668_0067818 3300046616 Bacteria 1963
352 Ga0495668_0104902 3300046616 Bacteria 1546
353 Ga0495668_0149627 3300046616 Bacteria 1278
354 Ga0495668_0232649 3300046616 Bacteria 1009
355 Ga0495668_0603532 3300046616 Bacteria 606
356 Ga0495611_0348480 3300046648 Bacteria 680
357 Ga0495625_0093264 3300046660 Bacteria 2079
358 Ga0495625_0204766 3300046660 Bacteria 1300
359 Ga0495625_0316698 3300046660 Bacteria 994
360 Ga0495625_0709842 3300046660 Bacteria 593
361 Ga0495599_0354748 3300046678 Bacteria 879
362 Ga0495623_0162617 3300046679 Bacteria 1311
363 Ga0495669_0100724 3300046684 Bacteria 1341
364 Ga0495669_0183296 3300046684 Bacteria 998
365 Ga0495669_0310259 3300046684 Bacteria 761
366 Ga0495613_0974847 3300046689 Bacteria 545
367 Ga0495624_0384521 3300046690 Bacteria 843
368 Ga0495670_0757621 3300046691 Bacteria 530
369 Ga0495672_0023154 3300047320 Bacteria 4027
370 Ga0495687_021135 3300047443 Bacteria 3158
371 Ga0495677_0055929 3300047445 Bacteria 1457
372 Ga0495673_0370052 3300047469 Bacteria 503
373 Ga0495593_0305648 3300047673 Unclassified 795
374 Ga0496100_0490046 3300048903 Bacteria 946
375 Ga0496101_0383788 3300048904 Bacteria 1105
376 Ga0496102_0039098 3300048905 Bacteria 4285
377 Ga0496102_0128310 3300048905 Bacteria 2372
378 Ga0496102_1775903 3300048905 Bacteria 534
379 Ga0496103_0064063 3300048906 Bacteria 2291
380 Ga0496103_0711348 3300048906 Bacteria 636
381 Ga0496105_0731810 3300048908 Bacteria 757
382 Ga0496106_0513778 3300048909 Bacteria 962
383 Ga0496107_0490651 3300048910 Bacteria 911
384 Ga0496107_1058279 3300048910 Bacteria 587
385 Ga0496108_0082330 3300048911 Bacteria 2729
386 Ga0496108_0361097 3300048911 Bacteria 1268
387 Ga0496109_0046992 3300048912 Bacteria 3922
388 Ga0496110_0084808 3300048913 Bacteria 2828
389 Ga0496111_0399999 3300048914 Bacteria 1015
390 Ga0496112_0329446 3300048915 Bacteria 1471
391 Ga0496113_0389671 3300048916 Bacteria 1118
392 Ga0496113_1131389 3300048916 Bacteria 613
393 Ga0496115_0000361 3300048918 Bacteria 38010
394 Ga0496115_0360209 3300048918 Bacteria 1185
395 Ga0496116_0267017 3300048919 Bacteria 839
396 Ga0496117_0005537 3300048920 Bacteria 13220
397 Ga0496117_0245558 3300048920 Bacteria 980
398 Ga0496118_0003871 3300048921 Bacteria 18389
399 Ga0496119_0026291 3300048922 Bacteria 4039
400 Ga0496120_0155274 3300048923 Bacteria 1146
401 Ga0496121_0000035 3300048924 Bacteria 374316
402 Ga0501032_0845491 3300049569 Bacteria 577
403 Ga0501033_0167185 3300049570 Bacteria 1581
404 Ga0501036_1475328 3300049572 Bacteria 550
405 Ga0501047_0008722 3300049581 Bacteria 9569
406 Ga0501047_0228636 3300049581 Bacteria 1714
407 Ga0501035_0644953 3300049822 Bacteria 859
408 Ga0501044_0133373 3300049823 Bacteria 2476
409 nmdc:mga03683_257277_c1 3300050489 Bacteria 812
410 nmdc:mga03n38_76936_c1 3300050490 Bacteria 1558
411 nmdc:mga00v17_426_c1 3300050491 Bacteria 23927
412 nmdc:mga0k408_33466_c1 3300050493 Bacteria 2940
413 nmdc:mga0k408_386755_c1 3300050493 Bacteria 833
414 nmdc:mga06z11_3378_c1 3300050494 Bacteria 6170
415 nmdc:mga04h51_14964_c1 3300050495 Bacteria 2228
416 nmdc:mga07m45_1533_c1 3300050496 Bacteria 10610
417 nmdc:mga07m45_239151_c1 3300050496 Bacteria 1057
418 nmdc:mga07m45_364334_c1 3300050496 Bacteria 840
419 Ga0500635_0000060 3300053080 Bacteria 72066
420 Ga0500578_0083504 3300053086 Bacteria 2030
421 Ga0500643_030949 3300053087 Bacteria 1636
422 Ga0500643_094445 3300053087 Bacteria 814
423 Ga0500644_0325020 3300053088 Bacteria 662
424 Ga0500646_0061184 3300053090 Bacteria 1109
425 Ga0500583_0039108 3300053092 Bacteria 2140
426 Ga0500651_0007983 3300053093 Bacteria 6194
427 Ga0500566_0123776 3300053094 Bacteria 1391
428 Ga0500641_0061064 3300053096 Bacteria 1569
429 Ga0500555_014354 3300053103 Bacteria 2283
430 Ga0500555_049047 3300053103 Bacteria 1158
431 Ga0500562_003278 3300053108 Bacteria 4044
432 Ga0500569_009107 3300053109 Bacteria 2297
433 Ga0500595_014993 3300053119 Bacteria 2923
434 Ga0500607_159715 3300053121 Bacteria 1032
435 Ga0500608_002690 3300053122 Bacteria 6521
436 Ga0500614_001981 3300053123 Bacteria 4683
437 Ga0500642_0184345 3300053130 Bacteria 975
438 Ga0500658_0425929 3300053134 Bacteria 606
439 Ga0500559_0325389 3300053136 Bacteria 720
440 Ga0500559_0489706 3300053136 Unclassified 565
441 Ga0500564_112675 3300053138 Bacteria 1193
442 Ga0500603_057481 3300053150 Bacteria 1080
443 Ga0500620_073140 3300053155 Bacteria 1181
444 Ga0500638_131461 3300053162 Bacteria 1134
445 Ga0500636_0004160 3300053177 Bacteria 8190
446 Ga0500637_0192055 3300053178 Bacteria 1166
447 Ga0500625_037689 3300053729 Bacteria 2285
448 Ga0500645_211257 3300053730 Bacteria 521
449 Ga0500596_010399 3300053735 Bacteria 1437
450 Ga0500601_026576 3300053737 Bacteria 678
451 Ga0501084_1523000 3300054114 Bacteria 559
452 Ga0070681_10179373
453 JGI25153J46596_10054457
454 Ga0055530_10000039
455 Ga0055531_10003500
456 Ga0055531_10107172
457 Ga0055543_1004683
458 Ga0065165_1000950
459 Ga0070658_10264203
460 Ga0070683_100911911
461 Ga0070670_100000013
462 Ga0070670_100183683
463 Ga0070670_100548696
464 Ga0068869_100193305
465 Ga0070666_10108615
466 Ga0070666_10368197
467 Ga0070666_10736164
468 Ga0070666_11026381
469 Ga0070666_11462157
470 Ga0070680_100040606
471 Ga0070680_100095120
472 Ga0068868_101864973
473 Ga0070660_100470286
474 Ga0070691_10007251
475 Ga0070661_100086998
476 Ga0070661_101646375
477 Ga0070692_10481433
478 Ga0070668_100000377
479 Ga0070668_100021679
480 Ga0070669_100021376
481 Ga0070671_100001863
482 Ga0070671_100193746
483 Ga0070674_100366273
484 Ga0070673_100097990
485 Ga0070673_101172899
486 Ga0070667_100000233
487 Ga0070667_100012553
488 Ga0070667_100018639
489 Ga0070667_100039600
490 Ga0070663_100146975
491 Ga0070663_101399750
492 Ga0070678_100054133
493 Ga0070678_101471822
494 Ga0070678_101866199
495 Ga0070662_100152226
496 Ga0070662_100671208
497 Ga0070706_102128685
498 Ga0070698_101939774
499 Ga0070679_100071019
500 Ga0070684_100650726
501 Ga0070684_101906355
502 Ga0068853_102481090
503 Ga0070665_100000311
504 Ga0070665_100000874
505 Ga0070665_100081129
506 Ga0070665_100208908
507 Ga0068855_100041873
508 Ga0068855_100050245
509 Ga0068855_100105871
510 Ga0068855_100220955
511 Ga0068855_100466571
512 Ga0068855_101497389
513 Ga0070664_100270747
514 Ga0070664_100340649
515 Ga0070664_101873926
516 Ga0068854_100317487
517 Ga0068856_100420618
518 Ga0068856_100519342
519 Ga0068856_101437366
520 Ga0068856_101615066
521 Ga0068852_100170427
522 Ga0068852_100884307
523 Ga0068859_100001382
524 Ga0068864_100000142
525 Ga0068864_100006231
526 Ga0068864_100008998
527 Ga0068864_100029280
528 Ga0068864_100056913
529 Ga0068864_100530808
530 Ga0068861_100805922
531 Ga0068863_100000091
532 Ga0068863_100000220
533 Ga0068863_100154098
534 Ga0068863_100158806
535 Ga0068863_100233514
536 Ga0068863_101240502
537 Ga0068863_102164593
538 Ga0068858_100000059
539 Ga0068858_100021652
540 Ga0068858_100371565
541 Ga0068860_100000895
542 Ga0068860_100072239
543 Ga0068860_100264752
544 Ga0068860_100726637
545 Ga0068862_100000849
546 Ga0068862_100719802
547 Ga0068862_100724167
548 Ga0068862_101611943
549 Ga0075368_10016145
550 Ga0075363_100106190
551 Ga0075364_10000439
552 Ga0070715_11036059
553 Ga0075362_10093484
554 Ga0075362_10214515
555 Ga0075367_10004606
556 Ga0075366_10064191
557 Ga0097621_100578995
558 Ga0075370_10060466
559 Ga0075370_10484733
560 Ga0075370_10937584
561 Ga0068871_100139528
562 Ga0068871_100638682
563 Ga0068865_100000811
564 Ga0068865_101036298
565 Ga0097620_100001382
566 Ga0105250_10020075
567 Ga0105250_10622598
568 Ga0105240_10049647
569 Ga0105240_10069871
570 Ga0105240_10112151
571 Ga0105240_10347014
572 Ga0105240_10451163
573 Ga0105240_10662059
574 Ga0105240_11228863
575 Ga0105240_12323577
576 Ga0105245_10800092
577 Ga0105247_10073222
578 Ga0105243_11176031
579 Ga0105241_10528888
580 Ga0105248_10018028
581 Ga0105248_10029388
582 Ga0105248_10032481
583 Ga0105248_10046997
584 Ga0105248_10124679
585 Ga0105248_10440680
586 Ga0105248_10633385
587 Ga0105248_12580695
588 Ga0105237_10177864
589 Ga0105237_10193637
590 Ga0105237_11955786
591 Ga0105238_10024908
592 Ga0105238_10331115
593 Ga0105238_12578952
594 Ga0105249_10000422
595 Ga0105249_10142621
596 Ga0105249_11317400
597 Ga0105239_10862847
598 Ga0157373_10234792
599 Ga0157369_10532767
600 Ga0157369_10846097
601 Ga0157369_11548090
602 Ga0157369_12018992
603 Ga0163162_10088198
604 Ga0163162_10100150
605 Ga0163162_10829360
606 Ga0163162_11147349
607 Ga0157372_10069866
608 Ga0157375_10389448
609 Ga0157375_11771508
610 Ga0163163_10003890
611 Ga0163163_10181916
612 Ga0163163_10471764
613 Ga0163163_10521214
614 Ga0163163_11076639
615 Ga0163163_12690824
616 Ga0157380_10562181
617 Ga0157377_11277102
618 Ga0157379_10008768
619 Ga0157379_10014981
620 Ga0157379_10103497
621 Ga0157379_10367179
622 Ga0157379_11838384
623 Ga0206356_11714731
624 Ga0213876_10010224
625 Ga0213876_10014822
626 Ga0213875_10085557
627 Ga0209026_1001553
628 Ga0209758_1000885
629 Ga0209050_1000073
630 Ga0209257_1000099
631 Ga0209257_1012735
632 Ga0207696_1031856
633 Ga0207710_10038800
634 Ga0207680_10038958
635 Ga0207680_10282078
636 Ga0207680_10414328
637 Ga0207654_10503138
638 Ga0207707_10080330
639 Ga0207707_10152296
640 Ga0207695_10000321
641 Ga0207695_10003676
642 Ga0207695_10048532
643 Ga0207695_10071035
644 Ga0207695_10408006
645 Ga0207695_11000171
646 Ga0207695_11032086
647 Ga0207660_10011492
648 Ga0207660_10110085
649 Ga0207657_10964177
650 Ga0207649_10471359
651 Ga0207649_11464586
652 Ga0207649_11577936
653 Ga0207681_10272312
654 Ga0207681_11638275
655 Ga0207694_10324470
656 Ga0207694_10793330
657 Ga0207650_10000016
658 Ga0207650_10072965
659 Ga0207650_10731382
660 Ga0207687_10518726
661 Ga0207644_10008430
662 Ga0207644_10092810
663 Ga0207644_10987720
664 Ga0207690_10315683
665 Ga0207706_10184296
666 Ga0207706_10447164
667 Ga0207669_10374194
668 Ga0207704_10003237
669 Ga0207704_10960919
670 Ga0207711_10018782
671 Ga0207711_10026775
672 Ga0207711_10350342
673 Ga0207711_10457559
674 Ga0207689_10066099
675 Ga0207661_11061966
676 Ga0207679_10235238
677 Ga0207679_10565339
678 Ga0207679_12162888
679 Ga0207667_10108344
680 Ga0207667_10182995
681 Ga0207667_10240311
682 Ga0207667_11113952
683 Ga0207651_10478151
684 Ga0207712_10010326
685 Ga0207668_10000088
686 Ga0207668_10000183
687 Ga0207668_10002474
688 Ga0207640_10621836
689 Ga0207658_10000875
690 Ga0207658_10004424
691 Ga0207658_10168173
692 Ga0207658_10169771
693 Ga0207658_11333327
694 Ga0207703_10000049
695 Ga0207703_10002367
696 Ga0207703_10003104
697 Ga0207703_10698685
698 Ga0207703_12142818
699 Ga0207639_12200082
700 Ga0207678_10508794
701 Ga0207702_10190865
702 Ga0207702_10457467
703 Ga0207702_11400920
704 Ga0207641_10000011
705 Ga0207641_10000578
706 Ga0207641_10023127
707 Ga0207641_10102663
708 Ga0207641_10131561
709 Ga0207641_10998985
710 Ga0207641_12079864
711 Ga0207676_10000073
712 Ga0207676_10000117
713 Ga0207676_10005953
714 Ga0207676_10011648
715 Ga0207676_10888835
716 Ga0207676_11432721
717 Ga0207676_11469625
718 Ga0207676_12100517
719 Ga0207674_10509491
720 Ga0207675_100968068
721 Ga0207683_10086015
722 Ga0207683_11600401
723 Ga0207698_10012451
724 Ga0207698_11913103
725 Ga0207698_12056843
726 Ga0209813_10005867
727 Ga0268266_10001223
728 Ga0268266_10055734
729 Ga0268266_10067126
730 Ga0268266_10537393
731 Ga0268266_10699927
732 Ga0268265_10001166
733 Ga0268265_10823087
734 Ga0268264_10000068
735 Ga0268264_10017092
736 Ga0268264_10142234
737 Ga0268264_12246688
738 Ga0307517_10002588
739 Ga0307517_10039630
740 Ga0307517_10178568
741 Ga0307511_10018131
742 Ga0307513_10000636
743 Ga0307513_10000793
744 Ga0307508_10654207
745 Ga0307510_10003534
746 Ga0373938_0216747
747 Ga0373960_0207012
748 Ga0373943_0028671
749 Ga0373946_0249556
750 Ga0373927_0012241
751 Ga0373925_0000089
752 Ga0373925_0414497
753 Ga0395899_0000052
754 Ga0395899_0472379
755 Ga0395900_0000002
756 Ga0395900_0964072
757 Ga0395898_0180706
758 Ga0395905_0006846
759 Ga0395905_0346955
760 Ga0395905_0720097
761 Ga0395905_0774548
762 Ga0436364_1214495
763 Ga0395901_0000013
764 Ga0395901_0543863
765 Ga0395901_1403668
766 Ga0436365_0523162
767 Ga0436365_0533422
768 Ga0439436_0087776
769 Ga0439442_025132
770 Ga0439445_0135226
771 Ga0466972_0223115
772 Ga0466965_0446941
773 Ga0466966_0311601
774 Ga0466964_0625198
775 Ga0466970_0392206
776 Ga0466957_0118975
777 Ga0466957_0277439
778 Ga0466957_0535946
779 Ga0466957_1245545
780 Ga0466958_1023586
781 Ga0495629_1059517
782 Ga0495585_0168168
783 Ga0495585_0407695
784 Ga0495585_0489078
785 Ga0495583_0082677
786 Ga0495583_0406347
787 Ga0495610_0114067
788 Ga0495620_0019961
789 Ga0495630_1304532
790 Ga0495643_0012690
791 Ga0495642_0003507
792 Ga0495642_0077647
793 Ga0495642_0164813
794 Ga0495654_0026010
795 Ga0495609_0025572
796 Ga0495621_0517817
797 Ga0495597_0005477
798 Ga0495645_0029919
799 Ga0495645_0588584
800 Ga0495622_0017724
801 Ga0495668_0066807
802 Ga0495668_0067818
803 Ga0495668_0104902
804 Ga0495668_0149627
805 Ga0495668_0232649
806 Ga0495668_0603532
807 Ga0495611_0348480
808 Ga0495625_0093264
809 Ga0495625_0204766
810 Ga0495625_0316698
811 Ga0495625_0709842
812 Ga0495599_0354748
813 Ga0495623_0162617
814 Ga0495669_0100724
815 Ga0495669_0183296
816 Ga0495669_0310259
817 Ga0495613_0974847
818 Ga0495624_0384521
819 Ga0495670_0757621
820 Ga0495672_0023154
821 Ga0495687_021135
822 Ga0495677_0055929
823 Ga0495673_0370052
824 Ga0495593_0305648
825 Ga0496100_0490046
826 Ga0496101_0383788
827 Ga0496102_0039098
828 Ga0496102_0128310
829 Ga0496102_1775903
830 Ga0496103_0064063
831 Ga0496103_0711348
832 Ga0496105_0731810
833 Ga0496106_0513778
834 Ga0496107_0490651
835 Ga0496107_1058279
836 Ga0496108_0082330
837 Ga0496108_0361097
838 Ga0496109_0046992
839 Ga0496110_0084808
840 Ga0496111_0399999
841 Ga0496112_0329446
842 Ga0496113_0389671
843 Ga0496113_1131389
844 Ga0496115_0000361
845 Ga0496115_0360209
846 Ga0496116_0267017
847 Ga0496117_0005537
848 Ga0496117_0245558
849 Ga0496118_0003871
850 Ga0496119_0026291
851 Ga0496120_0155274
852 Ga0496121_0000035
853 Ga0501032_0845491
854 Ga0501033_0167185
855 Ga0501036_1475328
856 Ga0501047_0008722
857 Ga0501047_0228636
858 Ga0501035_0644953
859 Ga0501044_0133373
860 nmdc:mga03683_257277_c1
861 nmdc:mga03n38_76936_c1
862 nmdc:mga00v17_426_c1
863 nmdc:mga0k408_33466_c1
864 nmdc:mga0k408_386755_c1
865 nmdc:mga06z11_3378_c1
866 nmdc:mga04h51_14964_c1
867 nmdc:mga07m45_1533_c1
868 nmdc:mga07m45_239151_c1
869 nmdc:mga07m45_364334_c1
870 Ga0500635_0000060
871 Ga0500578_0083504
872 Ga0500643_030949
873 Ga0500643_094445
874 Ga0500644_0325020
875 Ga0500646_0061184
876 Ga0500583_0039108
877 Ga0500651_0007983
878 Ga0500566_0123776
879 Ga0500641_0061064
880 Ga0500555_014354
881 Ga0500555_049047
882 Ga0500562_003278
883 Ga0500569_009107
884 Ga0500595_014993
885 Ga0500607_159715
886 Ga0500608_002690
887 Ga0500614_001981
888 Ga0500642_0184345
889 Ga0500658_0425929
890 Ga0500559_0325389
891 Ga0500559_0489706
892 Ga0500564_112675
893 Ga0500603_057481
894 Ga0500620_073140
895 Ga0500638_131461
896 Ga0500636_0004160
897 Ga0500637_0192055
898 Ga0500625_037689
899 Ga0500645_211257
900 Ga0500596_010399
901 Ga0500601_026576
902 Ga0501084_1523000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d2l-assembly1.cif.gz_A crystal structure of sam-dependent methyltransferase (zp_00538691.1) from exiguobacterium sp. 255-15 at 1.90 a resolution 0.8013 8 47
2xkl-assembly1.cif.gz_A-2 crystal structure of mouse apolipoprotein m 0.754 12 46
2vzv-assembly2.cif.gz_B substrate complex of amycolatopsis orientalis exo-chitosanase csxa e541a with chitosan 0.7511 10 32
3uc2-assembly3.cif.gz_C crystal structure of a duf4426 family protein (pa0388) from pseudomonas aeruginosa pao1 at 2.09 a resolution 0.7507 9 45
6dr9-assembly1.cif.gz_A crystal structure of the yoph ptp1b chimera 3 ptpase apo form 0.7457 10 47
ID Description Score Start End Superfamily
af_O62361_567_620_2.20.25.420 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ZPR1, zinc finger domain 0.8485 10 45 2.20.25.420
3d2lD02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;S-adenosyl-L-methionine-dependent methyltransferases 0.8196 9 47 2.20.25.110
af_A5Z2X0_902_1075_2.170.210.20 Mainly Beta;Beta Complex;Dna Repair Protein Xrcc4; Chain: A, domain 1;Spindle assembly abnormal protein 6, N-terminal domain 0.7885 12 45 2.170.210.20
af_Q553U9_108_208_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7812 7 45 2.40.128.20
af_I1J5E9_177_430_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7754 11 45 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A525JLI7-F1-model_v4 Uncharacterized protein 0.9794 1 85
AF-A0A7V9QQZ6-F1-model_v4 Type II secretion system protein GspI C-terminal domain-containing protein 0.8926 10 47
AF-A0A835AXI8-F1-model_v4 non-specific serine/threonine protein kinase (EC 2.7.11.1) 0.8634 10 45 GO:0004674
GO:0005524
AF-A0A4S8K529-F1-model_v4 non-specific serine/threonine protein kinase (EC 2.7.11.1) 0.8607 8 45 GO:0004674
GO:0005524
AF-A0A1H9RLI1-F1-model_v4 Uncharacterized protein 0.846 12 51 GO:0016020

Map