F446744

General Info

Members Datasets Scaffolds Average Seq Length
451 243 902 347

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100443755|Ga0070706_1004437551
Length 346
Sequence MIPSFRWFGTADPIPLAHIRQIPGVTGIVSALYDVPVGEAWSRARLSALKAQVEDAGLCLAVVESIPVHEDIKLGRPGRDRLIDNYGASIASMGELGIPVLCYNFMPVFDWTRTDLAMRLPDGSTALAYDDSALAAIDLSRGTGELPGWATAYSPAELQTLLAAYRHVDAEQLWDNLGYFLERVVPAAEQAGVRLALHPDDPPWPIFGLPRIITNARALERLVALVDSPANGVTFCTGSLGASPENDLPAMVRRLGERIHFAHCRNVRLTGERRFHETAHPSPCGSVDLFEVLRALKDVGFAGPMRPDHGRMIWGETGRPGYGLYDRALGVTYLQGLWEALSRSAT

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
176 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
177 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
178 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
216 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
217 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
218 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
219 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
220 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
221 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
222 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
223 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
226 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
227 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
228 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
229 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
242 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
243 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.67
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100443755 3300005467 Bacteria 1208
2 Ga0070658_10179261 3300005327 Bacteria 1782
3 Ga0070676_10007486 3300005328 Bacteria 5861
4 Ga0070683_100000662 3300005329 Bacteria 24891
5 Ga0070683_100005569 3300005329 Bacteria 10515
6 Ga0070690_100003026 3300005330 Bacteria 9120
7 Ga0070670_100154949 3300005331 Bacteria 1984
8 Ga0068869_100023006 3300005334 Bacteria 4298
9 Ga0070680_100020157 3300005336 Bacteria 5290
10 Ga0070680_100026333 3300005336 Bacteria 4651
11 Ga0070682_100012788 3300005337 Bacteria 4818
12 Ga0068868_100079955 3300005338 Bacteria 2619
13 Ga0070689_100028044 3300005340 Bacteria 4252
14 Ga0070687_100013085 3300005343 Bacteria 3685
15 Ga0070661_100005161 3300005344 Bacteria 8989
16 Ga0070661_100032556 3300005344 Bacteria 3774
17 Ga0070661_100040414 3300005344 Bacteria 3403
18 Ga0070692_10012241 3300005345 Bacteria 3964
19 Ga0070668_100009418 3300005347 Bacteria 7245
20 Ga0070668_100039222 3300005347 Bacteria 3622
21 Ga0070668_100135202 3300005347 Bacteria 1982
22 Ga0070669_100007050 3300005353 Bacteria 8076
23 Ga0070669_100018374 3300005353 Bacteria 4997
24 Ga0070669_100033684 3300005353 Bacteria 3706
25 Ga0070675_100005740 3300005354 Bacteria 9492
26 Ga0070675_100012018 3300005354 Bacteria 6786
27 Ga0070675_100038488 3300005354 Bacteria 3898
28 Ga0070675_100090168 3300005354 Bacteria 2567
29 Ga0070671_100120022 3300005355 Bacteria 2212
30 Ga0070671_100362175 3300005355 Bacteria 1238
31 Ga0070674_100028932 3300005356 Bacteria 3643
32 Ga0070673_100032789 3300005364 Bacteria 3915
33 Ga0070673_100108171 3300005364 Bacteria 2301
34 Ga0070673_100132609 3300005364 Bacteria 2093
35 Ga0070688_100004348 3300005365 Bacteria 7369
36 Ga0070688_100014297 3300005365 Bacteria 4495
37 Ga0070659_100001995 3300005366 Bacteria 14594
38 Ga0070659_100027019 3300005366 Bacteria 4419
39 Ga0070659_100033547 3300005366 Bacteria 3987
40 Ga0070667_100010909 3300005367 Bacteria 7515
41 Ga0070667_100034510 3300005367 Bacteria 4233
42 Ga0070703_10001613 3300005406 Bacteria 6706
43 Ga0070703_10035626 3300005406 Bacteria 1525
44 Ga0070709_10099778 3300005434 Unclassified 1932
45 Ga0070713_100007786 3300005436 Bacteria 7547
46 Ga0070701_10064103 3300005438 Bacteria 1946
47 Ga0070701_10065156 3300005438 Bacteria 1933
48 Ga0070711_100002508 3300005439 Bacteria 10485
49 Ga0070705_100004441 3300005440 Bacteria 6828
50 Ga0070700_100013496 3300005441 Bacteria 4589
51 Ga0070708_100000065 3300005445 Bacteria 69306
52 Ga0070708_100038827 3300005445 Bacteria 4163
53 Ga0070663_100020590 3300005455 Bacteria 4368
54 Ga0070678_100219889 3300005456 Bacteria 1578
55 Ga0070662_100005802 3300005457 Bacteria 7915
56 Ga0070662_100114124 3300005457 Bacteria 2062
57 Ga0070662_100175760 3300005457 Bacteria 1685
58 Ga0070681_10000813 3300005458 Bacteria 26076
59 Ga0070681_10018415 3300005458 Bacteria 6980
60 Ga0070681_10179439 3300005458 Bacteria 2039
61 Ga0070681_10249732 3300005458 Bacteria 1687
62 Ga0068867_100062668 3300005459 Bacteria 2763
63 Ga0070685_10010741 3300005466 Bacteria 4767
64 Ga0070685_10083549 3300005466 Bacteria 1918
65 Ga0070706_100009410 3300005467 Bacteria 9097
66 Ga0070706_100037545 3300005467 Bacteria 4474
67 Ga0070706_100111223 3300005467 Bacteria 2549
68 Ga0070706_100163188 3300005467 Bacteria 2080
69 Ga0070707_100016538 3300005468 Bacteria 6924
70 Ga0070707_100026817 3300005468 Bacteria 5474
71 Ga0070707_100062051 3300005468 Bacteria 3585
72 Ga0070707_100127462 3300005468 Bacteria 2473
73 Ga0070707_100131881 3300005468 Bacteria 2430
74 Ga0070707_100268270 3300005468 Bacteria 1660
75 Ga0070698_100026130 3300005471 Bacteria 6080
76 Ga0070698_100082634 3300005471 Bacteria 3204
77 Ga0070698_100443112 3300005471 Unclassified 1234
78 Ga0070699_100010009 3300005518 Bacteria 8206
79 Ga0070699_100011978 3300005518 Bacteria 7486
80 Ga0070699_100032085 3300005518 Bacteria 4536
81 Ga0070699_100036488 3300005518 Bacteria 4253
82 Ga0070699_100079125 3300005518 Bacteria 2863
83 Ga0070699_100237406 3300005518 Unclassified 1626
84 Ga0070679_100000532 3300005530 Bacteria 32393
85 Ga0070679_100003366 3300005530 Bacteria 14650
86 Ga0070679_100077442 3300005530 Bacteria 3314
87 Ga0070684_100008148 3300005535 Bacteria 8180
88 Ga0070684_100014784 3300005535 Bacteria 6333
89 Ga0070684_100033489 3300005535 Bacteria 4387
90 Ga0070684_100087174 3300005535 Bacteria 2771
91 Ga0070684_100171186 3300005535 Bacteria 1972
92 Ga0070684_100178821 3300005535 Bacteria 1928
93 Ga0070697_100003514 3300005536 Bacteria 12039
94 Ga0070697_100008187 3300005536 Bacteria 8161
95 Ga0070697_100109027 3300005536 Bacteria 2305
96 Ga0070697_100145529 3300005536 Bacteria 1994
97 Ga0070697_100163820 3300005536 Bacteria 1879
98 Ga0068853_100014803 3300005539 Bacteria 6401
99 Ga0068853_100082320 3300005539 Bacteria 2819
100 Ga0070672_100015428 3300005543 Bacteria 5440
101 Ga0070672_100047879 3300005543 Bacteria 3319
102 Ga0070672_100053490 3300005543 Bacteria 3157
103 Ga0070672_100078850 3300005543 Bacteria 2636
104 Ga0070695_100004062 3300005545 Bacteria 8566
105 Ga0070696_100000410 3300005546 Bacteria 26702
106 Ga0070696_100003064 3300005546 Bacteria 11101
107 Ga0070696_100008525 3300005546 Bacteria 6862
108 Ga0070696_100024780 3300005546 Bacteria 4077
109 Ga0070696_100030077 3300005546 Bacteria 3716
110 Ga0070696_100122671 3300005546 Bacteria 1882
111 Ga0070693_100005765 3300005547 Bacteria 5984
112 Ga0070665_100062313 3300005548 Bacteria 3740
113 Ga0070704_100006878 3300005549 Bacteria 6737
114 Ga0070664_100034527 3300005564 Bacteria 4243
115 Ga0070664_100050761 3300005564 Bacteria 3511
116 Ga0070664_100058225 3300005564 Bacteria 3286
117 Ga0070664_100091686 3300005564 Bacteria 2630
118 Ga0070664_100097557 3300005564 Bacteria 2551
119 Ga0070664_100102475 3300005564 Bacteria 2490
120 Ga0070664_100150265 3300005564 Bacteria 2056
121 Ga0070664_100171225 3300005564 Bacteria 1926
122 Ga0068857_100006526 3300005577 Bacteria 10007
123 Ga0068857_100006900 3300005577 Bacteria 9778
124 Ga0068857_100016607 3300005577 Bacteria 6448
125 Ga0068857_100070997 3300005577 Bacteria 3102
126 Ga0068857_100186152 3300005577 Bacteria 1890
127 Ga0068854_100149458 3300005578 Bacteria 1800
128 Ga0068856_100002535 3300005614 Bacteria 18828
129 Ga0068856_100010733 3300005614 Bacteria 8899
130 Ga0068852_100003933 3300005616 Bacteria 10441
131 Ga0068859_100014205 3300005617 Bacteria 7985
132 Ga0068859_100036309 3300005617 Bacteria 4947
133 Ga0068859_100226552 3300005617 Bacteria 1957
134 Ga0068859_100431466 3300005617 Bacteria 1414
135 Ga0068864_100009448 3300005618 Bacteria 8048
136 Ga0068864_100016193 3300005618 Bacteria 6206
137 Ga0068861_100013453 3300005719 Bacteria 5727
138 Ga0068851_10005319 3300005834 Bacteria 5844
139 Ga0068851_10010584 3300005834 Bacteria 4307
140 Ga0068851_10067947 3300005834 Bacteria 1839
141 Ga0068863_100008205 3300005841 Bacteria 10206
142 Ga0068863_100028350 3300005841 Bacteria 5346
143 Ga0068858_100020145 3300005842 Bacteria 6237
144 Ga0068858_100038357 3300005842 Bacteria 4444
145 Ga0068860_100016229 3300005843 Bacteria 7261
146 Ga0068860_100022419 3300005843 Bacteria 6107
147 Ga0068860_100065589 3300005843 Bacteria 3448
148 Ga0068860_100330487 3300005843 Bacteria 1497
149 Ga0068862_100001097 3300005844 Bacteria 25721
150 Ga0097621_100025395 3300006237 Bacteria 4636
151 Ga0097621_100291461 3300006237 Bacteria 1439
152 Ga0068871_100049363 3300006358 Bacteria 3401
153 Ga0068871_100139744 3300006358 Bacteria 2059
154 Ga0075428_100025522 3300006844 Bacteria 6543
155 Ga0075428_100046482 3300006844 Bacteria 4768
156 Ga0075428_100112912 3300006844 Bacteria 2960
157 Ga0075430_100011114 3300006846 Bacteria 7632
158 Ga0075430_100096411 3300006846 Bacteria 2472
159 Ga0075431_100014144 3300006847 Bacteria 8068
160 Ga0075431_100035815 3300006847 Bacteria 5110
161 Ga0075431_100046221 3300006847 Bacteria 4488
162 Ga0075431_100052572 3300006847 Bacteria 4201
163 Ga0075433_10002947 3300006852 Bacteria 13060
164 Ga0075433_10108801 3300006852 Bacteria 2459
165 Ga0075434_100004080 3300006871 Bacteria 13089
166 Ga0075434_100049507 3300006871 Bacteria 4172
167 Ga0075434_100052297 3300006871 Bacteria 4058
168 Ga0075434_100233433 3300006871 Bacteria 1859
169 Ga0075434_100361830 3300006871 Bacteria 1472
170 Ga0075429_100000160 3300006880 Bacteria 42594
171 Ga0075429_100203828 3300006880 Bacteria 1733
172 Ga0068865_100017889 3300006881 Bacteria 4565
173 Ga0068865_100018038 3300006881 Bacteria 4549
174 Ga0075436_100026445 3300006914 Bacteria 3995
175 Ga0075436_100027623 3300006914 Bacteria 3905
176 Ga0075436_100063319 3300006914 Bacteria 2556
177 Ga0097620_100014205 3300006931 Bacteria 7985
178 Ga0097620_100036311 3300006931 Bacteria 4947
179 Ga0097620_100226538 3300006931 Bacteria 1957
180 Ga0097620_100431464 3300006931 Bacteria 1414
181 Ga0075435_100006804 3300007076 Bacteria 8114
182 Ga0075435_100023017 3300007076 Bacteria 4811
183 Ga0075435_100237280 3300007076 Bacteria 1550
184 Ga0099794_10044644 3300007265 Bacteria 2118
185 Ga0111539_10259461 3300009094 Bacteria 2023
186 Ga0105245_10015835 3300009098 Bacteria 6569
187 Ga0105245_10082318 3300009098 Bacteria 2944
188 Ga0114129_10021844 3300009147 Bacteria 9084
189 Ga0114129_10042654 3300009147 Bacteria 6385
190 Ga0105243_10148869 3300009148 Bacteria 2006
191 Ga0105243_10387105 3300009148 Bacteria 1295
192 Ga0105242_10004391 3300009176 Bacteria 10971
193 Ga0105242_10017860 3300009176 Bacteria 5536
194 Ga0105242_10094599 3300009176 Bacteria 2521
195 Ga0105248_10016020 3300009177 Bacteria 8251
196 Ga0105248_10053452 3300009177 Bacteria 4532
197 Ga0105248_10268825 3300009177 Bacteria 1920
198 Ga0105248_10311376 3300009177 Bacteria 1773
199 Ga0105248_10385044 3300009177 Bacteria 1579
200 Ga0105248_10523524 3300009177 Bacteria 1337
201 Ga0105237_10121836 3300009545 Bacteria 2603
202 Ga0105238_10025648 3300009551 Bacteria 6008
203 Ga0105249_10022289 3300009553 Bacteria 5674
204 Ga0105249_10060670 3300009553 Bacteria 3470
205 Ga0105249_10110451 3300009553 Bacteria 2598
206 Ga0105239_10029464 3300010375 Bacteria 6035
207 Ga0105239_10055102 3300010375 Bacteria 4361
208 Ga0105246_10012881 3300011119 Bacteria 5232
209 Ga0157371_10063558 3300013102 Bacteria 2616
210 Ga0157370_10002776 3300013104 Bacteria 20926
211 Ga0157370_10150719 3300013104 Bacteria 2164
212 Ga0157369_10156608 3300013105 Bacteria 2406
213 Ga0163162_10022093 3300013306 Bacteria 6269
214 Ga0163162_10106710 3300013306 Bacteria 2896
215 Ga0157372_10016839 3300013307 Bacteria 7847
216 Ga0157372_10033849 3300013307 Bacteria 5615
217 Ga0157372_10166559 3300013307 Bacteria 2549
218 Ga0157375_10009997 3300013308 Bacteria 8340
219 Ga0157375_10043484 3300013308 Bacteria 4358
220 Ga0157375_10261554 3300013308 Bacteria 1892
221 Ga0157375_10312880 3300013308 Bacteria 1735
222 Ga0163163_10051022 3300014325 Bacteria 4077
223 Ga0157380_10016449 3300014326 Bacteria 5456
224 Ga0157380_10136290 3300014326 Bacteria 2102
225 Ga0157377_10001808 3300014745 Bacteria 9325
226 Ga0157379_10005544 3300014968 Bacteria 10845
227 Ga0157376_10021237 3300014969 Bacteria 5041
228 Ga0209025_1020219 3300025294 Bacteria 3652
229 Ga0207653_10000220 3300025885 Bacteria 37988
230 Ga0207653_10028702 3300025885 Bacteria 1790
231 Ga0207682_10041153 3300025893 Bacteria 1885
232 Ga0207682_10041222 3300025893 Bacteria 1884
233 Ga0207682_10074048 3300025893 Bacteria 1447
234 Ga0207645_10003593 3300025907 Bacteria 11735
235 Ga0207643_10006762 3300025908 Bacteria 6150
236 Ga0207643_10026198 3300025908 Bacteria 3227
237 Ga0207705_10051421 3300025909 Bacteria 2965
238 Ga0207684_10129047 3300025910 Bacteria 2170
239 Ga0207684_10209164 3300025910 Bacteria 1683
240 Ga0207684_10256820 3300025910 Bacteria 1508
241 Ga0207707_10004719 3300025912 Bacteria 11954
242 Ga0207707_10045797 3300025912 Bacteria 3811
243 Ga0207707_10093976 3300025912 Bacteria 2620
244 Ga0207707_10272802 3300025912 Bacteria 1466
245 Ga0207671_10226729 3300025914 Bacteria 1465
246 Ga0207663_10124129 3300025916 Bacteria 1773
247 Ga0207660_10088206 3300025917 Bacteria 2294
248 Ga0207662_10001709 3300025918 Bacteria 10752
249 Ga0207662_10002782 3300025918 Bacteria 8846
250 Ga0207657_10020093 3300025919 Bacteria 6323
251 Ga0207657_10023439 3300025919 Bacteria 5747
252 Ga0207657_10033757 3300025919 Bacteria 4609
253 Ga0207649_10035738 3300025920 Bacteria 2988
254 Ga0207649_10041072 3300025920 Bacteria 2814
255 Ga0207649_10097765 3300025920 Bacteria 1936
256 Ga0207652_10000516 3300025921 Bacteria 39166
257 Ga0207652_10015891 3300025921 Bacteria 6133
258 Ga0207646_10008077 3300025922 Bacteria 10610
259 Ga0207646_10034685 3300025922 Bacteria 4561
260 Ga0207646_10264773 3300025922 Bacteria 1554
261 Ga0207681_10003699 3300025923 Bacteria 9499
262 Ga0207650_10005282 3300025925 Bacteria 8809
263 Ga0207650_10006534 3300025925 Bacteria 7951
264 Ga0207659_10008933 3300025926 Bacteria 6246
265 Ga0207659_10036625 3300025926 Bacteria 3400
266 Ga0207687_10008791 3300025927 Bacteria 6602
267 Ga0207700_10119242 3300025928 Bacteria 2136
268 Ga0207644_10251567 3300025931 Bacteria 1410
269 Ga0207690_10008426 3300025932 Bacteria 6121
270 Ga0207690_10163303 3300025932 Bacteria 1662
271 Ga0207706_10002334 3300025933 Bacteria 18527
272 Ga0207706_10011532 3300025933 Bacteria 8049
273 Ga0207706_10033627 3300025933 Bacteria 4562
274 Ga0207686_10032773 3300025934 Bacteria 3095
275 Ga0207686_10113482 3300025934 Bacteria 1832
276 Ga0207709_10088960 3300025935 Bacteria 2012
277 Ga0207670_10048480 3300025936 Bacteria 2835
278 Ga0207670_10129338 3300025936 Bacteria 1847
279 Ga0207669_10165971 3300025937 Bacteria 1566
280 Ga0207691_10006069 3300025940 Bacteria 11673
281 Ga0207691_10033541 3300025940 Bacteria 4779
282 Ga0207691_10043168 3300025940 Bacteria 4156
283 Ga0207691_10153218 3300025940 Bacteria 2026
284 Ga0207711_10070286 3300025941 Bacteria 3036
285 Ga0207689_10002340 3300025942 Bacteria 17720
286 Ga0207689_10005545 3300025942 Bacteria 11269
287 Ga0207661_10025582 3300025944 Bacteria 4488
288 Ga0207661_10116107 3300025944 Bacteria 2272
289 Ga0207661_10117269 3300025944 Bacteria 2261
290 Ga0207679_10001560 3300025945 Bacteria 14340
291 Ga0207679_10002839 3300025945 Bacteria 10738
292 Ga0207679_10087581 3300025945 Bacteria 2398
293 Ga0207679_10141169 3300025945 Bacteria 1947
294 Ga0207667_10016727 3300025949 Bacteria 8275
295 Ga0207712_10010813 3300025961 Bacteria 5806
296 Ga0207712_10019855 3300025961 Bacteria 4393
297 Ga0207712_10056841 3300025961 Bacteria 2758
298 Ga0207668_10166174 3300025972 Bacteria 1725
299 Ga0207640_10070739 3300025981 Bacteria 2348
300 Ga0207658_10045402 3300025986 Bacteria 3203
301 Ga0207658_10050051 3300025986 Bacteria 3073
302 Ga0207658_10102646 3300025986 Bacteria 2243
303 Ga0207677_10012368 3300026023 Bacteria 4904
304 Ga0207677_10193198 3300026023 Bacteria 1611
305 Ga0207677_10261711 3300026023 Bacteria 1410
306 Ga0207703_10011083 3300026035 Bacteria 7023
307 Ga0207639_10314387 3300026041 Bacteria 1389
308 Ga0207708_10009943 3300026075 Bacteria 7063
309 Ga0207708_10102124 3300026075 Bacteria 2220
310 Ga0207702_10186635 3300026078 Bacteria 1913
311 Ga0207648_10007649 3300026089 Bacteria 10578
312 Ga0207648_10024258 3300026089 Bacteria 5417
313 Ga0207648_10047061 3300026089 Bacteria 3781
314 Ga0207676_10011959 3300026095 Bacteria 6211
315 Ga0207676_10021606 3300026095 Bacteria 4723
316 Ga0207676_10070151 3300026095 Bacteria 2809
317 Ga0207674_10001065 3300026116 Bacteria 35676
318 Ga0207674_10008134 3300026116 Bacteria 12158
319 Ga0207674_10009081 3300026116 Bacteria 11414
320 Ga0207674_10020471 3300026116 Bacteria 7147
321 Ga0207674_10042986 3300026116 Bacteria 4662
322 Ga0207675_100001703 3300026118 Bacteria 22024
323 Ga0207683_10211309 3300026121 Bacteria 1766
324 Ga0207683_10245464 3300026121 Bacteria 1633
325 Ga0207698_10144054 3300026142 Bacteria 2058
326 Ga0209371_1002012 3300027312 Bacteria 12216
327 Ga0209969_1002033 3300027360 Bacteria 2789
328 Ga0209995_1004880 3300027471 Bacteria 2153
329 Ga0209588_1000214 3300027671 Bacteria 15625
330 Ga0209966_1000545 3300027695 Bacteria 9478
331 Ga0209998_10000246 3300027717 Bacteria 17773
332 Ga0209974_10083003 3300027876 Bacteria 1105
333 Ga0268266_10132574 3300028379 Bacteria 2230
334 Ga0268265_10088618 3300028380 Bacteria 2466
335 Ga0268264_10015843 3300028381 Bacteria 6172
336 Ga0268256_1001763 3300030500 Bacteria 12216
337 Ga0307405_10099200 3300031731 Bacteria 1949
338 Ga0307413_10080481 3300031824 Bacteria 2086
339 Ga0307410_10082919 3300031852 Bacteria 2256
340 Ga0307410_10109289 3300031852 Bacteria 1998
341 Ga0307406_10063477 3300031901 Bacteria 2393
342 Ga0307407_10032645 3300031903 Unclassified 2833
343 Ga0307409_100006267 3300031995 Bacteria 6967
344 Ga0307409_100018393 3300031995 Bacteria 4697
345 Ga0307416_100039547 3300032002 Bacteria 3653
346 Ga0307416_100358248 3300032002 Bacteria 1480
347 Ga0373955_0002453 3300035172 Bacteria 8098
348 Ga0373931_0003457 3300035691 Bacteria 7093
349 Ga0373927_0002113 3300035695 Bacteria 14649
350 Ga0373947_0280305 3300035725 Bacteria 1108
351 Ga0373937_0000606 3300036401 Bacteria 31681
352 Ga0395899_0002363 3300037312 Bacteria 15358
353 Ga0395900_0003812 3300037418 Bacteria 16122
354 Ga0395905_0017086 3300037471 Bacteria 6890
355 Ga0395905_0022404 3300037471 Bacteria 5975
356 Ga0395901_0003789 3300038443 Bacteria 15226
357 Ga0400484_16757 3300038725 Bacteria 10295
358 Ga0400490_14639 3300038726 Bacteria 23628
359 Ga0400491_29683 3300038727 Bacteria 4746
360 Ga0400489_86273 3300039093 Bacteria 29159
361 Ga0436365_1585044 3300039437 Bacteria 20064
362 Ga0436365_1698337 3300039437 Bacteria 3223
363 Ga0451577_0246571 3300042876 Bacteria 1617
364 Ga0451576_0032746 3300045051 Bacteria 5528
365 Ga0451576_0145245 3300045051 Bacteria 2473
366 Ga0451576_0168474 3300045051 Bacteria 2286
367 Ga0451576_0456383 3300045051 Bacteria 1342
368 Ga0495629_0010846 3300046459 Bacteria 6626
369 Ga0495580_0046780 3300046472 Bacteria 3069
370 Ga0495582_0004313 3300046473 Bacteria 7997
371 Ga0495664_0081203 3300046477 Bacteria 1944
372 Ga0495596_0099500 3300046500 Bacteria 1129
373 Ga0495652_0039458 3300046529 Bacteria 4083
374 Ga0495654_0017766 3300046530 Bacteria 3733
375 Ga0495665_0073211 3300046531 Bacteria 1804
376 Ga0495587_0012467 3300046536 Bacteria 5350
377 Ga0495609_0069788 3300046538 Bacteria 1545
378 Ga0495645_0001044 3300046543 Bacteria 18880
379 Ga0495622_0082115 3300046557 Bacteria 1483
380 Ga0495667_0004217 3300046559 Bacteria 9688
381 Ga0495667_0127875 3300046559 Bacteria 1639
382 Ga0495661_0044783 3300046665 Bacteria 2710
383 Ga0495599_0001384 3300046678 Bacteria 13860
384 Ga0495646_0061222 3300046680 Bacteria 2242
385 Ga0495658_0126998 3300046683 Bacteria 1549
386 Ga0495613_0016053 3300046689 Bacteria 5575
387 Ga0495624_0105850 3300046690 Bacteria 1731
388 Ga0495600_0229519 3300046809 Bacteria 1185
389 Ga0495581_0005408 3300047315 Bacteria 7389
390 Ga0495672_0001552 3300047320 Bacteria 22470
391 Ga0496109_0029318 3300048912 Bacteria 4929
392 Ga0496110_0341373 3300048913 Bacteria 1364
393 Ga0496113_0069003 3300048916 Bacteria 2684
394 Ga0501032_0065769 3300049569 Bacteria 2424
395 Ga0501032_0101243 3300049569 Bacteria 1909
396 Ga0501033_0106637 3300049570 Bacteria 2041
397 Ga0501033_0247256 3300049570 Bacteria 1265
398 Ga0501034_0092539 3300049571 Bacteria 3020
399 Ga0501034_0434476 3300049571 Bacteria 1232
400 Ga0501038_0110427 3300049574 Bacteria 2279
401 Ga0501043_0008960 3300049579 Bacteria 7874
402 Ga0501043_0175633 3300049579 Bacteria 1670
403 Ga0501046_0033474 3300049580 Bacteria 4152
404 Ga0501047_0000589 3300049581 Bacteria 38644
405 Ga0501047_0124675 3300049581 Bacteria 2456
406 Ga0501047_0357808 3300049581 Bacteria 1296
407 Ga0501070_0046836 3300049586 Bacteria 3596
408 Ga0501202_000018 3300049652 Bacteria 17871
409 Ga0501224_000982 3300049664 Bacteria 3695
410 Ga0501233_001745 3300049668 Bacteria 3749
411 Ga0501235_000038 3300049669 Bacteria 21031
412 Ga0501243_002068 3300049675 Bacteria 2917
413 Ga0501250_000765 3300049680 Bacteria 2360
414 Ga0501257_003055 3300049686 Bacteria 3563
415 Ga0501259_001304 3300049688 Bacteria 4170
416 Ga0501261_001451 3300049690 Bacteria 2911
417 Ga0501225_0000491 3300049705 Bacteria 12318
418 Ga0501229_001655 3300049706 Bacteria 2606
419 Ga0501234_000564 3300049707 Bacteria 5657
420 Ga0501267_002795 3300049764 Bacteria 1563
421 Ga0501268_000193 3300049765 Bacteria 5785
422 Ga0501274_001684 3300049771 Bacteria 1696
423 Ga0501035_0001319 3300049822 Bacteria 25605
424 Ga0501044_0011401 3300049823 Bacteria 9628
425 nmdc:mga05p37_6571_c1 3300050507 Bacteria 13704
426 nmdc:mga05p37_680715_c1 3300050507 Bacteria 1146
427 nmdc:mga09592_3667_c1 3300050508 Bacteria 12375
428 nmdc:mga0qj67_129662_c1 3300050509 Bacteria 2042
429 nmdc:mga0qj67_26762_c1 3300050509 Bacteria 4466
430 nmdc:mga0qj67_75759_c1 3300050509 Bacteria 2690
431 nmdc:mga06r32_46419_c2 3300050510 Bacteria 2627
432 nmdc:mga06r32_61601_c1 3300050510 Bacteria 3612
433 nmdc:mga06r32_70836_c1 3300050510 Bacteria 3373
434 nmdc:mga08y16_92077_c1 3300050511 Bacteria 3159
435 nmdc:mga0n895_129607_c1 3300050512 Bacteria 2547
436 nmdc:mga0n895_226208_c1 3300050512 Bacteria 1899
437 nmdc:mga0n895_371056_c1 3300050512 Bacteria 1449
438 nmdc:mga0n895_52012_c1 3300050512 Bacteria 4020
439 nmdc:mga0rr50_167357_c1 3300050513 Bacteria 1788
440 nmdc:mga0rr50_240745_c1 3300050513 Bacteria 1500
441 nmdc:mga0rr50_26934_c1 3300050513 Bacteria 4019
442 nmdc:mga0rr50_293212_c1 3300050513 Bacteria 1360
443 nmdc:mga0rr50_84251_c1 3300050513 Bacteria 2461
444 nmdc:mga08x19_10285_c1 3300050514 Bacteria 5615
445 nmdc:mga0a205_11611_c2 3300050515 Bacteria 2264
446 nmdc:mga0a205_16290_c1 3300050515 Bacteria 6960
447 nmdc:mga0a205_171178_c1 3300050515 Bacteria 2068
448 nmdc:mga0a205_73670_c1 3300050515 Bacteria 3299
449 2888583933 2888578766 Bacteria 6743310
450 2889053622 2889049205 Bacteria 7524325
451 8007378429 8007375930 Bacteria 4080554
452 Ga0070706_100443755
453 Ga0070658_10179261
454 Ga0070676_10007486
455 Ga0070683_100000662
456 Ga0070683_100005569
457 Ga0070690_100003026
458 Ga0070670_100154949
459 Ga0068869_100023006
460 Ga0070680_100020157
461 Ga0070680_100026333
462 Ga0070682_100012788
463 Ga0068868_100079955
464 Ga0070689_100028044
465 Ga0070687_100013085
466 Ga0070661_100005161
467 Ga0070661_100032556
468 Ga0070661_100040414
469 Ga0070692_10012241
470 Ga0070668_100009418
471 Ga0070668_100039222
472 Ga0070668_100135202
473 Ga0070669_100007050
474 Ga0070669_100018374
475 Ga0070669_100033684
476 Ga0070675_100005740
477 Ga0070675_100012018
478 Ga0070675_100038488
479 Ga0070675_100090168
480 Ga0070671_100120022
481 Ga0070671_100362175
482 Ga0070674_100028932
483 Ga0070673_100032789
484 Ga0070673_100108171
485 Ga0070673_100132609
486 Ga0070688_100004348
487 Ga0070688_100014297
488 Ga0070659_100001995
489 Ga0070659_100027019
490 Ga0070659_100033547
491 Ga0070667_100010909
492 Ga0070667_100034510
493 Ga0070703_10001613
494 Ga0070703_10035626
495 Ga0070709_10099778
496 Ga0070713_100007786
497 Ga0070701_10064103
498 Ga0070701_10065156
499 Ga0070711_100002508
500 Ga0070705_100004441
501 Ga0070700_100013496
502 Ga0070708_100000065
503 Ga0070708_100038827
504 Ga0070663_100020590
505 Ga0070678_100219889
506 Ga0070662_100005802
507 Ga0070662_100114124
508 Ga0070662_100175760
509 Ga0070681_10000813
510 Ga0070681_10018415
511 Ga0070681_10179439
512 Ga0070681_10249732
513 Ga0068867_100062668
514 Ga0070685_10010741
515 Ga0070685_10083549
516 Ga0070706_100009410
517 Ga0070706_100037545
518 Ga0070706_100111223
519 Ga0070706_100163188
520 Ga0070707_100016538
521 Ga0070707_100026817
522 Ga0070707_100062051
523 Ga0070707_100127462
524 Ga0070707_100131881
525 Ga0070707_100268270
526 Ga0070698_100026130
527 Ga0070698_100082634
528 Ga0070698_100443112
529 Ga0070699_100010009
530 Ga0070699_100011978
531 Ga0070699_100032085
532 Ga0070699_100036488
533 Ga0070699_100079125
534 Ga0070699_100237406
535 Ga0070679_100000532
536 Ga0070679_100003366
537 Ga0070679_100077442
538 Ga0070684_100008148
539 Ga0070684_100014784
540 Ga0070684_100033489
541 Ga0070684_100087174
542 Ga0070684_100171186
543 Ga0070684_100178821
544 Ga0070697_100003514
545 Ga0070697_100008187
546 Ga0070697_100109027
547 Ga0070697_100145529
548 Ga0070697_100163820
549 Ga0068853_100014803
550 Ga0068853_100082320
551 Ga0070672_100015428
552 Ga0070672_100047879
553 Ga0070672_100053490
554 Ga0070672_100078850
555 Ga0070695_100004062
556 Ga0070696_100000410
557 Ga0070696_100003064
558 Ga0070696_100008525
559 Ga0070696_100024780
560 Ga0070696_100030077
561 Ga0070696_100122671
562 Ga0070693_100005765
563 Ga0070665_100062313
564 Ga0070704_100006878
565 Ga0070664_100034527
566 Ga0070664_100050761
567 Ga0070664_100058225
568 Ga0070664_100091686
569 Ga0070664_100097557
570 Ga0070664_100102475
571 Ga0070664_100150265
572 Ga0070664_100171225
573 Ga0068857_100006526
574 Ga0068857_100006900
575 Ga0068857_100016607
576 Ga0068857_100070997
577 Ga0068857_100186152
578 Ga0068854_100149458
579 Ga0068856_100002535
580 Ga0068856_100010733
581 Ga0068852_100003933
582 Ga0068859_100014205
583 Ga0068859_100036309
584 Ga0068859_100226552
585 Ga0068859_100431466
586 Ga0068864_100009448
587 Ga0068864_100016193
588 Ga0068861_100013453
589 Ga0068851_10005319
590 Ga0068851_10010584
591 Ga0068851_10067947
592 Ga0068863_100008205
593 Ga0068863_100028350
594 Ga0068858_100020145
595 Ga0068858_100038357
596 Ga0068860_100016229
597 Ga0068860_100022419
598 Ga0068860_100065589
599 Ga0068860_100330487
600 Ga0068862_100001097
601 Ga0097621_100025395
602 Ga0097621_100291461
603 Ga0068871_100049363
604 Ga0068871_100139744
605 Ga0075428_100025522
606 Ga0075428_100046482
607 Ga0075428_100112912
608 Ga0075430_100011114
609 Ga0075430_100096411
610 Ga0075431_100014144
611 Ga0075431_100035815
612 Ga0075431_100046221
613 Ga0075431_100052572
614 Ga0075433_10002947
615 Ga0075433_10108801
616 Ga0075434_100004080
617 Ga0075434_100049507
618 Ga0075434_100052297
619 Ga0075434_100233433
620 Ga0075434_100361830
621 Ga0075429_100000160
622 Ga0075429_100203828
623 Ga0068865_100017889
624 Ga0068865_100018038
625 Ga0075436_100026445
626 Ga0075436_100027623
627 Ga0075436_100063319
628 Ga0097620_100014205
629 Ga0097620_100036311
630 Ga0097620_100226538
631 Ga0097620_100431464
632 Ga0075435_100006804
633 Ga0075435_100023017
634 Ga0075435_100237280
635 Ga0099794_10044644
636 Ga0111539_10259461
637 Ga0105245_10015835
638 Ga0105245_10082318
639 Ga0114129_10021844
640 Ga0114129_10042654
641 Ga0105243_10148869
642 Ga0105243_10387105
643 Ga0105242_10004391
644 Ga0105242_10017860
645 Ga0105242_10094599
646 Ga0105248_10016020
647 Ga0105248_10053452
648 Ga0105248_10268825
649 Ga0105248_10311376
650 Ga0105248_10385044
651 Ga0105248_10523524
652 Ga0105237_10121836
653 Ga0105238_10025648
654 Ga0105249_10022289
655 Ga0105249_10060670
656 Ga0105249_10110451
657 Ga0105239_10029464
658 Ga0105239_10055102
659 Ga0105246_10012881
660 Ga0157371_10063558
661 Ga0157370_10002776
662 Ga0157370_10150719
663 Ga0157369_10156608
664 Ga0163162_10022093
665 Ga0163162_10106710
666 Ga0157372_10016839
667 Ga0157372_10033849
668 Ga0157372_10166559
669 Ga0157375_10009997
670 Ga0157375_10043484
671 Ga0157375_10261554
672 Ga0157375_10312880
673 Ga0163163_10051022
674 Ga0157380_10016449
675 Ga0157380_10136290
676 Ga0157377_10001808
677 Ga0157379_10005544
678 Ga0157376_10021237
679 Ga0209025_1020219
680 Ga0207653_10000220
681 Ga0207653_10028702
682 Ga0207682_10041153
683 Ga0207682_10041222
684 Ga0207682_10074048
685 Ga0207645_10003593
686 Ga0207643_10006762
687 Ga0207643_10026198
688 Ga0207705_10051421
689 Ga0207684_10129047
690 Ga0207684_10209164
691 Ga0207684_10256820
692 Ga0207707_10004719
693 Ga0207707_10045797
694 Ga0207707_10093976
695 Ga0207707_10272802
696 Ga0207671_10226729
697 Ga0207663_10124129
698 Ga0207660_10088206
699 Ga0207662_10001709
700 Ga0207662_10002782
701 Ga0207657_10020093
702 Ga0207657_10023439
703 Ga0207657_10033757
704 Ga0207649_10035738
705 Ga0207649_10041072
706 Ga0207649_10097765
707 Ga0207652_10000516
708 Ga0207652_10015891
709 Ga0207646_10008077
710 Ga0207646_10034685
711 Ga0207646_10264773
712 Ga0207681_10003699
713 Ga0207650_10005282
714 Ga0207650_10006534
715 Ga0207659_10008933
716 Ga0207659_10036625
717 Ga0207687_10008791
718 Ga0207700_10119242
719 Ga0207644_10251567
720 Ga0207690_10008426
721 Ga0207690_10163303
722 Ga0207706_10002334
723 Ga0207706_10011532
724 Ga0207706_10033627
725 Ga0207686_10032773
726 Ga0207686_10113482
727 Ga0207709_10088960
728 Ga0207670_10048480
729 Ga0207670_10129338
730 Ga0207669_10165971
731 Ga0207691_10006069
732 Ga0207691_10033541
733 Ga0207691_10043168
734 Ga0207691_10153218
735 Ga0207711_10070286
736 Ga0207689_10002340
737 Ga0207689_10005545
738 Ga0207661_10025582
739 Ga0207661_10116107
740 Ga0207661_10117269
741 Ga0207679_10001560
742 Ga0207679_10002839
743 Ga0207679_10087581
744 Ga0207679_10141169
745 Ga0207667_10016727
746 Ga0207712_10010813
747 Ga0207712_10019855
748 Ga0207712_10056841
749 Ga0207668_10166174
750 Ga0207640_10070739
751 Ga0207658_10045402
752 Ga0207658_10050051
753 Ga0207658_10102646
754 Ga0207677_10012368
755 Ga0207677_10193198
756 Ga0207677_10261711
757 Ga0207703_10011083
758 Ga0207639_10314387
759 Ga0207708_10009943
760 Ga0207708_10102124
761 Ga0207702_10186635
762 Ga0207648_10007649
763 Ga0207648_10024258
764 Ga0207648_10047061
765 Ga0207676_10011959
766 Ga0207676_10021606
767 Ga0207676_10070151
768 Ga0207674_10001065
769 Ga0207674_10008134
770 Ga0207674_10009081
771 Ga0207674_10020471
772 Ga0207674_10042986
773 Ga0207675_100001703
774 Ga0207683_10211309
775 Ga0207683_10245464
776 Ga0207698_10144054
777 Ga0209371_1002012
778 Ga0209969_1002033
779 Ga0209995_1004880
780 Ga0209588_1000214
781 Ga0209966_1000545
782 Ga0209998_10000246
783 Ga0209974_10083003
784 Ga0268266_10132574
785 Ga0268265_10088618
786 Ga0268264_10015843
787 Ga0268256_1001763
788 Ga0307405_10099200
789 Ga0307413_10080481
790 Ga0307410_10082919
791 Ga0307410_10109289
792 Ga0307406_10063477
793 Ga0307407_10032645
794 Ga0307409_100006267
795 Ga0307409_100018393
796 Ga0307416_100039547
797 Ga0307416_100358248
798 Ga0373955_0002453
799 Ga0373931_0003457
800 Ga0373927_0002113
801 Ga0373947_0280305
802 Ga0373937_0000606
803 Ga0395899_0002363
804 Ga0395900_0003812
805 Ga0395905_0017086
806 Ga0395905_0022404
807 Ga0395901_0003789
808 Ga0400484_16757
809 Ga0400490_14639
810 Ga0400491_29683
811 Ga0400489_86273
812 Ga0436365_1585044
813 Ga0436365_1698337
814 Ga0451577_0246571
815 Ga0451576_0032746
816 Ga0451576_0145245
817 Ga0451576_0168474
818 Ga0451576_0456383
819 Ga0495629_0010846
820 Ga0495580_0046780
821 Ga0495582_0004313
822 Ga0495664_0081203
823 Ga0495596_0099500
824 Ga0495652_0039458
825 Ga0495654_0017766
826 Ga0495665_0073211
827 Ga0495587_0012467
828 Ga0495609_0069788
829 Ga0495645_0001044
830 Ga0495622_0082115
831 Ga0495667_0004217
832 Ga0495667_0127875
833 Ga0495661_0044783
834 Ga0495599_0001384
835 Ga0495646_0061222
836 Ga0495658_0126998
837 Ga0495613_0016053
838 Ga0495624_0105850
839 Ga0495600_0229519
840 Ga0495581_0005408
841 Ga0495672_0001552
842 Ga0496109_0029318
843 Ga0496110_0341373
844 Ga0496113_0069003
845 Ga0501032_0065769
846 Ga0501032_0101243
847 Ga0501033_0106637
848 Ga0501033_0247256
849 Ga0501034_0092539
850 Ga0501034_0434476
851 Ga0501038_0110427
852 Ga0501043_0008960
853 Ga0501043_0175633
854 Ga0501046_0033474
855 Ga0501047_0000589
856 Ga0501047_0124675
857 Ga0501047_0357808
858 Ga0501070_0046836
859 Ga0501202_000018
860 Ga0501224_000982
861 Ga0501233_001745
862 Ga0501235_000038
863 Ga0501243_002068
864 Ga0501250_000765
865 Ga0501257_003055
866 Ga0501259_001304
867 Ga0501261_001451
868 Ga0501225_0000491
869 Ga0501229_001655
870 Ga0501234_000564
871 Ga0501267_002795
872 Ga0501268_000193
873 Ga0501274_001684
874 Ga0501035_0001319
875 Ga0501044_0011401
876 nmdc:mga05p37_6571_c1
877 nmdc:mga05p37_680715_c1
878 nmdc:mga09592_3667_c1
879 nmdc:mga0qj67_129662_c1
880 nmdc:mga0qj67_26762_c1
881 nmdc:mga0qj67_75759_c1
882 nmdc:mga06r32_46419_c2
883 nmdc:mga06r32_61601_c1
884 nmdc:mga06r32_70836_c1
885 nmdc:mga08y16_92077_c1
886 nmdc:mga0n895_129607_c1
887 nmdc:mga0n895_226208_c1
888 nmdc:mga0n895_371056_c1
889 nmdc:mga0n895_52012_c1
890 nmdc:mga0rr50_167357_c1
891 nmdc:mga0rr50_240745_c1
892 nmdc:mga0rr50_26934_c1
893 nmdc:mga0rr50_293212_c1
894 nmdc:mga0rr50_84251_c1
895 nmdc:mga08x19_10285_c1
896 nmdc:mga0a205_11611_c2
897 nmdc:mga0a205_16290_c1
898 nmdc:mga0a205_171178_c1
899 nmdc:mga0a205_73670_c1
900 2888583933
901 2889053622
902 8007378429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03786

UxuA

D-mannonate dehydratase (UxuA)

1

343

0.98

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

151

312

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ban-assembly1.cif.gz_A the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.9702 1 347
1tz9-assembly1.cif.gz_B crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 0.9435 1 345
3ban-assembly1.cif.gz_B the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.9433 1 347
1tz9-assembly1.cif.gz_B crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 0.9381 1 345
3ban-assembly1.cif.gz_A the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.9265 1 347
ID Description Score Start End Superfamily
1tz9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9486 2 344 3.20.20.150
3banB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9433 1 347 3.20.20.150
1tz9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9403 2 344 3.20.20.150
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9265 1 345 3.20.20.150
af_P24215_172_393_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9071 153 346 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A7W1EK56-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9925 1 328 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A2V7MGE2-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9908 1 267 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A2X3CI52-F1-model_v4 Mannonate dehydratase (EC 4.2.1.8) (D-mannonate hydro-lyase) 0.9902 1 109 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A7W1EK56-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9895 1 328 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A2V7STI9-F1-model_v4 Mannonate dehydratase (EC 4.2.1.8) (D-mannonate hydro-lyase) 0.9872 1 343 GO:0008198
GO:0008927
GO:0030145
GO:0042840

Map