F446746

General Info

Members Datasets Scaffolds Average Seq Length
451 258 447 152

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_101078056|Ga0070679_1010780561
Length 183
Sequence MPFTMVTGDPLDLGTTCHRRVRRAGPVRCFDRGMTSDPEPERVVSAGRDIAATAEKLFELIADPAQQPRWDGNDNLVEAVTARRVNAIGDVFTMTTTNGVRENHVFEFEEGRRIAWRTAELGQAPPGHLWRWELEPIDSSHTRVTHTYDWRNLTDQKRIPRARATTAERLRASLDRLADLAER

Samples

Sample ID Description Type Environment
1 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
2 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
3 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
193 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
194 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
197 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
198 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
199 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 2.66
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0.22
Rhizoplane 5.76
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002574 3300000546 Bacteria 2165
2 JGI24751J29686_10037629 3300002459 Bacteria 1002
3 Ga0070658_10075952 3300005327 Bacteria 2756
4 Ga0070658_10137099 3300005327 Bacteria 2043
5 Ga0070676_10019061 3300005328 Bacteria 3813
6 Ga0070676_10035026 3300005328 Bacteria 2885
7 Ga0070683_100004032 3300005329 Bacteria 12022
8 Ga0070683_100010811 3300005329 Bacteria 7855
9 Ga0070690_100064092 3300005330 Bacteria 2373
10 Ga0070670_100133662 3300005331 Bacteria 2143
11 Ga0070670_100247887 3300005331 Bacteria 1551
12 Ga0068869_100007386 3300005334 Bacteria 7019
13 Ga0068869_100011554 3300005334 Bacteria 5796
14 Ga0068869_100351548 3300005334 Bacteria 1201
15 Ga0070666_10028716 3300005335 Bacteria 3652
16 Ga0070666_10069411 3300005335 Bacteria 2396
17 Ga0070680_100031757 3300005336 Bacteria 4246
18 Ga0070680_100101093 3300005336 Bacteria 2393
19 Ga0070680_100207465 3300005336 Bacteria 1653
20 Ga0070680_100444577 3300005336 Bacteria 1107
21 Ga0070682_100035063 3300005337 Bacteria 3060
22 Ga0070682_100679482 3300005337 Bacteria 823
23 Ga0068868_100013827 3300005338 Bacteria 5932
24 Ga0068868_100018832 3300005338 Bacteria 5166
25 Ga0070660_100025891 3300005339 Bacteria 4363
26 Ga0070660_100070058 3300005339 Bacteria 2736
27 Ga0070660_100461398 3300005339 Bacteria 1054
28 Ga0070689_100053262 3300005340 Bacteria 3131
29 Ga0070691_10003850 3300005341 Bacteria 6780
30 Ga0070687_100017010 3300005343 Bacteria 3334
31 Ga0070661_100021412 3300005344 Bacteria 4617
32 Ga0070661_100155389 3300005344 Bacteria 1731
33 Ga0070692_10011792 3300005345 Bacteria 4026
34 Ga0070692_10117170 3300005345 Bacteria 1481
35 Ga0070668_100171786 3300005347 Bacteria 1765
36 Ga0070668_100354963 3300005347 Bacteria 1242
37 Ga0070669_100682726 3300005353 Bacteria 866
38 Ga0070675_100000238 3300005354 Bacteria 35586
39 Ga0070675_100011986 3300005354 Bacteria 6793
40 Ga0070671_100020030 3300005355 Bacteria 5450
41 Ga0070671_100246068 3300005355 Bacteria 1518
42 Ga0070673_100050805 3300005364 Bacteria 3243
43 Ga0070673_100228772 3300005364 Bacteria 1613
44 Ga0070688_100250054 3300005365 Bacteria 1262
45 Ga0070659_100016184 3300005366 Bacteria 5596
46 Ga0070659_100071821 3300005366 Bacteria 2753
47 Ga0070667_100038379 3300005367 Bacteria 4015
48 Ga0070709_10120250 3300005434 Bacteria 1779
49 Ga0070714_100034858 3300005435 Bacteria 4215
50 Ga0070714_100055199 3300005435 Bacteria 3395
51 Ga0070713_100601739 3300005436 Bacteria 1044
52 Ga0070710_10298042 3300005437 Bacteria 1051
53 Ga0070710_10624497 3300005437 Bacteria 752
54 Ga0070705_100384621 3300005440 Bacteria 1034
55 Ga0070694_100997868 3300005444 Bacteria 695
56 Ga0070708_100317431 3300005445 Bacteria 1468
57 Ga0070663_100005542 3300005455 Bacteria 7513
58 Ga0070663_100007414 3300005455 Bacteria 6675
59 Ga0070663_100068641 3300005455 Bacteria 2574
60 Ga0070663_100688950 3300005455 Bacteria 868
61 Ga0070662_100005857 3300005457 Bacteria 7889
62 Ga0070662_100040534 3300005457 Bacteria 3316
63 Ga0070681_10144416 3300005458 Bacteria 2309
64 Ga0068867_100120213 3300005459 Bacteria 2029
65 Ga0070685_10614506 3300005466 Bacteria 784
66 Ga0070706_100808693 3300005467 Bacteria 868
67 Ga0070707_100536089 3300005468 Bacteria 1133
68 Ga0070698_100172818 3300005471 Unclassified 2101
69 Ga0070698_100324769 3300005471 Bacteria 1470
70 Ga0070698_100385142 3300005471 Bacteria 1335
71 Ga0070679_100020226 3300005530 Bacteria 6488
72 Ga0070679_100116976 3300005530 Bacteria 2650
73 Ga0070679_101078056 3300005530 Bacteria 748
74 Ga0070684_100009574 3300005535 Bacteria 7634
75 Ga0070684_100067837 3300005535 Bacteria 3134
76 Ga0068853_100185422 3300005539 Bacteria 1888
77 Ga0068853_100193104 3300005539 Bacteria 1851
78 Ga0068853_100943278 3300005539 Bacteria 830
79 Ga0070686_100393351 3300005544 Bacteria 1052
80 Ga0070695_100077505 3300005545 Bacteria 2190
81 Ga0070696_100029662 3300005546 Bacteria 3740
82 Ga0070696_100684793 3300005546 Bacteria 834
83 Ga0070693_100000998 3300005547 Bacteria 12613
84 Ga0070693_100010988 3300005547 Bacteria 4550
85 Ga0070665_100550950 3300005548 Bacteria 1165
86 Ga0070665_100940384 3300005548 Bacteria 877
87 Ga0070704_100109679 3300005549 Bacteria 2097
88 Ga0068855_100385876 3300005563 Bacteria 1537
89 Ga0068855_100582574 3300005563 Bacteria 1208
90 Ga0068855_100635798 3300005563 Bacteria 1148
91 Ga0070664_100001415 3300005564 Bacteria 19138
92 Ga0070664_100008041 3300005564 Bacteria 8522
93 Ga0070664_100506196 3300005564 Bacteria 1113
94 Ga0070664_101003488 3300005564 Bacteria 785
95 Ga0068857_100003822 3300005577 Bacteria 12673
96 Ga0068857_100073408 3300005577 Bacteria 3048
97 Ga0068857_100120255 3300005577 Bacteria 2364
98 Ga0068854_100101973 3300005578 Bacteria 2153
99 Ga0068854_100155150 3300005578 Bacteria 1769
100 Ga0068856_100024301 3300005614 Bacteria 5896
101 Ga0068856_100479029 3300005614 Bacteria 1265
102 Ga0068856_100675252 3300005614 Bacteria 1054
103 Ga0070702_100003496 3300005615 Bacteria 7033
104 Ga0068852_100025246 3300005616 Bacteria 4812
105 Ga0068852_100072435 3300005616 Bacteria 3028
106 Ga0068852_100474249 3300005616 Bacteria 1242
107 Ga0068852_101644917 3300005616 Bacteria 665
108 Ga0068859_100105543 3300005617 Bacteria 2876
109 Ga0068859_100116802 3300005617 Bacteria 2733
110 Ga0068864_100067884 3300005618 Bacteria 3097
111 Ga0068864_100237582 3300005618 Bacteria 1687
112 Ga0068861_100017264 3300005719 Bacteria 5119
113 Ga0068861_100041718 3300005719 Bacteria 3437
114 Ga0068851_10353725 3300005834 Bacteria 855
115 Ga0068851_10510366 3300005834 Bacteria 722
116 Ga0068870_10000205 3300005840 Bacteria 21167
117 Ga0068863_100000995 3300005841 Bacteria 28447
118 Ga0068863_100311055 3300005841 Bacteria 1529
119 Ga0068863_100869076 3300005841 Bacteria 901
120 Ga0068858_100009187 3300005842 Bacteria 9446
121 Ga0068858_100503374 3300005842 Bacteria 1170
122 Ga0068858_100575477 3300005842 Bacteria 1091
123 Ga0068860_100141847 3300005843 Bacteria 2310
124 Ga0068860_100401389 3300005843 Bacteria 1356
125 Ga0068860_100591126 3300005843 Bacteria 1115
126 Ga0068862_100020024 3300005844 Bacteria 5585
127 Ga0081455_10000632 3300005937 Bacteria 45622
128 Ga0081540_1001084 3300005983 Bacteria 24152
129 Ga0081540_1001647 3300005983 Bacteria 19003
130 Ga0070717_10316440 3300006028 Bacteria 1390
131 Ga0075432_10037252 3300006058 Bacteria 1693
132 Ga0070715_10139340 3300006163 Bacteria 1176
133 Ga0070715_10631775 3300006163 Bacteria 632
134 Ga0070716_100036167 3300006173 Bacteria 2721
135 Ga0070712_100090251 3300006175 Bacteria 2243
136 Ga0070712_100390523 3300006175 Bacteria 1147
137 Ga0097621_100020038 3300006237 Bacteria 5149
138 Ga0097621_100051402 3300006237 Bacteria 3354
139 Ga0068871_100002715 3300006358 Bacteria 12079
140 Ga0068871_100982631 3300006358 Bacteria 785
141 Ga0075428_100003519 3300006844 Bacteria 17163
142 Ga0075430_100001382 3300006846 Bacteria 19703
143 Ga0075431_100104883 3300006847 Bacteria 2917
144 Ga0075431_100152877 3300006847 Bacteria 2376
145 Ga0075433_10037205 3300006852 Bacteria 4197
146 Ga0075434_100044508 3300006871 Bacteria 4403
147 Ga0075434_100410219 3300006871 Bacteria 1376
148 Ga0075434_100835035 3300006871 Bacteria 937
149 Ga0075429_100055991 3300006880 Bacteria 3432
150 Ga0068865_101039225 3300006881 Unclassified 719
151 Ga0075436_100061032 3300006914 Bacteria 2604
152 Ga0075436_100124356 3300006914 Bacteria 1806
153 Ga0097620_100105539 3300006931 Bacteria 2876
154 Ga0097620_100116793 3300006931 Bacteria 2733
155 Ga0075435_100001141 3300007076 Bacteria 16946
156 Ga0075435_100382684 3300007076 Bacteria 1209
157 Ga0105251_10021893 3300009011 Bacteria 3329
158 Ga0105240_10879485 3300009093 Bacteria 965
159 Ga0111539_10004003 3300009094 Bacteria 19351
160 Ga0111539_10096370 3300009094 Bacteria 3475
161 Ga0105245_10003643 3300009098 Bacteria 13750
162 Ga0105245_10070716 3300009098 Bacteria 3167
163 Ga0105245_10796199 3300009098 Bacteria 983
164 Ga0105247_10209092 3300009101 Bacteria 1315
165 Ga0114129_10130546 3300009147 Bacteria 3451
166 Ga0114129_10411007 3300009147 Bacteria 1782
167 Ga0114129_10996156 3300009147 Bacteria 1056
168 Ga0105243_10092576 3300009148 Bacteria 2493
169 Ga0105243_10191632 3300009148 Bacteria 1786
170 Ga0105241_10001623 3300009174 Bacteria 17142
171 Ga0105241_10553435 3300009174 Bacteria 1033
172 Ga0105241_11158919 3300009174 Bacteria 730
173 Ga0105248_10368255 3300009177 Bacteria 1618
174 Ga0105237_10142168 3300009545 Bacteria 2394
175 Ga0105237_10644661 3300009545 Bacteria 1066
176 Ga0105238_10104504 3300009551 Bacteria 2813
177 Ga0105238_10519821 3300009551 Bacteria 1193
178 Ga0105249_10084494 3300009553 Bacteria 2956
179 Ga0105249_12417896 3300009553 Bacteria 598
180 Ga0105239_10746679 3300010375 Bacteria 1120
181 Ga0105239_11003579 3300010375 Bacteria 960
182 Ga0105239_11215074 3300010375 Bacteria 869
183 Ga0105246_10013045 3300011119 Bacteria 5200
184 Ga0105246_10167050 3300011119 Bacteria 1681
185 Ga0157342_1029366 3300012507 Bacteria 685
186 Ga0157373_10106452 3300013100 Bacteria 1972
187 Ga0157371_10013698 3300013102 Bacteria 6151
188 Ga0157371_10369553 3300013102 Bacteria 1046
189 Ga0157370_10061161 3300013104 Bacteria 3574
190 Ga0157369_10002584 3300013105 Bacteria 21674
191 Ga0157369_10031349 3300013105 Bacteria 5854
192 Ga0157369_10274910 3300013105 Bacteria 1755
193 Ga0157369_10438450 3300013105 Bacteria 1353
194 Ga0157374_10002672 3300013296 Bacteria 14999
195 Ga0163162_11020369 3300013306 Bacteria 936
196 Ga0157372_10288696 3300013307 Bacteria 1908
197 Ga0157372_11064955 3300013307 Bacteria 936
198 Ga0157375_10093050 3300013308 Bacteria 3080
199 Ga0163163_10475183 3300014325 Bacteria 1311
200 Ga0157380_10218337 3300014326 Bacteria 1704
201 Ga0157380_10256291 3300014326 Bacteria 1586
202 Ga0157380_10765841 3300014326 Bacteria 978
203 Ga0157377_10005207 3300014745 Bacteria 6087
204 Ga0157379_10129329 3300014968 Bacteria 2272
205 Ga0157376_10107276 3300014969 Bacteria 2451
206 Ga0197907_11035920 3300020069 Bacteria 1990
207 Ga0197907_11315613 3300020069 Bacteria 1014
208 Ga0206356_10644548 3300020070 Bacteria 3061
209 Ga0206356_10821749 3300020070 Bacteria 1125
210 Ga0206352_10120848 3300020078 Bacteria 1161
211 Ga0206350_11415849 3300020080 Bacteria 1781
212 Ga0206354_10538699 3300020081 Bacteria 2690
213 Ga0206354_11214315 3300020081 Bacteria 771
214 Ga0206354_11541017 3300020081 Bacteria 1567
215 Ga0206353_10142902 3300020082 Bacteria 1192
216 Ga0206353_11098035 3300020082 Bacteria 1487
217 Ga0206353_11947350 3300020082 Bacteria 2019
218 Ga0207656_10249808 3300025321 Bacteria 869
219 Ga0207710_10266395 3300025900 Bacteria 860
220 Ga0207688_10008676 3300025901 Bacteria 5531
221 Ga0207688_10009057 3300025901 Bacteria 5419
222 Ga0207680_10055987 3300025903 Bacteria 2380
223 Ga0207685_10161658 3300025905 Bacteria 1023
224 Ga0207699_10089606 3300025906 Bacteria 1928
225 Ga0207699_10181773 3300025906 Bacteria 1414
226 Ga0207645_10063223 3300025907 Bacteria 2365
227 Ga0207643_10000027 3300025908 Bacteria 99423
228 Ga0207643_10280290 3300025908 Bacteria 1033
229 Ga0207705_10054287 3300025909 Bacteria 2888
230 Ga0207705_10267814 3300025909 Bacteria 1306
231 Ga0207684_10628956 3300025910 Bacteria 915
232 Ga0207654_10006227 3300025911 Bacteria 5996
233 Ga0207695_10302908 3300025913 Bacteria 1489
234 Ga0207693_10015024 3300025915 Bacteria 6215
235 Ga0207693_10571712 3300025915 Bacteria 881
236 Ga0207660_10288433 3300025917 Bacteria 1304
237 Ga0207660_10733325 3300025917 Bacteria 806
238 Ga0207662_10023859 3300025918 Bacteria 3517
239 Ga0207657_10017623 3300025919 Bacteria 6842
240 Ga0207657_10022302 3300025919 Bacteria 5930
241 Ga0207657_10464840 3300025919 Bacteria 992
242 Ga0207657_10605431 3300025919 Bacteria 855
243 Ga0207649_10027820 3300025920 Bacteria 3323
244 Ga0207649_10773660 3300025920 Bacteria 748
245 Ga0207652_10052955 3300025921 Bacteria 3486
246 Ga0207646_10246257 3300025922 Bacteria 1615
247 Ga0207694_10141104 3300025924 Bacteria 1937
248 Ga0207694_10567748 3300025924 Bacteria 953
249 Ga0207650_10006536 3300025925 Bacteria 7949
250 Ga0207650_10087986 3300025925 Bacteria 2368
251 Ga0207659_10001637 3300025926 Bacteria 13308
252 Ga0207659_10017279 3300025926 Bacteria 4710
253 Ga0207659_10139994 3300025926 Bacteria 1877
254 Ga0207687_10016957 3300025927 Bacteria 4787
255 Ga0207700_10041614 3300025928 Bacteria 3363
256 Ga0207700_10217019 3300025928 Bacteria 1619
257 Ga0207700_10404186 3300025928 Bacteria 1197
258 Ga0207664_10071772 3300025929 Bacteria 2790
259 Ga0207664_10186790 3300025929 Bacteria 1782
260 Ga0207644_10081882 3300025931 Bacteria 2386
261 Ga0207644_10148655 3300025931 Bacteria 1811
262 Ga0207690_10018617 3300025932 Bacteria 4260
263 Ga0207690_10239784 3300025932 Bacteria 1396
264 Ga0207690_10484061 3300025932 Bacteria 999
265 Ga0207706_10008733 3300025933 Bacteria 9328
266 Ga0207709_10328822 3300025935 Bacteria 1147
267 Ga0207709_10751303 3300025935 Bacteria 784
268 Ga0207669_10276673 3300025937 Bacteria 1264
269 Ga0207665_10007420 3300025939 Bacteria 7250
270 Ga0207665_10037532 3300025939 Bacteria 3225
271 Ga0207691_10049666 3300025940 Bacteria 3844
272 Ga0207691_10058433 3300025940 Bacteria 3508
273 Ga0207691_10356502 3300025940 Bacteria 1251
274 Ga0207711_10846309 3300025941 Bacteria 851
275 Ga0207689_10002095 3300025942 Bacteria 18817
276 Ga0207689_10007948 3300025942 Bacteria 9265
277 Ga0207689_10059974 3300025942 Bacteria 3129
278 Ga0207661_10002523 3300025944 Bacteria 12595
279 Ga0207661_10005545 3300025944 Bacteria 8905
280 Ga0207661_10020945 3300025944 Bacteria 4896
281 Ga0207661_10138049 3300025944 Bacteria 2096
282 Ga0207661_10467924 3300025944 Bacteria 1150
283 Ga0207679_10020782 3300025945 Bacteria 4437
284 Ga0207679_10034090 3300025945 Bacteria 3589
285 Ga0207679_10266371 3300025945 Bacteria 1463
286 Ga0207667_10396314 3300025949 Bacteria 1406
287 Ga0207712_10114582 3300025961 Bacteria 2028
288 Ga0207712_11667360 3300025961 Bacteria 571
289 Ga0207668_10292211 3300025972 Bacteria 1341
290 Ga0207668_10314141 3300025972 Bacteria 1298
291 Ga0207640_10045821 3300025981 Bacteria 2810
292 Ga0207640_10089744 3300025981 Bacteria 2125
293 Ga0207640_10132693 3300025981 Bacteria 1803
294 Ga0207658_10001453 3300025986 Bacteria 18468
295 Ga0207658_11640536 3300025986 Bacteria 588
296 Ga0207677_10007045 3300026023 Bacteria 6185
297 Ga0207677_10214908 3300026023 Bacteria 1538
298 Ga0207703_10034895 3300026035 Bacteria 3995
299 Ga0207703_10538928 3300026035 Bacteria 1099
300 Ga0207703_11434207 3300026035 Bacteria 664
301 Ga0207639_10214071 3300026041 Bacteria 1660
302 Ga0207639_11063781 3300026041 Bacteria 758
303 Ga0207678_10001840 3300026067 Bacteria 19458
304 Ga0207678_10004646 3300026067 Bacteria 12331
305 Ga0207678_10008384 3300026067 Bacteria 9118
306 Ga0207678_10510078 3300026067 Bacteria 1049
307 Ga0207708_10045203 3300026075 Bacteria 3356
308 Ga0207708_10117074 3300026075 Bacteria 2073
309 Ga0207702_10016981 3300026078 Bacteria 6022
310 Ga0207702_10157387 3300026078 Bacteria 2072
311 Ga0207702_10253614 3300026078 Bacteria 1653
312 Ga0207702_10272997 3300026078 Bacteria 1595
313 Ga0207641_10092765 3300026088 Bacteria 2645
314 Ga0207641_10200970 3300026088 Bacteria 1837
315 Ga0207676_10002272 3300026095 Bacteria 13787
316 Ga0207676_10226298 3300026095 Bacteria 1669
317 Ga0207676_12131149 3300026095 Bacteria 559
318 Ga0207674_10011755 3300026116 Bacteria 9822
319 Ga0207674_10032649 3300026116 Bacteria 5458
320 Ga0207675_100019255 3300026118 Bacteria 6369
321 Ga0207675_100062336 3300026118 Bacteria 3482
322 Ga0207683_10001136 3300026121 Bacteria 24178
323 Ga0207683_10005627 3300026121 Bacteria 10746
324 Ga0207683_10265135 3300026121 Bacteria 1569
325 Ga0207698_10007399 3300026142 Bacteria 6878
326 Ga0207698_10009322 3300026142 Bacteria 6252
327 Ga0207428_10002110 3300027907 Bacteria 20036
328 Ga0207428_10031094 3300027907 Bacteria 4411
329 Ga0207428_10045334 3300027907 Bacteria 3542
330 Ga0268266_10182411 3300028379 Bacteria 1912
331 Ga0268264_11359980 3300028381 Bacteria 720
332 Ga0265327_10001202 3300031251 Bacteria 34967
333 Ga0307513_10137512 3300031456 Bacteria 2376
334 Ga0307408_100137283 3300031548 Bacteria 1915
335 Ga0307508_10040474 3300031616 Bacteria 4184
336 Ga0307409_101751865 3300031995 Bacteria 650
337 Ga0307409_101935415 3300031995 Bacteria 619
338 Ga0373955_0103558 3300035172 Bacteria 1637
339 Ga0373937_0810505 3300036401 Bacteria 884
340 Ga0395899_0366228 3300037312 Bacteria 961
341 Ga0395899_0581038 3300037312 Bacteria 716
342 Ga0395900_0886977 3300037418 Bacteria 816
343 Ga0395898_0303135 3300037466 Bacteria 1524
344 Ga0395898_0881265 3300037466 Bacteria 834
345 Ga0395898_1407001 3300037466 Bacteria 625
346 Ga0436364_0714158 3300037853 Bacteria 28231
347 Ga0395901_0015035 3300038443 Bacteria 7870
348 Ga0395901_0095030 3300038443 Unclassified 3123
349 Ga0395901_0565299 3300038443 Bacteria 1151
350 Ga0436363_0644605 3300039450 Bacteria 2328
351 Ga0451800_0063750 3300041459 Bacteria 576
352 Ga0451833_1373484 3300041491 Bacteria 535
353 Ga0451849_0284701 3300041505 Bacteria 726
354 Ga0439448_0007604 3300042005 Bacteria 3147
355 Ga0439448_0068660 3300042005 Bacteria 1179
356 Ga0439455_0064341 3300042012 Bacteria 977
357 Ga0439455_0127814 3300042012 Bacteria 715
358 Ga0439463_176093 3300042016 Bacteria 555
359 Ga0439459_0005843 3300042438 Bacteria 2033
360 Ga0439464_0095644 3300042439 Bacteria 899
361 Ga0466972_0201098 3300044658 Bacteria 933
362 Ga0466965_0006847 3300044683 Bacteria 5209
363 Ga0466965_0013604 3300044683 Bacteria 3842
364 Ga0466966_0150799 3300044684 Bacteria 1418
365 Ga0466961_0121958 3300044693 Bacteria 1636
366 Ga0466961_0284417 3300044693 Bacteria 1012
367 Ga0466961_0454736 3300044693 Bacteria 775
368 Ga0466961_0888246 3300044693 Bacteria 531
369 Ga0466963_0000746 3300044694 Bacteria 16042
370 Ga0466963_0172302 3300044694 Bacteria 1509
371 Ga0466971_0044054 3300044719 Bacteria 2004
372 Ga0466971_0168980 3300044719 Bacteria 1025
373 Ga0466970_0050683 3300044765 Bacteria 2214
374 Ga0466957_0034785 3300044842 Bacteria 3022
375 Ga0466957_0110760 3300044842 Bacteria 1741
376 Ga0466959_0263478 3300045049 Bacteria 1186
377 Ga0466959_0297741 3300045049 Bacteria 1105
378 Ga0466958_0042713 3300045836 Bacteria 2730
379 Ga0466958_0226349 3300045836 Bacteria 1194
380 Ga0466967_0021000 3300045976 Bacteria 5290
381 Ga0495664_0154420 3300046477 Bacteria 1392
382 Ga0495608_0085992 3300046511 Bacteria 2038
383 Ga0495652_0390050 3300046529 Bacteria 988
384 Ga0495587_0181460 3300046536 Bacteria 1193
385 Ga0495645_0217147 3300046543 Bacteria 1288
386 Ga0495667_0572824 3300046559 Bacteria 704
387 Ga0495604_0047711 3300047317 Bacteria 3335
388 Ga0495674_0641601 3300047319 Bacteria 838
389 Ga0495684_0106952 3300047471 Bacteria 2113
390 Ga0496100_0052464 3300048903 Bacteria 2651
391 Ga0496101_0000301 3300048904 Bacteria 34516
392 Ga0496102_0033713 3300048905 Bacteria 4603
393 Ga0496103_0011852 3300048906 Bacteria 5173
394 Ga0496103_0401460 3300048906 Bacteria 880
395 Ga0496104_0001624 3300048907 Bacteria 19409
396 Ga0496105_0013602 3300048908 Bacteria 6462
397 Ga0496106_0000638 3300048909 Bacteria 25113
398 Ga0496106_0004722 3300048909 Bacteria 10088
399 Ga0496107_0003452 3300048910 Bacteria 10561
400 Ga0496108_0003498 3300048911 Bacteria 12593
401 Ga0496108_0027215 3300048911 Bacteria 4719
402 Ga0496109_0012267 3300048912 Bacteria 7397
403 Ga0496109_0031996 3300048912 Bacteria 4725
404 Ga0496110_0026204 3300048913 Bacteria 4986
405 Ga0496110_0035738 3300048913 Bacteria 4312
406 Ga0496111_0220410 3300048914 Bacteria 1409
407 Ga0496112_0060379 3300048915 Bacteria 3736
408 Ga0496112_0208314 3300048915 Bacteria 1913
409 Ga0496112_0643737 3300048915 Bacteria 990
410 Ga0496113_0020783 3300048916 Bacteria 4622
411 Ga0496114_0011153 3300048917 Bacteria 7174
412 Ga0496115_0024819 3300048918 Bacteria 4662
413 Ga0496115_0154229 3300048918 Bacteria 1897
414 Ga0496115_0334625 3300048918 Bacteria 1236
415 Ga0496116_0033679 3300048919 Bacteria 3630
416 Ga0496117_0014180 3300048920 Bacteria 6889
417 Ga0496118_0015210 3300048921 Bacteria 7144
418 Ga0496120_0029359 3300048923 Bacteria 3358
419 Ga0496121_0000002 3300048924 Bacteria 1494588
420 Ga0496121_0062478 3300048924 Bacteria 3050
421 Ga0496122_0000396 3300048925 Bacteria 92624
422 Ga0496124_0000002 3300048927 Bacteria 1494588
423 Ga0496125_0000002 3300048928 Bacteria 1480920
424 Ga0496126_0000009 3300048929 Bacteria 750350
425 Ga0496126_0840621 3300048929 Bacteria 701
426 nmdc:mga05p37_184_c1 3300050507 Bacteria 61426
427 nmdc:mga05p37_206194_c1 3300050507 Bacteria 2378
428 nmdc:mga05p37_362408_c1 3300050507 Bacteria 1704
429 nmdc:mga09592_123223_c1 3300050508 Bacteria 2227
430 nmdc:mga09592_3640_c1 3300050508 Bacteria 12426
431 nmdc:mga0qj67_240171_c1 3300050509 Bacteria 1470
432 nmdc:mga06r32_150364_c1 3300050510 Bacteria 2306
433 nmdc:mga06r32_219803_c1 3300050510 Bacteria 1888
434 nmdc:mga06r32_56630_c1 3300050510 Bacteria 3764
435 nmdc:mga08y16_15196_c1 3300050511 Bacteria 8097
436 nmdc:mga08y16_2340_c1 3300050511 Bacteria 19420
437 nmdc:mga08y16_5543_c1 3300050511 Bacteria 13216
438 nmdc:mga0n895_762720_c1 3300050512 Bacteria 960
439 nmdc:mga0rr50_10260_c1 3300050513 Bacteria 5936
440 nmdc:mga0rr50_905616_c1 3300050513 Bacteria 752
441 nmdc:mga08x19_51974_c1 3300050514 Bacteria 2634
442 nmdc:mga0a205_31640_c1 3300050515 Bacteria 5071
443 nmdc:mga0a205_465796_c1 3300050515 Bacteria 1123
444 nmdc:mga0sz30_4639_c1 3300050516 Bacteria 4980
445 Ga0495601_0254731 3300053077 Bacteria 1146
446 Ga0500616_0016878 3300053153 Bacteria 4147
447 Ga0466962_0119651 3300061719 Bacteria 1270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041491 Ga0451833_1373484 Ga0451833_1373484_51_497 139
2 iso_pu_bacteria 2870782633 2870787228 139
3 3300005327 Ga0070658_10137099 Ga0070658_101370993 143
4 3300005334 Ga0068869_100351548 Ga0068869_1003515481 143
5 3300005335 Ga0070666_10028716 Ga0070666_100287163 143
6 3300005336 Ga0070680_100101093 Ga0070680_1001010932 143
7 3300005339 Ga0070660_100070058 Ga0070660_1000700583 143
8 3300005343 Ga0070687_100017010 Ga0070687_1000170104 143
9 3300005344 Ga0070661_100155389 Ga0070661_1001553892 143
10 3300005347 Ga0070668_100354963 Ga0070668_1003549632 143
11 3300005353 Ga0070669_100682726 Ga0070669_1006827261 143
12 3300005355 Ga0070671_100246068 Ga0070671_1002460682 143
13 3300005364 Ga0070673_100050805 Ga0070673_1000508053 143
14 3300005365 Ga0070688_100250054 Ga0070688_1002500542 143
15 3300005435 Ga0070714_100034858 Ga0070714_1000348581 143
16 3300005437 Ga0070710_10298042 Ga0070710_102980423 143
17 3300005445 Ga0070708_100317431 Ga0070708_1003174312 143
18 3300005455 Ga0070663_100068641 Ga0070663_1000686413 143
19 3300005457 Ga0070662_100040534 Ga0070662_1000405341 143
20 3300005466 Ga0070685_10614506 Ga0070685_106145062 143
21 3300005468 Ga0070707_100536089 Ga0070707_1005360892 143
22 3300005471 Ga0070698_100324769 Ga0070698_1003247692 143
23 3300005530 Ga0070679_100116976 Ga0070679_1001169762 143
24 3300005539 Ga0068853_100185422 Ga0068853_1001854221 143
25 3300005545 Ga0070695_100077505 Ga0070695_1000775053 143
26 3300005546 Ga0070696_100029662 Ga0070696_1000296622 143
27 3300005547 Ga0070693_100010988 Ga0070693_1000109883 143
28 3300005548 Ga0070665_100550950 Ga0070665_1005509502 143
29 3300005549 Ga0070704_100109679 Ga0070704_1001096793 143
30 3300005563 Ga0068855_100385876 Ga0068855_1003858762 143
31 3300005564 Ga0070664_100506196 Ga0070664_1005061963 143
32 3300005578 Ga0068854_100155150 Ga0068854_1001551503 143
33 3300005614 Ga0068856_100675252 Ga0068856_1006752522 143
34 3300005616 Ga0068852_100474249 Ga0068852_1004742492 143
35 3300005617 Ga0068859_100116802 Ga0068859_1001168023 143
36 3300005719 Ga0068861_100041718 Ga0068861_1000417183 143
37 3300005834 Ga0068851_10353725 Ga0068851_103537251 143
38 3300005842 Ga0068858_100503374 Ga0068858_1005033742 143
39 3300005983 Ga0081540_1001084 Ga0081540_10010843 143
40 3300005983 Ga0081540_1001647 Ga0081540_100164711 143
41 3300006163 Ga0070715_10139340 Ga0070715_101393402 143
42 3300006173 Ga0070716_100036167 Ga0070716_1000361672 143
43 3300006237 Ga0097621_100051402 Ga0097621_1000514023 143
44 3300006871 Ga0075434_100410219 Ga0075434_1004102192 143
45 3300006914 Ga0075436_100061032 Ga0075436_1000610322 143
46 3300006931 Ga0097620_100116793 Ga0097620_1001167933 143
47 3300010375 Ga0105239_10746679 Ga0105239_107466792 143
48 3300020069 Ga0197907_11315613 Ga0197907_113156132 143
49 3300020070 Ga0206356_10821749 Ga0206356_108217492 143
50 3300020081 Ga0206354_11214315 Ga0206354_112143151 143
51 3300020082 Ga0206353_10142902 Ga0206353_101429022 143
52 3300025321 Ga0207656_10249808 Ga0207656_102498082 143
53 3300025900 Ga0207710_10266395 Ga0207710_102663952 143
54 3300025906 Ga0207699_10181773 Ga0207699_101817732 143
55 3300025908 Ga0207643_10280290 Ga0207643_102802901 143
56 3300025915 Ga0207693_10015024 Ga0207693_100150243 143
57 3300025917 Ga0207660_10733325 Ga0207660_107333252 143
58 3300025918 Ga0207662_10023859 Ga0207662_100238592 143
59 3300025919 Ga0207657_10017623 Ga0207657_100176239 143
60 3300025920 Ga0207649_10773660 Ga0207649_107736601 143
61 3300025924 Ga0207694_10567748 Ga0207694_105677481 143
62 3300025926 Ga0207659_10139994 Ga0207659_101399942 143
63 3300025928 Ga0207700_10041614 Ga0207700_100416144 143
64 3300025929 Ga0207664_10186790 Ga0207664_101867901 143
65 3300025931 Ga0207644_10148655 Ga0207644_101486553 143
66 3300025932 Ga0207690_10484061 Ga0207690_104840612 143
67 3300025937 Ga0207669_10276673 Ga0207669_102766732 143
68 3300025939 Ga0207665_10037532 Ga0207665_100375322 143
69 3300025940 Ga0207691_10058433 Ga0207691_100584334 143
70 3300025942 Ga0207689_10059974 Ga0207689_100599743 143
71 3300025945 Ga0207679_10266371 Ga0207679_102663712 143
72 3300025972 Ga0207668_10314141 Ga0207668_103141412 143
73 3300025981 Ga0207640_10132693 Ga0207640_101326931 143
74 3300025986 Ga0207658_11640536 Ga0207658_116405362 143
75 3300026035 Ga0207703_11434207 Ga0207703_114342072 143
76 3300026067 Ga0207678_10001840 Ga0207678_1000184014 143
77 3300026075 Ga0207708_10045203 Ga0207708_100452031 143
78 3300026078 Ga0207702_10272997 Ga0207702_102729971 143
79 3300026088 Ga0207641_10092765 Ga0207641_100927653 143
80 3300026116 Ga0207674_10032649 Ga0207674_100326493 143
81 3300026118 Ga0207675_100019255 Ga0207675_1000192554 143
82 3300026121 Ga0207683_10001136 Ga0207683_1000113618 143
83 3300048906 Ga0496103_0401460 Ga0496103_0401460_424_855 143
84 3300048929 Ga0496126_0840621 Ga0496126_0840621_23_454 143
85 3300026078 Ga0207702_10157387 Ga0207702_101573872 144
86 iso_pu_bacteria 2738541264 2738665782 144
87 iso_pu_bacteria 2738541356 2739144916 144
88 3300013105 Ga0157369_10002584 Ga0157369_100025849 146
89 3300048924 Ga0496121_0062478 Ga0496121_0062478_1655_2098 146
90 3300005834 Ga0068851_10510366 Ga0068851_105103661 147
91 3300044683 Ga0466965_0006847 Ga0466965_0006847_2974_3423 147
92 3300044693 Ga0466961_0121958 Ga0466961_0121958_828_1277 147
93 3300044765 Ga0466970_0050683 Ga0466970_0050683_335_784 147
94 3300044842 Ga0466957_0034785 Ga0466957_0034785_1741_2190 147
95 3300005335 Ga0070666_10069411 Ga0070666_100694113 148
96 3300005367 Ga0070667_100038379 Ga0070667_1000383792 148
97 3300005843 Ga0068860_100401389 Ga0068860_1004013892 148
98 3300009553 Ga0105249_12417896 Ga0105249_124178961 148
99 3300010375 Ga0105239_11215074 Ga0105239_112150741 148
100 3300025903 Ga0207680_10055987 Ga0207680_100559873 148
101 3300025961 Ga0207712_11667360 Ga0207712_116673602 148
102 3300025986 Ga0207658_10001453 Ga0207658_100014532 148
103 3300044693 Ga0466961_0888246 Ga0466961_0888246_19_471 148
104 3300048903 Ga0496100_0052464 Ga0496100_0052464_313_759 148
105 3300048904 Ga0496101_0000301 Ga0496101_0000301_1850_2296 148
106 3300048905 Ga0496102_0033713 Ga0496102_0033713_689_1135 148
107 3300048906 Ga0496103_0011852 Ga0496103_0011852_2864_3310 148
108 3300048909 Ga0496106_0000638 Ga0496106_0000638_12050_12496 148
109 3300048910 Ga0496107_0003452 Ga0496107_0003452_620_1066 148
110 3300048911 Ga0496108_0003498 Ga0496108_0003498_6196_6642 148
111 3300048912 Ga0496109_0012267 Ga0496109_0012267_6889_7335 148
112 3300048913 Ga0496110_0026204 Ga0496110_0026204_975_1421 148
113 3300048917 Ga0496114_0011153 Ga0496114_0011153_1799_2245 148
114 3300048918 Ga0496115_0024819 Ga0496115_0024819_3928_4374 148
115 3300048919 Ga0496116_0033679 Ga0496116_0033679_946_1392 148
116 3300048920 Ga0496117_0014180 Ga0496117_0014180_1387_1833 148
117 3300048921 Ga0496118_0015210 Ga0496118_0015210_796_1242 148
118 3300048923 Ga0496120_0029359 Ga0496120_0029359_2484_2930 148
119 3300048924 Ga0496121_0000002 Ga0496121_0000002_538129_538575 148
120 3300048925 Ga0496122_0000396 Ga0496122_0000396_1862_2308 148
121 3300048927 Ga0496124_0000002 Ga0496124_0000002_956014_956460 148
122 3300048928 Ga0496125_0000002 Ga0496125_0000002_538129_538575 148
123 3300048929 Ga0496126_0000009 Ga0496126_0000009_211776_212222 148
124 iso_pu_bacteria 8055412473 8055418825 148
125 3300005328 Ga0070676_10019061 Ga0070676_100190612 149
126 3300005329 Ga0070683_100010811 Ga0070683_1000108114 149
127 3300005331 Ga0070670_100133662 Ga0070670_1001336622 149
128 3300005334 Ga0068869_100007386 Ga0068869_1000073863 149
129 3300005338 Ga0068868_100013827 Ga0068868_1000138275 149
130 3300005347 Ga0070668_100171786 Ga0070668_1001717861 149
131 3300005354 Ga0070675_100000238 Ga0070675_10000023816 149
132 3300005366 Ga0070659_100016184 Ga0070659_1000161842 149
133 3300005455 Ga0070663_100005542 Ga0070663_1000055424 149
134 3300005457 Ga0070662_100005857 Ga0070662_1000058573 149
135 3300005459 Ga0068867_100120213 Ga0068867_1001202133 149
136 3300005544 Ga0070686_100393351 Ga0070686_1003933512 149
137 3300005563 Ga0068855_100582574 Ga0068855_1005825742 149
138 3300005564 Ga0070664_100001415 Ga0070664_1000014153 149
139 3300005577 Ga0068857_100003822 Ga0068857_1000038223 149
140 3300005616 Ga0068852_100072435 Ga0068852_1000724352 149
141 3300005618 Ga0068864_100067884 Ga0068864_1000678843 149
142 3300005719 Ga0068861_100017264 Ga0068861_1000172646 149
143 3300005842 Ga0068858_100575477 Ga0068858_1005754771 149
144 3300005843 Ga0068860_100141847 Ga0068860_1001418472 149
145 3300005844 Ga0068862_100020024 Ga0068862_1000200242 149
146 3300006358 Ga0068871_100982631 Ga0068871_1009826311 149
147 3300009094 Ga0111539_10096370 Ga0111539_100963703 149
148 3300009098 Ga0105245_10003643 Ga0105245_100036434 149
149 3300009148 Ga0105243_10191632 Ga0105243_101916321 149
150 3300009174 Ga0105241_10553435 Ga0105241_105534351 149
151 3300009551 Ga0105238_10519821 Ga0105238_105198211 149
152 3300009553 Ga0105249_10084494 Ga0105249_100844943 149
153 3300011119 Ga0105246_10167050 Ga0105246_101670502 149
154 3300012507 Ga0157342_1029366 Ga0157342_10293662 149
155 3300014326 Ga0157380_10218337 Ga0157380_102183372 149
156 3300014326 Ga0157380_10256291 Ga0157380_102562912 149
157 3300025901 Ga0207688_10008676 Ga0207688_100086763 149
158 3300025907 Ga0207645_10063223 Ga0207645_100632232 149
159 3300025925 Ga0207650_10087986 Ga0207650_100879862 149
160 3300025926 Ga0207659_10001637 Ga0207659_1000163712 149
161 3300025927 Ga0207687_10016957 Ga0207687_100169572 149
162 3300025933 Ga0207706_10008733 Ga0207706_100087334 149
163 3300025935 Ga0207709_10328822 Ga0207709_103288221 149
164 3300025940 Ga0207691_10356502 Ga0207691_103565022 149
165 3300025942 Ga0207689_10007948 Ga0207689_100079483 149
166 3300025944 Ga0207661_10020945 Ga0207661_100209452 149
167 3300025961 Ga0207712_10114582 Ga0207712_101145822 149
168 3300025972 Ga0207668_10292211 Ga0207668_102922112 149
169 3300026023 Ga0207677_10007045 Ga0207677_100070454 149
170 3300026035 Ga0207703_10538928 Ga0207703_105389281 149
171 3300026067 Ga0207678_10008384 Ga0207678_100083848 149
172 3300026095 Ga0207676_10226298 Ga0207676_102262982 149
173 3300026095 Ga0207676_12131149 Ga0207676_121311491 149
174 3300026116 Ga0207674_10011755 Ga0207674_1001175511 149
175 3300026118 Ga0207675_100062336 Ga0207675_1000623362 149
176 3300026121 Ga0207683_10265135 Ga0207683_102651352 149
177 3300026142 Ga0207698_10009322 Ga0207698_100093226 149
178 3300027907 Ga0207428_10045334 Ga0207428_100453342 149
179 3300031251 Ga0265327_10001202 Ga0265327_1000120226 149
180 3300031995 Ga0307409_101751865 Ga0307409_1017518652 149
181 3300042005 Ga0439448_0068660 Ga0439448_0068660_473_1003 149
182 3300042012 Ga0439455_0127814 Ga0439455_0127814_55_585 149
183 3300044658 Ga0466972_0201098 Ga0466972_0201098_60_509 149
184 3300044683 Ga0466965_0013604 Ga0466965_0013604_3071_3520 149
185 3300044684 Ga0466966_0150799 Ga0466966_0150799_380_835 149
186 3300044693 Ga0466961_0284417 Ga0466961_0284417_172_627 149
187 3300044694 Ga0466963_0000746 Ga0466963_0000746_11364_11819 149
188 3300044719 Ga0466971_0044054 Ga0466971_0044054_620_1075 149
189 3300044719 Ga0466971_0168980 Ga0466971_0168980_400_849 149
190 3300045049 Ga0466959_0297741 Ga0466959_0297741_11_460 149
191 3300045836 Ga0466958_0226349 Ga0466958_0226349_190_639 149
192 3300045976 Ga0466967_0021000 Ga0466967_0021000_4224_4679 149
193 3300050511 nmdc:mga08y16_2340_c1 nmdc:mga08y16_2340_c1_9466_9924 149
194 3300061719 Ga0466962_0119651 Ga0466962_0119651_256_711 149
195 3300005530 Ga0070679_101078056 Ga0070679_1010780561 150
196 3300005329 Ga0070683_100004032 Ga0070683_1000040326 151
197 3300005336 Ga0070680_100444577 Ga0070680_1004445772 151
198 3300005434 Ga0070709_10120250 Ga0070709_101202503 151
199 3300005435 Ga0070714_100055199 Ga0070714_1000551996 151
200 3300005458 Ga0070681_10144416 Ga0070681_101444163 151
201 3300005535 Ga0070684_100009574 Ga0070684_1000095746 151
202 3300005564 Ga0070664_100008041 Ga0070664_1000080415 151
203 3300005577 Ga0068857_100120255 Ga0068857_1001202553 151
204 3300005841 Ga0068863_100869076 Ga0068863_1008690762 151
205 3300006881 Ga0068865_101039225 Ga0068865_1010392251 151
206 3300010375 Ga0105239_11003579 Ga0105239_110035791 151
207 3300025919 Ga0207657_10605431 Ga0207657_106054311 151
208 3300025944 Ga0207661_10005545 Ga0207661_100055452 151
209 3300025944 Ga0207661_10138049 Ga0207661_101380492 151
210 3300025944 Ga0207661_10467924 Ga0207661_104679242 151
211 3300025945 Ga0207679_10020782 Ga0207679_100207824 151
212 3300031456 Ga0307513_10137512 Ga0307513_101375122 151
213 3300036401 Ga0373937_0810505 Ga0373937_0810505_311_766 151
214 3300037312 Ga0395899_0366228 Ga0395899_0366228_190_645 151
215 3300037418 Ga0395900_0886977 Ga0395900_0886977_121_576 151
216 3300037466 Ga0395898_0303135 Ga0395898_0303135_781_1236 151
217 3300038443 Ga0395901_0015035 Ga0395901_0015035_3679_4134 151
218 3300038443 Ga0395901_0565299 Ga0395901_0565299_360_815 151
219 3300046511 Ga0495608_0085992 Ga0495608_0085992_1068_1535 151
220 3300047319 Ga0495674_0641601 Ga0495674_0641601_269_736 151
221 3300000546 LJNas_1002574 LJNas_10025743 152
222 3300002459 JGI24751J29686_10037629 JGI24751J29686_100376291 152
223 3300005327 Ga0070658_10075952 Ga0070658_100759523 152
224 3300005328 Ga0070676_10035026 Ga0070676_100350263 152
225 3300005330 Ga0070690_100064092 Ga0070690_1000640924 152
226 3300005331 Ga0070670_100247887 Ga0070670_1002478871 152
227 3300005334 Ga0068869_100011554 Ga0068869_1000115544 152
228 3300005336 Ga0070680_100031757 Ga0070680_1000317572 152
229 3300005336 Ga0070680_100207465 Ga0070680_1002074653 152
230 3300005337 Ga0070682_100035063 Ga0070682_1000350632 152
231 3300005337 Ga0070682_100679482 Ga0070682_1006794822 152
232 3300005338 Ga0068868_100018832 Ga0068868_1000188325 152
233 3300005339 Ga0070660_100025891 Ga0070660_1000258915 152
234 3300005339 Ga0070660_100461398 Ga0070660_1004613982 152
235 3300005340 Ga0070689_100053262 Ga0070689_1000532625 152
236 3300005341 Ga0070691_10003850 Ga0070691_100038508 152
237 3300005344 Ga0070661_100021412 Ga0070661_1000214125 152
238 3300005345 Ga0070692_10011792 Ga0070692_100117925 152
239 3300005345 Ga0070692_10117170 Ga0070692_101171701 152
240 3300005354 Ga0070675_100011986 Ga0070675_1000119865 152
241 3300005355 Ga0070671_100020030 Ga0070671_1000200305 152
242 3300005364 Ga0070673_100228772 Ga0070673_1002287723 152
243 3300005366 Ga0070659_100071821 Ga0070659_1000718215 152
244 3300005436 Ga0070713_100601739 Ga0070713_1006017392 152
245 3300005437 Ga0070710_10624497 Ga0070710_106244972 152
246 3300005440 Ga0070705_100384621 Ga0070705_1003846212 152
247 3300005444 Ga0070694_100997868 Ga0070694_1009978681 152
248 3300005455 Ga0070663_100007414 Ga0070663_1000074147 152
249 3300005455 Ga0070663_100688950 Ga0070663_1006889501 152
250 3300005467 Ga0070706_100808693 Ga0070706_1008086931 152
251 3300005471 Ga0070698_100172818 Ga0070698_1001728182 152
252 3300005471 Ga0070698_100385142 Ga0070698_1003851422 152
253 3300005530 Ga0070679_100020226 Ga0070679_1000202267 152
254 3300005535 Ga0070684_100067837 Ga0070684_1000678375 152
255 3300005539 Ga0068853_100193104 Ga0068853_1001931044 152
256 3300005539 Ga0068853_100943278 Ga0068853_1009432782 152
257 3300005546 Ga0070696_100684793 Ga0070696_1006847932 152
258 3300005547 Ga0070693_100000998 Ga0070693_1000009985 152
259 3300005548 Ga0070665_100940384 Ga0070665_1009403842 152
260 3300005563 Ga0068855_100635798 Ga0068855_1006357981 152
261 3300005564 Ga0070664_101003488 Ga0070664_1010034881 152
262 3300005577 Ga0068857_100073408 Ga0068857_1000734081 152
263 3300005578 Ga0068854_100101973 Ga0068854_1001019735 152
264 3300005614 Ga0068856_100024301 Ga0068856_1000243014 152
265 3300005614 Ga0068856_100479029 Ga0068856_1004790292 152
266 3300005615 Ga0070702_100003496 Ga0070702_1000034966 152
267 3300005616 Ga0068852_100025246 Ga0068852_1000252465 152
268 3300005616 Ga0068852_101644917 Ga0068852_1016449171 152
269 3300005617 Ga0068859_100105543 Ga0068859_1001055432 152
270 3300005618 Ga0068864_100237582 Ga0068864_1002375822 152
271 3300005840 Ga0068870_10000205 Ga0068870_1000020513 152
272 3300005841 Ga0068863_100000995 Ga0068863_10000099527 152
273 3300005841 Ga0068863_100311055 Ga0068863_1003110552 152
274 3300005842 Ga0068858_100009187 Ga0068858_1000091877 152
275 3300005843 Ga0068860_100591126 Ga0068860_1005911262 152
276 3300005937 Ga0081455_10000632 Ga0081455_1000063232 152
277 3300006028 Ga0070717_10316440 Ga0070717_103164402 152
278 3300006058 Ga0075432_10037252 Ga0075432_100372524 152
279 3300006163 Ga0070715_10631775 Ga0070715_106317751 152
280 3300006175 Ga0070712_100090251 Ga0070712_1000902512 152
281 3300006175 Ga0070712_100390523 Ga0070712_1003905232 152
282 3300006237 Ga0097621_100020038 Ga0097621_1000200384 152
283 3300006358 Ga0068871_100002715 Ga0068871_1000027159 152
284 3300006844 Ga0075428_100003519 Ga0075428_10000351910 152
285 3300006846 Ga0075430_100001382 Ga0075430_10000138226 152
286 3300006847 Ga0075431_100104883 Ga0075431_1001048832 152
287 3300006847 Ga0075431_100152877 Ga0075431_1001528773 152
288 3300006852 Ga0075433_10037205 Ga0075433_100372052 152
289 3300006871 Ga0075434_100044508 Ga0075434_1000445086 152
290 3300006871 Ga0075434_100835035 Ga0075434_1008350352 152
291 3300006880 Ga0075429_100055991 Ga0075429_1000559912 152
292 3300006914 Ga0075436_100124356 Ga0075436_1001243563 152
293 3300006931 Ga0097620_100105539 Ga0097620_1001055392 152
294 3300007076 Ga0075435_100001141 Ga0075435_1000011417 152
295 3300007076 Ga0075435_100382684 Ga0075435_1003826842 152
296 3300009011 Ga0105251_10021893 Ga0105251_100218935 152
297 3300009093 Ga0105240_10879485 Ga0105240_108794851 152
298 3300009094 Ga0111539_10004003 Ga0111539_100040038 152
299 3300009098 Ga0105245_10070716 Ga0105245_100707165 152
300 3300009098 Ga0105245_10796199 Ga0105245_107961992 152
301 3300009101 Ga0105247_10209092 Ga0105247_102090922 152
302 3300009147 Ga0114129_10130546 Ga0114129_101305463 152
303 3300009147 Ga0114129_10411007 Ga0114129_104110073 152
304 3300009147 Ga0114129_10996156 Ga0114129_109961562 152
305 3300009148 Ga0105243_10092576 Ga0105243_100925765 152
306 3300009174 Ga0105241_10001623 Ga0105241_1000162313 152
307 3300009174 Ga0105241_11158919 Ga0105241_111589192 152
308 3300009177 Ga0105248_10368255 Ga0105248_103682552 152
309 3300009545 Ga0105237_10142168 Ga0105237_101421685 152
310 3300009545 Ga0105237_10644661 Ga0105237_106446612 152
311 3300009551 Ga0105238_10104504 Ga0105238_101045043 152
312 3300011119 Ga0105246_10013045 Ga0105246_100130455 152
313 3300013100 Ga0157373_10106452 Ga0157373_101064523 152
314 3300013102 Ga0157371_10013698 Ga0157371_100136985 152
315 3300013102 Ga0157371_10369553 Ga0157371_103695532 152
316 3300013104 Ga0157370_10061161 Ga0157370_100611615 152
317 3300013105 Ga0157369_10031349 Ga0157369_100313494 152
318 3300013105 Ga0157369_10274910 Ga0157369_102749102 152
319 3300013105 Ga0157369_10438450 Ga0157369_104384502 152
320 3300013296 Ga0157374_10002672 Ga0157374_1000267210 152
321 3300013306 Ga0163162_11020369 Ga0163162_110203692 152
322 3300013307 Ga0157372_10288696 Ga0157372_102886961 152
323 3300013307 Ga0157372_11064955 Ga0157372_110649551 152
324 3300013308 Ga0157375_10093050 Ga0157375_100930504 152
325 3300014325 Ga0163163_10475183 Ga0163163_104751832 152
326 3300014326 Ga0157380_10765841 Ga0157380_107658412 152
327 3300014745 Ga0157377_10005207 Ga0157377_100052077 152
328 3300014968 Ga0157379_10129329 Ga0157379_101293294 152
329 3300014969 Ga0157376_10107276 Ga0157376_101072764 152
330 3300020069 Ga0197907_11035920 Ga0197907_110359203 152
331 3300020070 Ga0206356_10644548 Ga0206356_106445485 152
332 3300020078 Ga0206352_10120848 Ga0206352_101208481 152
333 3300020080 Ga0206350_11415849 Ga0206350_114158492 152
334 3300020081 Ga0206354_10538699 Ga0206354_105386992 152
335 3300020081 Ga0206354_11541017 Ga0206354_115410172 152
336 3300020082 Ga0206353_11098035 Ga0206353_110980353 152
337 3300020082 Ga0206353_11947350 Ga0206353_119473503 152
338 3300025901 Ga0207688_10009057 Ga0207688_100090575 152
339 3300025905 Ga0207685_10161658 Ga0207685_101616581 152
340 3300025906 Ga0207699_10089606 Ga0207699_100896062 152
341 3300025908 Ga0207643_10000027 Ga0207643_1000002729 152
342 3300025909 Ga0207705_10054287 Ga0207705_100542875 152
343 3300025909 Ga0207705_10267814 Ga0207705_102678143 152
344 3300025910 Ga0207684_10628956 Ga0207684_106289562 152
345 3300025911 Ga0207654_10006227 Ga0207654_100062275 152
346 3300025913 Ga0207695_10302908 Ga0207695_103029082 152
347 3300025915 Ga0207693_10571712 Ga0207693_105717121 152
348 3300025917 Ga0207660_10288433 Ga0207660_102884332 152
349 3300025919 Ga0207657_10022302 Ga0207657_100223025 152
350 3300025919 Ga0207657_10464840 Ga0207657_104648402 152
351 3300025920 Ga0207649_10027820 Ga0207649_100278204 152
352 3300025921 Ga0207652_10052955 Ga0207652_100529552 152
353 3300025922 Ga0207646_10246257 Ga0207646_102462572 152
354 3300025924 Ga0207694_10141104 Ga0207694_101411042 152
355 3300025925 Ga0207650_10006536 Ga0207650_100065366 152
356 3300025926 Ga0207659_10017279 Ga0207659_100172794 152
357 3300025928 Ga0207700_10217019 Ga0207700_102170192 152
358 3300025928 Ga0207700_10404186 Ga0207700_104041862 152
359 3300025929 Ga0207664_10071772 Ga0207664_100717722 152
360 3300025931 Ga0207644_10081882 Ga0207644_100818822 152
361 3300025932 Ga0207690_10018617 Ga0207690_100186175 152
362 3300025932 Ga0207690_10239784 Ga0207690_102397843 152
363 3300025935 Ga0207709_10751303 Ga0207709_107513031 152
364 3300025939 Ga0207665_10007420 Ga0207665_100074205 152
365 3300025940 Ga0207691_10049666 Ga0207691_100496663 152
366 3300025941 Ga0207711_10846309 Ga0207711_108463091 152
367 3300025942 Ga0207689_10002095 Ga0207689_1000209511 152
368 3300025944 Ga0207661_10002523 Ga0207661_100025236 152
369 3300025945 Ga0207679_10034090 Ga0207679_100340902 152
370 3300025949 Ga0207667_10396314 Ga0207667_103963141 152
371 3300025981 Ga0207640_10045821 Ga0207640_100458212 152
372 3300025981 Ga0207640_10089744 Ga0207640_100897445 152
373 3300026023 Ga0207677_10214908 Ga0207677_102149083 152
374 3300026035 Ga0207703_10034895 Ga0207703_100348955 152
375 3300026041 Ga0207639_10214071 Ga0207639_102140714 152
376 3300026041 Ga0207639_11063781 Ga0207639_110637812 152
377 3300026067 Ga0207678_10004646 Ga0207678_1000464611 152
378 3300026067 Ga0207678_10510078 Ga0207678_105100782 152
379 3300026075 Ga0207708_10117074 Ga0207708_101170745 152
380 3300026078 Ga0207702_10016981 Ga0207702_100169816 152
381 3300026078 Ga0207702_10253614 Ga0207702_102536141 152
382 3300026088 Ga0207641_10200970 Ga0207641_102009703 152
383 3300026095 Ga0207676_10002272 Ga0207676_1000227211 152
384 3300026121 Ga0207683_10005627 Ga0207683_100056279 152
385 3300026142 Ga0207698_10007399 Ga0207698_100073996 152
386 3300027907 Ga0207428_10002110 Ga0207428_1000211017 152
387 3300027907 Ga0207428_10031094 Ga0207428_100310945 152
388 3300028379 Ga0268266_10182411 Ga0268266_101824112 152
389 3300028381 Ga0268264_11359980 Ga0268264_113599801 152
390 3300031548 Ga0307408_100137283 Ga0307408_1001372832 152
391 3300031616 Ga0307508_10040474 Ga0307508_100404743 152
392 3300031995 Ga0307409_101935415 Ga0307409_1019354151 152
393 3300035172 Ga0373955_0103558 Ga0373955_0103558_1117_1575 152
394 3300037312 Ga0395899_0581038 Ga0395899_0581038_70_534 152
395 3300037466 Ga0395898_0881265 Ga0395898_0881265_176_643 152
396 3300037466 Ga0395898_1407001 Ga0395898_1407001_57_521 152
397 3300037853 Ga0436364_0714158 Ga0436364_0714158_6880_7407 152
398 3300038443 Ga0395901_0095030 Ga0395901_0095030_2558_3022 152
399 3300039450 Ga0436363_0644605 Ga0436363_0644605_804_1262 152
400 3300041459 Ga0451800_0063750 Ga0451800_0063750_62_520 152
401 3300041505 Ga0451849_0284701 Ga0451849_0284701_35_502 152
402 3300042005 Ga0439448_0007604 Ga0439448_0007604_645_1112 152
403 3300042012 Ga0439455_0064341 Ga0439455_0064341_488_955 152
404 3300042016 Ga0439463_176093 Ga0439463_176093_45_512 152
405 3300042438 Ga0439459_0005843 Ga0439459_0005843_782_1249 152
406 3300042439 Ga0439464_0095644 Ga0439464_0095644_344_811 152
407 3300044693 Ga0466961_0454736 Ga0466961_0454736_187_675 152
408 3300044694 Ga0466963_0172302 Ga0466963_0172302_262_744 152
409 3300044842 Ga0466957_0110760 Ga0466957_0110760_1052_1567 152
410 3300045049 Ga0466959_0263478 Ga0466959_0263478_668_1141 152
411 3300045836 Ga0466958_0042713 Ga0466958_0042713_235_732 152
412 3300046477 Ga0495664_0154420 Ga0495664_0154420_631_1089 152
413 3300046529 Ga0495652_0390050 Ga0495652_0390050_49_507 152
414 3300046536 Ga0495587_0181460 Ga0495587_0181460_536_994 152
415 3300046543 Ga0495645_0217147 Ga0495645_0217147_52_510 152
416 3300046559 Ga0495667_0572824 Ga0495667_0572824_88_546 152
417 3300047317 Ga0495604_0047711 Ga0495604_0047711_2045_2503 152
418 3300047471 Ga0495684_0106952 Ga0495684_0106952_275_733 152
419 3300048907 Ga0496104_0001624 Ga0496104_0001624_2450_2917 152
420 3300048908 Ga0496105_0013602 Ga0496105_0013602_2905_3372 152
421 3300048909 Ga0496106_0004722 Ga0496106_0004722_3078_3545 152
422 3300048911 Ga0496108_0027215 Ga0496108_0027215_2431_2898 152
423 3300048912 Ga0496109_0031996 Ga0496109_0031996_528_995 152
424 3300048913 Ga0496110_0035738 Ga0496110_0035738_656_1123 152
425 3300048914 Ga0496111_0220410 Ga0496111_0220410_34_501 152
426 3300048915 Ga0496112_0060379 Ga0496112_0060379_960_1427 152
427 3300048915 Ga0496112_0208314 Ga0496112_0208314_489_947 152
428 3300048915 Ga0496112_0643737 Ga0496112_0643737_82_549 152
429 3300048916 Ga0496113_0020783 Ga0496113_0020783_3224_3691 152
430 3300048918 Ga0496115_0154229 Ga0496115_0154229_1291_1758 152
431 3300048918 Ga0496115_0334625 Ga0496115_0334625_608_1075 152
432 3300050507 nmdc:mga05p37_184_c1 nmdc:mga05p37_184_c1_3098_3577 152
433 3300050507 nmdc:mga05p37_206194_c1 nmdc:mga05p37_206194_c1_879_1346 152
434 3300050507 nmdc:mga05p37_362408_c1 nmdc:mga05p37_362408_c1_845_1324 152
435 3300050508 nmdc:mga09592_123223_c1 nmdc:mga09592_123223_c1_1024_1491 152
436 3300050508 nmdc:mga09592_3640_c1 nmdc:mga09592_3640_c1_10215_10694 152
437 3300050509 nmdc:mga0qj67_240171_c1 nmdc:mga0qj67_240171_c1_430_909 152
438 3300050510 nmdc:mga06r32_150364_c1 nmdc:mga06r32_150364_c1_1223_1681 152
439 3300050510 nmdc:mga06r32_219803_c1 nmdc:mga06r32_219803_c1_1305_1772 152
440 3300050510 nmdc:mga06r32_56630_c1 nmdc:mga06r32_56630_c1_1834_2313 152
441 3300050511 nmdc:mga08y16_15196_c1 nmdc:mga08y16_15196_c1_4065_4532 152
442 3300050511 nmdc:mga08y16_5543_c1 nmdc:mga08y16_5543_c1_5186_5665 152
443 3300050512 nmdc:mga0n895_762720_c1 nmdc:mga0n895_762720_c1_208_687 152
444 3300050513 nmdc:mga0rr50_10260_c1 nmdc:mga0rr50_10260_c1_1930_2397 152
445 3300050513 nmdc:mga0rr50_905616_c1 nmdc:mga0rr50_905616_c1_141_620 152
446 3300050514 nmdc:mga08x19_51974_c1 nmdc:mga08x19_51974_c1_1573_2040 152
447 3300050515 nmdc:mga0a205_31640_c1 nmdc:mga0a205_31640_c1_3737_4204 152
448 3300050515 nmdc:mga0a205_465796_c1 nmdc:mga0a205_465796_c1_495_974 152
449 3300050516 nmdc:mga0sz30_4639_c1 nmdc:mga0sz30_4639_c1_2535_3011 152
450 3300053077 Ga0495601_0254731 Ga0495601_0254731_669_1127 152
451 3300053153 Ga0500616_0016878 Ga0500616_0016878_2071_2574 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

51

182

0.73

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

41

182

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8104 10 150
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.803 10 150
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7737 10 150
3ni8-assembly1.cif.gz_A crystal structure of pfc0360w, an hsp90 activator from plasmodium falciparum 0.761 10 117
1xn6-assembly1.cif.gz_A solution structure of northeast structural genomics target protein bcr68 encoded in gene q816v6 of b. cereus 0.7589 12 150
ID Description Score Start End Superfamily
af_P9WM73_75_221_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8273 9 150 3.30.530.20
af_P9WM73_75_221_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7962 9 150 3.30.530.20
af_P9WL87_17_165_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7646 10 150 3.30.530.20
3ni8A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.761 10 117 3.30.530.20
1xn6A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7589 12 150 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7I7T4B3-F1-model_v4 Polyketide cyclase 0.9984 6 152
AF-A0A828TAN3-F1-model_v4 deleted 0.998 2 152
AF-A0A144MJY5-F1-model_v4 Polyketide cyclase 0.998 9 150
AF-A0A4U8W3A6-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9967 11 151
AF-W9BLC7-F1-model_v4 TetR family transcriptional regulator 0.9964 8 149

Feature Viewer

pLDDT pTM Quality
93.23 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map