F446763

General Info

Members Datasets Scaffolds Average Seq Length
451 345 375 155

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10147258|Ga0099794_101472582
Length 177
Sequence MQLHIAVIGETSCPVRKDAMVKRTSLEKAECPIARSLDAIGDWWSLLIIRDALMGINRFSEFQKHIGLAKNILTVRLRALVDHGILKTAPAADGSAYQEYVLTPKGRGVFPVLVALRQWSEEFGGEPDGFPTLLVDRGKGRPVRKLELRSADGRLLGIGDTEVRANPGVKRRRRVLA

Samples

Sample ID Description Type Environment
1 2511231004 Pseudomonas sp. GM102 Isolate Nodule
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231018 Pseudomonas sp. GM60 Isolate Nodule
4 2511231022 Pseudomonas sp. GM79 Isolate Nodule
5 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
10 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
11 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
12 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
13 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
14 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
15 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
16 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
17 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
18 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
19 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
20 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
21 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
22 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
23 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
24 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
25 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
26 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
27 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
28 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
29 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
30 2643221651 Afipia sp. Root123D2 Isolate Unclassified
31 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
32 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
33 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
34 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
35 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
36 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
37 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
38 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
39 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
40 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
41 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
42 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
43 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
44 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
45 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
46 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
47 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
48 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
49 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
50 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
51 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
52 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
53 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
54 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
55 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
56 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
57 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
58 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
59 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
60 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
61 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
62 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
63 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
64 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
65 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
66 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
67 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
68 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
69 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
70 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
73 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
74 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
75 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
76 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
77 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
78 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
86 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
95 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
98 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
99 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
152 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
153 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
184 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
187 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
188 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
189 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
190 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
191 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
204 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
269 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
270 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
274 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
296 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
317 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
318 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
319 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
320 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
321 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
322 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
323 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
324 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
325 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
326 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
327 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
328 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
329 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
330 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
334 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
335 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
336 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
337 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
338 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
339 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
340 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
341 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
342 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
343 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
344 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
345 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.15
Metatranscriptomes 0
Isolates 16.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.63
Nodule 6.21
Rhizoplane 6.43
Rhizosphere 62.31
Stem 0
Stem Tuber 0
Unclassified 10.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000095 3300002737 Bacteria 98329
2 JGI25163J39215_1000303 3300002771 Bacteria 16649
3 JGI25164J39214_1000069 3300002772 Bacteria 103125
4 JGI25151J46595_10015502 3300003187 Bacteria 3354
5 JGI25165J46597_1000168 3300003214 Bacteria 103125
6 JGI25153J46596_10001025 3300003215 Bacteria 16999
7 JGI25153J46596_10106197 3300003215 Bacteria 652
8 Ga0055526_1060592 3300003771 Bacteria 809
9 Ga0055524_1004374 3300003775 Bacteria 6524
10 Ga0055536_1000082 3300003781 Bacteria 81873
11 Ga0055528_1001797 3300003790 Bacteria 12295
12 Ga0055530_10000124 3300003791 Bacteria 66816
13 Ga0055540_1000467 3300003792 Bacteria 31316
14 Ga0055531_10005197 3300003794 Bacteria 7659
15 Ga0065165_1004734 3300005262 Bacteria 8166
16 Ga0065165_1005082 3300005262 Bacteria 7644
17 Ga0070658_10204895 3300005327 Bacteria 1665
18 Ga0070680_100242876 3300005336 Bacteria 1522
19 Ga0070682_100296628 3300005337 Bacteria 1184
20 Ga0068868_100545915 3300005338 Bacteria 1021
21 Ga0068868_101843410 3300005338 Bacteria 572
22 Ga0070668_100256123 3300005347 Bacteria 1454
23 Ga0070706_100235219 3300005467 Bacteria 1710
24 Ga0070706_100275372 3300005467 Bacteria 1570
25 Ga0070706_101678057 3300005467 Bacteria 579
26 Ga0070707_100648203 3300005468 Bacteria 1019
27 Ga0070699_100378425 3300005518 Bacteria 1278
28 Ga0070679_100075610 3300005530 Bacteria 3357
29 Ga0070697_100419363 3300005536 Bacteria 1163
30 Ga0068853_100145819 3300005539 Bacteria 2127
31 Ga0068853_100411253 3300005539 Bacteria 1267
32 Ga0068855_100153492 3300005563 Bacteria 2617
33 Ga0068855_100537150 3300005563 Bacteria 1267
34 Ga0068857_100208430 3300005577 Bacteria 1783
35 Ga0068856_100000427 3300005614 Bacteria 46259
36 Ga0081455_10484354 3300005937 Bacteria 835
37 Ga0075432_10009635 3300006058 Bacteria 3288
38 Ga0070716_100622497 3300006173 Bacteria 815
39 Ga0099825_1028003 3300006941 Bacteria 2798
40 Ga0099824_1007084 3300006942 Bacteria 15049
41 Ga0099822_1001392 3300006943 Bacteria 27954
42 Ga0099794_10013241 3300007265 Bacteria 3585
43 Ga0099794_10026161 3300007265 Bacteria 2695
44 Ga0099794_10147258 3300007265 Bacteria 1194
45 Ga0099795_10039243 3300007788 Bacteria 1675
46 Ga0099795_10128740 3300007788 Bacteria 1019
47 Ga0099795_10530526 3300007788 Bacteria 552
48 Ga0105244_10029666 3300009036 Bacteria 2919
49 Ga0105250_10020026 3300009092 Bacteria 2705
50 Ga0105240_11383508 3300009093 Bacteria 740
51 Ga0105243_10000570 3300009148 Bacteria 37174
52 Ga0105243_10106930 3300009148 Bacteria 2333
53 Ga0105237_10064347 3300009545 Bacteria 3664
54 Ga0105249_10152930 3300009553 Bacteria 2223
55 Ga0105249_11270170 3300009553 Bacteria 808
56 Ga0099796_10009094 3300010159 Bacteria 2675
57 Ga0099796_10340208 3300010159 Bacteria 645
58 Ga0157373_10026664 3300013100 Bacteria 4171
59 Ga0157371_10001096 3300013102 Bacteria 29365
60 Ga0157371_10116147 3300013102 Bacteria 1901
61 Ga0157369_10139016 3300013105 Bacteria 2571
62 Ga0157374_10147436 3300013296 Bacteria 2286
63 Ga0157374_11132615 3300013296 Bacteria 803
64 Ga0163162_10130463 3300013306 Bacteria 2622
65 Ga0163162_10154756 3300013306 Bacteria 2412
66 Ga0157375_10766855 3300013308 Bacteria 1115
67 Ga0182008_10001418 3300014497 Bacteria 16074
68 Ga0182008_10048731 3300014497 Bacteria 2104
69 Ga0182008_10089624 3300014497 Bacteria 1516
70 Ga0182006_1000785 3300015261 Bacteria 21404
71 Ga0182007_10000182 3300015262 Bacteria 42974
72 Ga0182007_10011976 3300015262 Bacteria 3351
73 Ga0182007_10172909 3300015262 Bacteria 744
74 Ga0182005_1000622 3300015265 Bacteria 17081
75 Ga0163161_10050021 3300017792 Bacteria 3023
76 Ga0163161_10122971 3300017792 Bacteria 1951
77 Ga0213876_10154659 3300021384 Bacteria 1220
78 Ga0209760_100018 3300025207 Bacteria 172833
79 Ga0207427_100015 3300025231 Bacteria 542133
80 Ga0209437_100027 3300025233 Bacteria 542133
81 Ga0209129_1000140 3300025258 Bacteria 122574
82 Ga0209233_1000039 3300025261 Bacteria 542133
83 Ga0209233_1005867 3300025261 Bacteria 4029
84 Ga0209673_1000068 3300025273 Bacteria 245891
85 Ga0209676_1000017 3300025292 Bacteria 643409
86 Ga0209025_1003243 3300025294 Bacteria 15691
87 Ga0209025_1005069 3300025294 Bacteria 10967
88 Ga0209564_1013582 3300025295 Bacteria 3443
89 Ga0209758_1000100 3300025297 Bacteria 227948
90 Ga0209758_1023046 3300025297 Bacteria 2831
91 Ga0209758_1065808 3300025297 Bacteria 1167
92 Ga0209758_1074199 3300025297 Bacteria 1056
93 Ga0209050_1000371 3300025298 Bacteria 85791
94 Ga0209256_1001101 3300025299 Bacteria 31081
95 Ga0209256_1007360 3300025299 Bacteria 5466
96 Ga0207426_1088438 3300025302 Bacteria 825
97 Ga0209051_1000234 3300025303 Bacteria 92914
98 Ga0209257_1001443 3300025304 Bacteria 28086
99 Ga0209257_1028072 3300025304 Bacteria 1859
100 Ga0209257_1073781 3300025304 Bacteria 892
101 Ga0207696_1025142 3300025711 Bacteria 1860
102 Ga0207655_1001852 3300025728 Bacteria 18277
103 Ga0207655_1009607 3300025728 Bacteria 5989
104 Ga0207705_10103469 3300025909 Bacteria 2097
105 Ga0207684_10110480 3300025910 Bacteria 2353
106 Ga0207684_10803375 3300025910 Bacteria 795
107 Ga0207684_11121851 3300025910 Bacteria 654
108 Ga0207693_10124907 3300025915 Bacteria 2022
109 Ga0207657_10011877 3300025919 Bacteria 8621
110 Ga0207652_10218447 3300025921 Bacteria 1717
111 Ga0207690_10846166 3300025932 Bacteria 757
112 Ga0207709_10004792 3300025935 Bacteria 7753
113 Ga0207665_10277012 3300025939 Bacteria 1247
114 Ga0207667_10149085 3300025949 Bacteria 2408
115 Ga0207667_11871323 3300025949 Bacteria 563
116 Ga0207712_10368643 3300025961 Bacteria 1198
117 Ga0207640_10033862 3300025981 Bacteria 3183
118 Ga0207639_10209618 3300026041 Bacteria 1676
119 Ga0207702_10002256 3300026078 Bacteria 18481
120 Ga0207702_11699766 3300026078 Bacteria 624
121 Ga0209589_1000023 3300027357 Bacteria 177856
122 Ga0209489_100032 3300027361 Bacteria 177856
123 Ga0209700_100040 3300027363 Bacteria 177856
124 Ga0209588_1077496 3300027671 Bacteria 1074
125 Ga0209588_1085073 3300027671 Bacteria 1021
126 Ga0207428_10119101 3300027907 Bacteria 2026
127 Ga0265330_10099481 3300031235 Bacteria 1245
128 Ga0265316_10125149 3300031344 Bacteria 1939
129 Ga0307509_10188086 3300031507 Bacteria 1920
130 Ga0307508_10080181 3300031616 Bacteria 2846
131 Ga0265314_10003900 3300031711 Bacteria 14176
132 Ga0265314_10192895 3300031711 Bacteria 1211
133 Ga0265342_10099438 3300031712 Bacteria 1659
134 Ga0307414_10631406 3300032004 Bacteria 964
135 Ga0307510_10002011 3300033180 Bacteria 22938
136 Ga0307510_10005745 3300033180 Bacteria 14788
137 Ga0315911_1000029 3300033442 Bacteria 82350
138 Ga0373926_0005258 3300035083 Bacteria 4260
139 Ga0373926_0062252 3300035083 Bacteria 1362
140 Ga0373944_0196151 3300035089 Bacteria 729
141 Ga0373923_0004116 3300035111 Bacteria 4785
142 Ga0373923_0022318 3300035111 Bacteria 2481
143 Ga0373936_0018274 3300035113 Bacteria 2706
144 Ga0373936_0030449 3300035113 Bacteria 2128
145 Ga0373936_0171334 3300035113 Bacteria 949
146 Ga0373945_0023264 3300035116 Bacteria 2140
147 Ga0373945_0028357 3300035116 Bacteria 1961
148 Ga0373953_0049978 3300035117 Bacteria 1688
149 Ga0373954_0180581 3300035118 Bacteria 1035
150 Ga0373957_0092946 3300035120 Bacteria 1201
151 Ga0373943_0010440 3300035170 Bacteria 4161
152 Ga0373943_0014191 3300035170 Bacteria 3603
153 Ga0373943_0553490 3300035170 Bacteria 675
154 Ga0373946_0003822 3300035171 Bacteria 5346
155 Ga0373931_0790525 3300035691 Bacteria 632
156 Ga0373935_0006298 3300035692 Bacteria 7070
157 Ga0373935_0168839 3300035692 Bacteria 1495
158 Ga0373927_0000689 3300035695 Bacteria 25810
159 Ga0373927_0059006 3300035695 Bacteria 2482
160 Ga0373927_0161150 3300035695 Bacteria 1469
161 Ga0373933_0037909 3300035724 Bacteria 2830
162 Ga0373947_0002567 3300035725 Bacteria 10914
163 Ga0373947_0036502 3300035725 Bacteria 2914
164 Ga0373937_0002165 3300036401 Bacteria 16456
165 Ga0373937_0432331 3300036401 Bacteria 1249
166 Ga0373925_0003101 3300037068 Bacteria 13044
167 Ga0373925_0009228 3300037068 Bacteria 7180
168 Ga0395901_1206137 3300038443 Bacteria 722
169 Ga0439447_009467 3300041407 Bacteria 2949
170 Ga0439466_0000223 3300041411 Bacteria 22390
171 Ga0439466_0013830 3300041411 Bacteria 2949
172 Ga0439465_0053449 3300041413 Bacteria 1327
173 Ga0439451_080902 3300042009 Bacteria 652
174 Ga0439452_020791 3300042010 Bacteria 1717
175 Ga0439456_000028 3300042013 Bacteria 53976
176 Ga0439456_025599 3300042013 Bacteria 1253
177 Ga0439456_031413 3300042013 Bacteria 1138
178 Ga0439463_000157 3300042016 Bacteria 17433
179 Ga0450903_031820 3300042138 Bacteria 795
180 Ga0450907_000071 3300042146 Bacteria 39081
181 Ga0439446_0023532 3300042156 Bacteria 1753
182 Ga0450909_001772 3300042185 Bacteria 3038
183 Ga0439434_0001048 3300042435 Bacteria 8014
184 Ga0439440_0011850 3300042993 Bacteria 1845
185 Ga0439440_0062630 3300042993 Bacteria 952
186 Ga0466972_0033287 3300044658 Bacteria 2528
187 Ga0466963_0284304 3300044694 Bacteria 1163
188 Ga0466968_0023052 3300044735 Bacteria 2534
189 Ga0466967_0179791 3300045976 Bacteria 1995
190 Ga0466967_0786516 3300045976 Bacteria 944
191 Ga0495617_023586 3300046452 Bacteria 2078
192 Ga0495592_0022417 3300046454 Bacteria 4805
193 Ga0495592_0102460 3300046454 Bacteria 2038
194 Ga0495603_0001582 3300046455 Bacteria 13328
195 Ga0495603_0046296 3300046455 Bacteria 2592
196 Ga0495590_0004815 3300046457 Bacteria 5407
197 Ga0495591_015234 3300046458 Bacteria 2725
198 Ga0495629_0001500 3300046459 Bacteria 18364
199 Ga0495638_0098889 3300046460 Bacteria 1747
200 Ga0495641_0019862 3300046461 Bacteria 3424
201 Ga0495641_0073247 3300046461 Bacteria 1537
202 Ga0495653_0192973 3300046463 Bacteria 1388
203 Ga0495650_0013397 3300046471 Bacteria 4337
204 Ga0495580_0017445 3300046472 Bacteria 5370
205 Ga0495580_0026091 3300046472 Bacteria 4263
206 Ga0495582_0001498 3300046473 Bacteria 13187
207 Ga0495582_0096896 3300046473 Bacteria 1649
208 Ga0495605_0055964 3300046474 Bacteria 1903
209 Ga0495639_0002214 3300046475 Bacteria 8558
210 Ga0495639_0010545 3300046475 Bacteria 3980
211 Ga0495662_0022039 3300046476 Bacteria 3077
212 Ga0495664_0020455 3300046477 Bacteria 3817
213 Ga0495664_0053599 3300046477 Bacteria 2398
214 Ga0495584_0001433 3300046491 Bacteria 14353
215 Ga0495584_0205679 3300046491 Bacteria 1000
216 Ga0495585_0003679 3300046492 Bacteria 10251
217 Ga0495594_0002146 3300046499 Bacteria 10267
218 Ga0495607_0010965 3300046501 Bacteria 6061
219 Ga0495583_0000918 3300046506 Bacteria 34803
220 Ga0495583_0010664 3300046506 Bacteria 5341
221 Ga0495608_0185300 3300046511 Bacteria 1316
222 Ga0495616_0004213 3300046513 Bacteria 9106
223 Ga0495618_0312617 3300046514 Bacteria 974
224 Ga0495628_0041912 3300046516 Bacteria 3653
225 Ga0495630_0002211 3300046517 Bacteria 13546
226 Ga0495630_0057885 3300046517 Bacteria 2905
227 Ga0495631_0164599 3300046518 Bacteria 951
228 Ga0495632_0003436 3300046519 Bacteria 11242
229 Ga0495637_0013956 3300046520 Bacteria 3801
230 Ga0495643_0031707 3300046522 Bacteria 2939
231 Ga0495643_0215864 3300046522 Bacteria 913
232 Ga0495644_0019366 3300046523 Bacteria 2599
233 Ga0495648_0076129 3300046524 Bacteria 1927
234 Ga0495666_0021904 3300046526 Bacteria 3164
235 Ga0495666_0042977 3300046526 Bacteria 2184
236 Ga0495652_0043460 3300046529 Bacteria 3870
237 Ga0495654_0164255 3300046530 Bacteria 972
238 Ga0495665_0003724 3300046531 Bacteria 8266
239 Ga0495640_0011188 3300046533 Bacteria 6908
240 Ga0495640_0016796 3300046533 Bacteria 5471
241 Ga0495586_0234979 3300046535 Bacteria 1044
242 Ga0495587_0035212 3300046536 Bacteria 3017
243 Ga0495609_0006680 3300046538 Bacteria 5855
244 Ga0495622_0007988 3300046557 Bacteria 4906
245 Ga0495634_0001270 3300046642 Bacteria 23127
246 Ga0495634_0035380 3300046642 Bacteria 3421
247 Ga0495611_0208497 3300046648 Bacteria 910
248 Ga0495625_0366772 3300046660 Bacteria 906
249 Ga0495635_0015274 3300046663 Bacteria 5372
250 Ga0495635_0043334 3300046663 Bacteria 3106
251 Ga0495659_0023237 3300046664 Bacteria 2105
252 Ga0495661_0207106 3300046665 Bacteria 1023
253 Ga0495588_0002635 3300046674 Bacteria 7683
254 Ga0495657_0151918 3300046675 Bacteria 1437
255 Ga0495599_0139554 3300046678 Bacteria 1503
256 Ga0495646_0053215 3300046680 Bacteria 2441
257 Ga0495646_0073374 3300046680 Bacteria 2010
258 Ga0495647_0000649 3300046681 Bacteria 10310
259 Ga0495658_0001998 3300046683 Bacteria 10393
260 Ga0495669_0036836 3300046684 Bacteria 2163
261 Ga0495613_0004899 3300046689 Bacteria 10058
262 Ga0495624_0015721 3300046690 Bacteria 5103
263 Ga0495670_0023497 3300046691 Bacteria 3042
264 Ga0495671_0174169 3300046692 Bacteria 1045
265 Ga0495589_0026195 3300046794 Bacteria 2955
266 Ga0495660_0013918 3300046810 Bacteria 4663
267 Ga0495660_0051708 3300046810 Bacteria 2234
268 Ga0495581_0005949 3300047315 Bacteria 7070
269 Ga0495581_0119835 3300047315 Bacteria 1531
270 Ga0495604_0286443 3300047317 Bacteria 1111
271 Ga0495636_0057465 3300047318 Bacteria 1638
272 Ga0495674_0001148 3300047319 Bacteria 25513
273 Ga0495674_0009113 3300047319 Bacteria 9428
274 Ga0495672_0037691 3300047320 Bacteria 2955
275 Ga0495676_0014823 3300047321 Bacteria 6960
276 Ga0495683_0046046 3300047323 Bacteria 2189
277 Ga0495683_0046800 3300047323 Bacteria 2171
278 Ga0495677_0002617 3300047445 Bacteria 7042
279 Ga0495679_021304 3300047446 Bacteria 2241
280 Ga0495685_094385 3300047447 Bacteria 990
281 Ga0495673_0001330 3300047469 Bacteria 20066
282 Ga0495673_0017045 3300047469 Bacteria 3698
283 Ga0495673_0041944 3300047469 Bacteria 2057
284 Ga0495684_0010447 3300047471 Bacteria 7180
285 Ga0495684_0087639 3300047471 Bacteria 2359
286 Ga0495593_0023156 3300047673 Bacteria 3454
287 Ga0495593_0231489 3300047673 Bacteria 926
288 Ga0495614_0081522 3300048089 Bacteria 1402
289 Ga0495626_0004695 3300048091 Bacteria 8285
290 Ga0496104_0572277 3300048907 Bacteria 1040
291 Ga0496106_0000705 3300048909 Bacteria 24064
292 Ga0496108_0563532 3300048911 Bacteria 993
293 Ga0496109_0016445 3300048912 Bacteria 6468
294 Ga0496110_0150665 3300048913 Bacteria 2106
295 Ga0496111_0036632 3300048914 Bacteria 3508
296 Ga0496112_0286244 3300048915 Bacteria 1594
297 Ga0496114_0273387 3300048917 Bacteria 1489
298 Ga0496115_0321669 3300048918 Bacteria 1265
299 Ga0496115_1029353 3300048918 Bacteria 628
300 Ga0496116_0000514 3300048919 Bacteria 52327
301 Ga0496116_0315352 3300048919 Bacteria 735
302 Ga0496117_0001404 3300048920 Bacteria 34972
303 Ga0496117_0065944 3300048920 Bacteria 2458
304 Ga0496118_0009033 3300048921 Bacteria 10161
305 Ga0496118_0065350 3300048921 Bacteria 2662
306 Ga0496118_0118106 3300048921 Bacteria 1738
307 Ga0496119_0010805 3300048922 Bacteria 7640
308 Ga0496120_0072282 3300048923 Bacteria 1890
309 Ga0496121_0000034 3300048924 Bacteria 377095
310 Ga0496121_0000955 3300048924 Bacteria 52253
311 Ga0496121_0399934 3300048924 Bacteria 900
312 Ga0496121_0455143 3300048924 Bacteria 824
313 Ga0496122_0002553 3300048925 Bacteria 25577
314 Ga0496123_0001630 3300048926 Bacteria 30236
315 Ga0496124_0015709 3300048927 Bacteria 7238
316 Ga0496124_0020627 3300048927 Bacteria 6083
317 Ga0496124_0248179 3300048927 Bacteria 1318
318 Ga0496125_0000030 3300048928 Bacteria 375023
319 Ga0496126_0029296 3300048929 Bacteria 5231
320 Ga0496126_0092020 3300048929 Bacteria 2665
321 Ga0496126_0219667 3300048929 Bacteria 1597
322 Ga0496126_0297124 3300048929 Bacteria 1334
323 Ga0496126_0754232 3300048929 Bacteria 751
324 Ga0495678_020297 3300049459 Bacteria 2946
325 Ga0495678_021260 3300049459 Bacteria 2860
326 Ga0495678_037109 3300049459 Bacteria 1983
327 Ga0495678_098129 3300049459 Bacteria 1019
328 Ga0495682_0026715 3300049460 Bacteria 2141
329 Ga0501033_0051177 3300049570 Bacteria 3061
330 Ga0501033_0053026 3300049570 Bacteria 3004
331 Ga0501034_0362062 3300049571 Bacteria 1377
332 Ga0501037_0154048 3300049573 Bacteria 1641
333 Ga0501043_0194667 3300049579 Bacteria 1575
334 Ga0501047_0073966 3300049581 Bacteria 3280
335 Ga0501048_0349285 3300049582 Bacteria 1055
336 Ga0501067_0106520 3300049583 Bacteria 1558
337 Ga0501069_0140436 3300049585 Bacteria 1386
338 Ga0501070_0241832 3300049586 Bacteria 1477
339 Ga0501070_0773978 3300049586 Bacteria 755
340 Ga0501079_1035943 3300049741 Bacteria 646
341 Ga0501080_0403041 3300049742 Bacteria 1230
342 Ga0501035_0239006 3300049822 Bacteria 1545
343 Ga0501044_0510446 3300049823 Bacteria 1102
344 nmdc:mga00v17_49881_c1 3300050491 Bacteria 2541
345 Ga0495601_0037763 3300053077 Bacteria 3019
346 Ga0495612_0083194 3300053078 Bacteria 1347
347 Ga0495612_0086302 3300053078 Bacteria 1324
348 Ga0495619_0210527 3300053085 Bacteria 1346
349 Ga0495619_0666502 3300053085 Bacteria 709
350 Ga0500643_000025 3300053087 Bacteria 259605
351 Ga0500566_0000516 3300053094 Bacteria 21571
352 Ga0500640_002117 3300053095 Bacteria 6424
353 Ga0500554_067632 3300053102 Bacteria 1157
354 Ga0500556_0141421 3300053104 Bacteria 946
355 Ga0500572_000055 3300053111 Bacteria 34260
356 Ga0500572_005070 3300053111 Bacteria 2981
357 Ga0500591_068279 3300053115 Bacteria 1618
358 Ga0500608_006046 3300053122 Bacteria 4882
359 Ga0500614_002236 3300053123 Bacteria 4369
360 Ga0500618_001381 3300053125 Bacteria 10986
361 Ga0500618_105602 3300053125 Bacteria 635
362 Ga0500559_0238228 3300053136 Bacteria 857
363 Ga0500589_144695 3300053147 Bacteria 975
364 Ga0500590_074139 3300053148 Bacteria 1686
365 Ga0500590_104301 3300053148 Bacteria 1356
366 Ga0500603_000052 3300053150 Bacteria 28617
367 Ga0500603_001546 3300053150 Bacteria 5227
368 Ga0500630_001061 3300053159 Bacteria 12856
369 Ga0500638_104094 3300053162 Bacteria 1320
370 Ga0500639_000004 3300053163 Bacteria 216921
371 Ga0500636_0002532 3300053177 Bacteria 10151
372 Ga0500637_0058314 3300053178 Bacteria 2208
373 Ga0500596_004634 3300053735 Bacteria 2505
374 Ga0500601_002675 3300053737 Bacteria 1915
375 Ga0500601_016275 3300053737 Bacteria 848

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8017057580 8017061959 131
2 3300045976 Ga0466967_0179791 Ga0466967_0179791_154_639 135
3 iso_pu_bacteria 2643221651 2644288143 137
4 3300049585 Ga0501069_0140436 Ga0501069_0140436_245_685 140
5 3300049586 Ga0501070_0773978 Ga0501070_0773978_43_495 140
6 3300048929 Ga0496126_0029296 Ga0496126_0029296_2081_2539 141
7 3300005327 Ga0070658_10204895 Ga0070658_102048952 142
8 3300005336 Ga0070680_100242876 Ga0070680_1002428761 142
9 3300005530 Ga0070679_100075610 Ga0070679_1000756103 142
10 3300005539 Ga0068853_100145819 Ga0068853_1001458192 142
11 3300005563 Ga0068855_100153492 Ga0068855_1001534923 142
12 3300005577 Ga0068857_100208430 Ga0068857_1002084302 142
13 3300009036 Ga0105244_10029666 Ga0105244_100296662 142
14 3300013100 Ga0157373_10026664 Ga0157373_100266643 142
15 3300014497 Ga0182008_10089624 Ga0182008_100896242 142
16 3300015261 Ga0182006_1000785 Ga0182006_10007852 142
17 3300015262 Ga0182007_10000182 Ga0182007_100001828 142
18 3300015265 Ga0182005_1000622 Ga0182005_100062213 142
19 3300025909 Ga0207705_10103469 Ga0207705_101034692 142
20 3300025919 Ga0207657_10011877 Ga0207657_100118772 142
21 3300025921 Ga0207652_10218447 Ga0207652_102184472 142
22 3300025932 Ga0207690_10846166 Ga0207690_108461662 142
23 3300025949 Ga0207667_10149085 Ga0207667_101490853 142
24 3300026041 Ga0207639_10209618 Ga0207639_102096182 142
25 3300031507 Ga0307509_10188086 Ga0307509_101880862 142
26 3300033180 Ga0307510_10005745 Ga0307510_1000574512 142
27 3300038443 Ga0395901_1206137 Ga0395901_1206137_130_591 142
28 3300046455 Ga0495603_0046296 Ga0495603_0046296_1961_2413 142
29 3300046522 Ga0495643_0215864 Ga0495643_0215864_223_669 142
30 3300046526 Ga0495666_0042977 Ga0495666_0042977_31_483 142
31 3300047323 Ga0495683_0046800 Ga0495683_0046800_221_667 142
32 3300049570 Ga0501033_0051177 Ga0501033_0051177_2241_2702 142
33 3300049570 Ga0501033_0053026 Ga0501033_0053026_2241_2702 142
34 3300049571 Ga0501034_0362062 Ga0501034_0362062_226_687 142
35 3300049573 Ga0501037_0154048 Ga0501037_0154048_371_832 142
36 3300049579 Ga0501043_0194667 Ga0501043_0194667_976_1437 142
37 3300049581 Ga0501047_0073966 Ga0501047_0073966_921_1382 142
38 3300049582 Ga0501048_0349285 Ga0501048_0349285_533_994 142
39 3300049583 Ga0501067_0106520 Ga0501067_0106520_230_691 142
40 3300049586 Ga0501070_0241832 Ga0501070_0241832_677_1138 142
41 3300049741 Ga0501079_1035943 Ga0501079_1035943_101_562 142
42 3300049742 Ga0501080_0403041 Ga0501080_0403041_228_689 142
43 3300049822 Ga0501035_0239006 Ga0501035_0239006_414_875 142
44 3300049823 Ga0501044_0510446 Ga0501044_0510446_410_871 142
45 3300053102 Ga0500554_067632 Ga0500554_067632_597_1049 142
46 3300053150 Ga0500603_001546 Ga0500603_001546_1176_1628 142
47 3300053162 Ga0500638_104094 Ga0500638_104094_762_1214 142
48 3300053178 Ga0500637_0058314 Ga0500637_0058314_1054_1506 142
49 iso_pu_bacteria 2517572143 2517893268 142
50 iso_pu_bacteria 2617270741 2617376645 142
51 iso_pu_bacteria 2824679649 2824682534 142
52 iso_pu_bacteria 2824746037 2824751678 142
53 iso_pu_bacteria 2885374607 2885374862 142
54 iso_pu_bacteria 2903748898 2903755732 142
55 iso_pu_bacteria 2904690495 2904696688 142
56 iso_pu_bacteria 2908756301 2908761308 142
57 iso_pu_bacteria 2922393267 2922395460 142
58 iso_pu_bacteria 2935630451 2935634207 142
59 iso_pu_bacteria 2935984226 2935989156 142
60 iso_pu_bacteria 2941507105 2941511097 142
61 iso_pu_bacteria 2941515067 2941518481 142
62 iso_pu_bacteria 2941523033 2941527256 142
63 iso_pu_bacteria 3005474847 3005479373 142
64 iso_pu_bacteria 8056689827 8056695779 142
65 3300045976 Ga0466967_0786516 Ga0466967_0786516_49_513 143
66 3300048929 Ga0496126_0754232 Ga0496126_0754232_80_544 143
67 iso_pu_bacteria 2513237137 2513859641 143
68 iso_pu_bacteria 2513237145 2513921692 143
69 iso_pu_bacteria 2885409591 2885410328 143
70 iso_pu_bacteria 2906635258 2906642273 143
71 iso_pu_bacteria 2906660503 2906667975 143
72 iso_pu_bacteria 2908739725 2908743663 143
73 iso_pu_bacteria 3005483717 3005490055 143
74 3300021384 Ga0213876_10154659 Ga0213876_101546592 144
75 iso_pu_bacteria 2511231004 2511253691 144
76 iso_pu_bacteria 2511231006 2511267565 144
77 iso_pu_bacteria 2511231018 2511339819 144
78 iso_pu_bacteria 2511231022 2511364003 144
79 iso_pu_bacteria 2512047018 2512325562 144
80 iso_pu_bacteria 2582580891 2583793090 144
81 iso_pu_bacteria 2597489887 2597858962 144
82 iso_pu_bacteria 2599185185 2599487600 144
83 iso_pu_bacteria 2599185257 2599806075 144
84 iso_pu_bacteria 2600254931 2600366782 144
85 iso_pu_bacteria 2623620446 2624493118 144
86 iso_pu_bacteria 2671180172 2671772859 144
87 iso_pu_bacteria 2740892503 2743738484 144
88 iso_pu_bacteria 2844665904 2844671498 144
89 iso_pu_bacteria 2919697872 2919699616 144
90 iso_pu_bacteria 2923153595 2923157542 144
91 iso_pu_bacteria 2984286254 2984288593 144
92 iso_pu_bacteria 3007395558 3007396864 144
93 iso_pu_bacteria 8015687852 8015691704 144
94 iso_pu_bacteria 8019769354 8019772112 144
95 iso_pu_bacteria 8019775933 8019776113 144
96 iso_pu_bacteria 8055770955 8055774892 144
97 iso_pu_bacteria 8056155041 8056160361 144
98 iso_pu_bacteria 8057798959 8057801418 144
99 3300005614 Ga0068856_100000427 Ga0068856_10000042729 145
100 3300006173 Ga0070716_100622497 Ga0070716_1006224971 145
101 3300025981 Ga0207640_10033862 Ga0207640_100338622 145
102 3300026078 Ga0207702_10002256 Ga0207702_100022563 145
103 3300031711 Ga0265314_10003900 Ga0265314_100039006 145
104 iso_pu_bacteria 2912963787 2912966050 145
105 iso_pu_bacteria 2939651529 2939656479 145
106 3300003215 JGI25153J46596_10001025 JGI25153J46596_1000102513 146
107 3300003794 Ga0055531_10005197 Ga0055531_100051974 146
108 3300005262 Ga0065165_1004734 Ga0065165_10047348 146
109 3300007788 Ga0099795_10128740 Ga0099795_101287401 146
110 3300025261 Ga0209233_1005867 Ga0209233_10058673 146
111 3300025297 Ga0209758_1000100 Ga0209758_1000100156 146
112 3300025299 Ga0209256_1007360 Ga0209256_10073604 146
113 3300025304 Ga0209257_1001443 Ga0209257_100144316 146
114 3300025304 Ga0209257_1028072 Ga0209257_10280721 146
115 3300033180 Ga0307510_10002011 Ga0307510_100020114 146
116 3300035083 Ga0373926_0005258 Ga0373926_0005258_83_556 146
117 3300035111 Ga0373923_0004116 Ga0373923_0004116_699_1172 146
118 3300035113 Ga0373936_0171334 Ga0373936_0171334_53_526 146
119 3300035116 Ga0373945_0028357 Ga0373945_0028357_27_500 146
120 3300035117 Ga0373953_0049978 Ga0373953_0049978_192_665 146
121 3300035120 Ga0373957_0092946 Ga0373957_0092946_611_1084 146
122 3300035170 Ga0373943_0010440 Ga0373943_0010440_1063_1536 146
123 3300035171 Ga0373946_0003822 Ga0373946_0003822_2657_3130 146
124 3300035692 Ga0373935_0168839 Ga0373935_0168839_414_887 146
125 3300035695 Ga0373927_0161150 Ga0373927_0161150_529_1002 146
126 3300035724 Ga0373933_0037909 Ga0373933_0037909_1145_1618 146
127 3300035725 Ga0373947_0036502 Ga0373947_0036502_418_891 146
128 3300036401 Ga0373937_0432331 Ga0373937_0432331_140_613 146
129 3300037068 Ga0373925_0003101 Ga0373925_0003101_9207_9680 146
130 3300046454 Ga0495592_0102460 Ga0495592_0102460_285_758 146
131 3300046461 Ga0495641_0073247 Ga0495641_0073247_488_961 146
132 3300046472 Ga0495580_0026091 Ga0495580_0026091_2681_3154 146
133 3300046473 Ga0495582_0096896 Ga0495582_0096896_1065_1538 146
134 3300046475 Ga0495639_0010545 Ga0495639_0010545_446_919 146
135 3300046477 Ga0495664_0020455 Ga0495664_0020455_688_1161 146
136 3300046514 Ga0495618_0312617 Ga0495618_0312617_302_775 146
137 3300046517 Ga0495630_0057885 Ga0495630_0057885_2412_2885 146
138 3300046526 Ga0495666_0021904 Ga0495666_0021904_2494_2967 146
139 3300046529 Ga0495652_0043460 Ga0495652_0043460_1050_1523 146
140 3300046533 Ga0495640_0011188 Ga0495640_0011188_4366_4839 146
141 3300046535 Ga0495586_0234979 Ga0495586_0234979_79_552 146
142 3300046536 Ga0495587_0035212 Ga0495587_0035212_216_689 146
143 3300046642 Ga0495634_0035380 Ga0495634_0035380_2627_3100 146
144 3300046663 Ga0495635_0043334 Ga0495635_0043334_1515_1988 146
145 3300046680 Ga0495646_0073374 Ga0495646_0073374_457_930 146
146 3300047315 Ga0495581_0119835 Ga0495581_0119835_415_888 146
147 3300047319 Ga0495674_0009113 Ga0495674_0009113_6281_6754 146
148 3300047471 Ga0495684_0010447 Ga0495684_0010447_992_1465 146
149 3300047673 Ga0495593_0231489 Ga0495593_0231489_309_782 146
150 3300048089 Ga0495614_0081522 Ga0495614_0081522_392_865 146
151 3300048909 Ga0496106_0000705 Ga0496106_0000705_4418_4864 146
152 3300048924 Ga0496121_0399934 Ga0496121_0399934_281_754 146
153 3300048929 Ga0496126_0297124 Ga0496126_0297124_331_798 146
154 3300053077 Ga0495601_0037763 Ga0495601_0037763_2491_2964 146
155 3300053078 Ga0495612_0083194 Ga0495612_0083194_822_1295 146
156 3300053078 Ga0495612_0086302 Ga0495612_0086302_554_1054 146
157 3300053085 Ga0495619_0666502 Ga0495619_0666502_84_557 146
158 3300053087 Ga0500643_000025 Ga0500643_000025_58252_58719 146
159 3300053104 Ga0500556_0141421 Ga0500556_0141421_414_914 146
160 3300053125 Ga0500618_001381 Ga0500618_001381_7913_8371 146
161 3300053125 Ga0500618_105602 Ga0500618_105602_26_493 146
162 3300053147 Ga0500589_144695 Ga0500589_144695_472_939 146
163 3300053148 Ga0500590_104301 Ga0500590_104301_144_617 146
164 3300053737 Ga0500601_002675 Ga0500601_002675_145_618 146
165 iso_pu_bacteria 2834028612 2834032780 146
166 iso_pu_bacteria 2840764183 2840764507 146
167 iso_pu_bacteria 2929138655 2929142057 146
168 3300003187 JGI25151J46595_10015502 JGI25151J46595_100155024 147
169 3300003771 Ga0055526_1060592 Ga0055526_10605922 147
170 3300003775 Ga0055524_1004374 Ga0055524_10043742 147
171 3300003790 Ga0055528_1001797 Ga0055528_100179710 147
172 3300005262 Ga0065165_1005082 Ga0065165_10050827 147
173 3300005338 Ga0068868_101843410 Ga0068868_1018434101 147
174 3300005467 Ga0070706_100235219 Ga0070706_1002352192 147
175 3300005467 Ga0070706_100275372 Ga0070706_1002753722 147
176 3300005468 Ga0070707_100648203 Ga0070707_1006482031 147
177 3300005518 Ga0070699_100378425 Ga0070699_1003784252 147
178 3300005536 Ga0070697_100419363 Ga0070697_1004193632 147
179 3300005539 Ga0068853_100411253 Ga0068853_1004112532 147
180 3300005563 Ga0068855_100537150 Ga0068855_1005371502 147
181 3300005937 Ga0081455_10484354 Ga0081455_104843541 147
182 3300006941 Ga0099825_1028003 Ga0099825_10280033 147
183 3300006942 Ga0099824_1007084 Ga0099824_100708416 147
184 3300006943 Ga0099822_1001392 Ga0099822_100139212 147
185 3300007265 Ga0099794_10013241 Ga0099794_100132414 147
186 3300007265 Ga0099794_10026161 Ga0099794_100261612 147
187 3300007265 Ga0099794_10147258 Ga0099794_101472582 147
188 3300007788 Ga0099795_10039243 Ga0099795_100392432 147
189 3300007788 Ga0099795_10530526 Ga0099795_105305261 147
190 3300009093 Ga0105240_11383508 Ga0105240_113835081 147
191 3300009545 Ga0105237_10064347 Ga0105237_100643472 147
192 3300009553 Ga0105249_11270170 Ga0105249_112701702 147
193 3300010159 Ga0099796_10009094 Ga0099796_100090944 147
194 3300010159 Ga0099796_10340208 Ga0099796_103402081 147
195 3300013296 Ga0157374_10147436 Ga0157374_101474363 147
196 3300013296 Ga0157374_11132615 Ga0157374_111326151 147
197 3300013306 Ga0163162_10154756 Ga0163162_101547562 147
198 3300025258 Ga0209129_1000140 Ga0209129_1000140107 147
199 3300025273 Ga0209673_1000068 Ga0209673_100006882 147
200 3300025294 Ga0209025_1003243 Ga0209025_10032438 147
201 3300025294 Ga0209025_1005069 Ga0209025_10050695 147
202 3300025295 Ga0209564_1013582 Ga0209564_10135823 147
203 3300025297 Ga0209758_1065808 Ga0209758_10658081 147
204 3300025297 Ga0209758_1074199 Ga0209758_10741992 147
205 3300025299 Ga0209256_1001101 Ga0209256_100110114 147
206 3300025302 Ga0207426_1088438 Ga0207426_10884381 147
207 3300025304 Ga0209257_1073781 Ga0209257_10737811 147
208 3300025910 Ga0207684_10110480 Ga0207684_101104803 147
209 3300025910 Ga0207684_10803375 Ga0207684_108033751 147
210 3300025915 Ga0207693_10124907 Ga0207693_101249072 147
211 3300025939 Ga0207665_10277012 Ga0207665_102770122 147
212 3300025949 Ga0207667_11871323 Ga0207667_118713231 147
213 3300027357 Ga0209589_1000023 Ga0209589_1000023171 147
214 3300027361 Ga0209489_100032 Ga0209489_100032171 147
215 3300027363 Ga0209700_100040 Ga0209700_100040171 147
216 3300027671 Ga0209588_1077496 Ga0209588_10774962 147
217 3300027671 Ga0209588_1085073 Ga0209588_10850732 147
218 3300031235 Ga0265330_10099481 Ga0265330_100994811 147
219 3300031344 Ga0265316_10125149 Ga0265316_101251493 147
220 3300031616 Ga0307508_10080181 Ga0307508_100801813 147
221 3300031711 Ga0265314_10192895 Ga0265314_101928952 147
222 3300031712 Ga0265342_10099438 Ga0265342_100994381 147
223 3300033442 Ga0315911_1000029 Ga0315911_100002921 147
224 3300035083 Ga0373926_0062252 Ga0373926_0062252_472_948 147
225 3300035089 Ga0373944_0196151 Ga0373944_0196151_29_505 147
226 3300035111 Ga0373923_0022318 Ga0373923_0022318_1167_1643 147
227 3300035113 Ga0373936_0018274 Ga0373936_0018274_1625_2101 147
228 3300035113 Ga0373936_0030449 Ga0373936_0030449_1391_1867 147
229 3300035116 Ga0373945_0023264 Ga0373945_0023264_1549_2025 147
230 3300035118 Ga0373954_0180581 Ga0373954_0180581_419_895 147
231 3300035170 Ga0373943_0014191 Ga0373943_0014191_772_1248 147
232 3300035170 Ga0373943_0553490 Ga0373943_0553490_153_638 147
233 3300035691 Ga0373931_0790525 Ga0373931_0790525_28_504 147
234 3300035692 Ga0373935_0006298 Ga0373935_0006298_5517_5993 147
235 3300035695 Ga0373927_0000689 Ga0373927_0000689_9402_9878 147
236 3300035695 Ga0373927_0059006 Ga0373927_0059006_1290_1775 147
237 3300035725 Ga0373947_0002567 Ga0373947_0002567_3084_3560 147
238 3300036401 Ga0373937_0002165 Ga0373937_0002165_8719_9195 147
239 3300037068 Ga0373925_0009228 Ga0373925_0009228_4509_4985 147
240 3300044694 Ga0466963_0284304 Ga0466963_0284304_551_1024 147
241 3300044735 Ga0466968_0023052 Ga0466968_0023052_1954_2424 147
242 3300046454 Ga0495592_0022417 Ga0495592_0022417_4058_4534 147
243 3300046455 Ga0495603_0001582 Ga0495603_0001582_2496_2972 147
244 3300046459 Ga0495629_0001500 Ga0495629_0001500_8850_9326 147
245 3300046461 Ga0495641_0019862 Ga0495641_0019862_2356_2832 147
246 3300046463 Ga0495653_0192973 Ga0495653_0192973_349_825 147
247 3300046472 Ga0495580_0017445 Ga0495580_0017445_4225_4701 147
248 3300046473 Ga0495582_0001498 Ga0495582_0001498_7194_7670 147
249 3300046475 Ga0495639_0002214 Ga0495639_0002214_445_921 147
250 3300046476 Ga0495662_0022039 Ga0495662_0022039_2477_2953 147
251 3300046477 Ga0495664_0053599 Ga0495664_0053599_1259_1735 147
252 3300046499 Ga0495594_0002146 Ga0495594_0002146_7639_8115 147
253 3300046511 Ga0495608_0185300 Ga0495608_0185300_572_1087 147
254 3300046516 Ga0495628_0041912 Ga0495628_0041912_2622_3098 147
255 3300046517 Ga0495630_0002211 Ga0495630_0002211_10110_10586 147
256 3300046531 Ga0495665_0003724 Ga0495665_0003724_4247_4723 147
257 3300046533 Ga0495640_0016796 Ga0495640_0016796_532_1008 147
258 3300046557 Ga0495622_0007988 Ga0495622_0007988_1898_2374 147
259 3300046642 Ga0495634_0001270 Ga0495634_0001270_11286_11762 147
260 3300046663 Ga0495635_0015274 Ga0495635_0015274_2452_2928 147
261 3300046674 Ga0495588_0002635 Ga0495588_0002635_1959_2435 147
262 3300046675 Ga0495657_0151918 Ga0495657_0151918_423_899 147
263 3300046678 Ga0495599_0139554 Ga0495599_0139554_766_1242 147
264 3300046680 Ga0495646_0053215 Ga0495646_0053215_784_1260 147
265 3300046681 Ga0495647_0000649 Ga0495647_0000649_6758_7234 147
266 3300046683 Ga0495658_0001998 Ga0495658_0001998_4495_4971 147
267 3300046689 Ga0495613_0004899 Ga0495613_0004899_3691_4167 147
268 3300046690 Ga0495624_0015721 Ga0495624_0015721_1685_2161 147
269 3300047315 Ga0495581_0005949 Ga0495581_0005949_3517_3993 147
270 3300047317 Ga0495604_0286443 Ga0495604_0286443_215_691 147
271 3300047319 Ga0495674_0001148 Ga0495674_0001148_22924_23400 147
272 3300047321 Ga0495676_0014823 Ga0495676_0014823_5328_5804 147
273 3300047469 Ga0495673_0041944 Ga0495673_0041944_1131_1607 147
274 3300047471 Ga0495684_0087639 Ga0495684_0087639_1716_2192 147
275 3300047673 Ga0495593_0023156 Ga0495593_0023156_754_1230 147
276 3300048907 Ga0496104_0572277 Ga0496104_0572277_93_569 147
277 3300048911 Ga0496108_0563532 Ga0496108_0563532_436_912 147
278 3300048912 Ga0496109_0016445 Ga0496109_0016445_4799_5275 147
279 3300048913 Ga0496110_0150665 Ga0496110_0150665_291_767 147
280 3300048914 Ga0496111_0036632 Ga0496111_0036632_202_678 147
281 3300048915 Ga0496112_0286244 Ga0496112_0286244_295_771 147
282 3300048917 Ga0496114_0273387 Ga0496114_0273387_997_1473 147
283 3300048918 Ga0496115_0321669 Ga0496115_0321669_718_1251 147
284 3300048918 Ga0496115_1029353 Ga0496115_1029353_116_592 147
285 3300053085 Ga0495619_0210527 Ga0495619_0210527_620_1096 147
286 3300053094 Ga0500566_0000516 Ga0500566_0000516_10174_10650 147
287 3300053095 Ga0500640_002117 Ga0500640_002117_3922_4398 147
288 3300053111 Ga0500572_000055 Ga0500572_000055_10174_10650 147
289 3300053115 Ga0500591_068279 Ga0500591_068279_637_1113 147
290 3300053122 Ga0500608_006046 Ga0500608_006046_894_1370 147
291 3300053123 Ga0500614_002236 Ga0500614_002236_986_1462 147
292 3300053136 Ga0500559_0238228 Ga0500559_0238228_337_813 147
293 3300053148 Ga0500590_074139 Ga0500590_074139_314_790 147
294 3300053150 Ga0500603_000052 Ga0500603_000052_23634_24110 147
295 3300053159 Ga0500630_001061 Ga0500630_001061_1115_1591 147
296 3300053163 Ga0500639_000004 Ga0500639_000004_141188_141664 147
297 3300053735 Ga0500596_004634 Ga0500596_004634_1928_2404 147
298 3300053737 Ga0500601_016275 Ga0500601_016275_102_578 147
299 iso_pu_bacteria 2554235341 2555670945 147
300 iso_pu_bacteria 2599185160 2599357492 147
301 iso_pu_bacteria 2599185161 2599364282 147
302 iso_pu_bacteria 2599185162 2599370603 147
303 iso_pu_bacteria 2599185163 2599377204 147
304 iso_pu_bacteria 2599185164 2599382791 147
305 iso_pu_bacteria 2599185165 2599389239 147
306 iso_pu_bacteria 2599185166 2599395828 147
307 iso_pu_bacteria 2599185168 2599408218 147
308 iso_pu_bacteria 2599185181 2599464019 147
309 iso_pu_bacteria 2599185182 2599471046 147
310 iso_pu_bacteria 2599185186 2599493038 147
311 iso_pu_bacteria 2599185356 2600217161 147
312 iso_pu_bacteria 2600255313 2601777332 147
313 iso_pu_bacteria 2667528171 2671100446 147
314 iso_pu_bacteria 2818991464 2819706107 147
315 iso_pu_bacteria 2917070673 2917074807 147
316 iso_pu_bacteria 2935353572 2935355206 147
317 iso_pu_bacteria 2945928738 2945932798 147
318 iso_pu_bacteria 637000220 637321280 147
319 iso_pu_bacteria 8055878733 8055881102 147
320 iso_pu_bacteria 8056161164 8056165366 147
321 3300003781 Ga0055536_1000082 Ga0055536_100008238 148
322 3300003791 Ga0055530_10000124 Ga0055530_1000012426 148
323 3300003792 Ga0055540_1000467 Ga0055540_10004679 148
324 3300005467 Ga0070706_101678057 Ga0070706_1016780571 148
325 3300006058 Ga0075432_10009635 Ga0075432_100096353 148
326 3300009092 Ga0105250_10020026 Ga0105250_100200263 148
327 3300009148 Ga0105243_10106930 Ga0105243_101069303 148
328 3300013102 Ga0157371_10116147 Ga0157371_101161472 148
329 3300013105 Ga0157369_10139016 Ga0157369_101390162 148
330 3300013306 Ga0163162_10130463 Ga0163162_101304632 148
331 3300013308 Ga0157375_10766855 Ga0157375_107668552 148
332 3300015262 Ga0182007_10172909 Ga0182007_101729091 148
333 3300017792 Ga0163161_10050021 Ga0163161_100500212 148
334 3300017792 Ga0163161_10122971 Ga0163161_101229712 148
335 3300025292 Ga0209676_1000017 Ga0209676_1000017265 148
336 3300025298 Ga0209050_1000371 Ga0209050_100037135 148
337 3300025303 Ga0209051_1000234 Ga0209051_100023436 148
338 3300025711 Ga0207696_1025142 Ga0207696_10251422 148
339 3300025728 Ga0207655_1001852 Ga0207655_10018522 148
340 3300025728 Ga0207655_1009607 Ga0207655_10096072 148
341 3300025910 Ga0207684_11121851 Ga0207684_111218511 148
342 3300027907 Ga0207428_10119101 Ga0207428_101191012 148
343 3300032004 Ga0307414_10631406 Ga0307414_106314062 148
344 3300041407 Ga0439447_009467 Ga0439447_009467_507_1013 148
345 3300041411 Ga0439466_0000223 Ga0439466_0000223_21677_22123 148
346 3300041411 Ga0439466_0013830 Ga0439466_0013830_507_1013 148
347 3300041413 Ga0439465_0053449 Ga0439465_0053449_544_1050 148
348 3300042009 Ga0439451_080902 Ga0439451_080902_177_623 148
349 3300042010 Ga0439452_020791 Ga0439452_020791_507_1013 148
350 3300042013 Ga0439456_025599 Ga0439456_025599_302_808 148
351 3300042013 Ga0439456_031413 Ga0439456_031413_452_898 148
352 3300042016 Ga0439463_000157 Ga0439463_000157_452_898 148
353 3300042138 Ga0450903_031820 Ga0450903_031820_182_688 148
354 3300042146 Ga0450907_000071 Ga0450907_000071_33438_33944 148
355 3300042156 Ga0439446_0023532 Ga0439446_0023532_626_1132 148
356 3300042185 Ga0450909_001772 Ga0450909_001772_1827_2333 148
357 3300042435 Ga0439434_0001048 Ga0439434_0001048_6750_7256 148
358 3300042993 Ga0439440_0011850 Ga0439440_0011850_886_1392 148
359 3300042993 Ga0439440_0062630 Ga0439440_0062630_20_466 148
360 3300044658 Ga0466972_0033287 Ga0466972_0033287_1377_1886 148
361 3300046452 Ga0495617_023586 Ga0495617_023586_1361_1858 148
362 3300046457 Ga0495590_0004815 Ga0495590_0004815_4620_5117 148
363 3300046458 Ga0495591_015234 Ga0495591_015234_326_823 148
364 3300046460 Ga0495638_0098889 Ga0495638_0098889_121_618 148
365 3300046471 Ga0495650_0013397 Ga0495650_0013397_550_1047 148
366 3300046474 Ga0495605_0055964 Ga0495605_0055964_195_692 148
367 3300046491 Ga0495584_0001433 Ga0495584_0001433_7263_7709 148
368 3300046491 Ga0495584_0205679 Ga0495584_0205679_195_692 148
369 3300046492 Ga0495585_0003679 Ga0495585_0003679_7068_7565 148
370 3300046501 Ga0495607_0010965 Ga0495607_0010965_3514_4011 148
371 3300046506 Ga0495583_0000918 Ga0495583_0000918_30391_30888 148
372 3300046506 Ga0495583_0010664 Ga0495583_0010664_2739_3185 148
373 3300046513 Ga0495616_0004213 Ga0495616_0004213_8112_8609 148
374 3300046518 Ga0495631_0164599 Ga0495631_0164599_42_539 148
375 3300046519 Ga0495632_0003436 Ga0495632_0003436_8124_8621 148
376 3300046520 Ga0495637_0013956 Ga0495637_0013956_2733_3230 148
377 3300046522 Ga0495643_0031707 Ga0495643_0031707_2047_2544 148
378 3300046523 Ga0495644_0019366 Ga0495644_0019366_176_673 148
379 3300046524 Ga0495648_0076129 Ga0495648_0076129_994_1491 148
380 3300046530 Ga0495654_0164255 Ga0495654_0164255_354_851 148
381 3300046538 Ga0495609_0006680 Ga0495609_0006680_4159_4656 148
382 3300046648 Ga0495611_0208497 Ga0495611_0208497_169_666 148
383 3300046660 Ga0495625_0366772 Ga0495625_0366772_356_853 148
384 3300046664 Ga0495659_0023237 Ga0495659_0023237_1349_1846 148
385 3300046665 Ga0495661_0207106 Ga0495661_0207106_404_901 148
386 3300046684 Ga0495669_0036836 Ga0495669_0036836_437_934 148
387 3300046691 Ga0495670_0023497 Ga0495670_0023497_1245_1742 148
388 3300046692 Ga0495671_0174169 Ga0495671_0174169_250_747 148
389 3300046794 Ga0495589_0026195 Ga0495589_0026195_2014_2511 148
390 3300046810 Ga0495660_0013918 Ga0495660_0013918_2097_2543 148
391 3300046810 Ga0495660_0051708 Ga0495660_0051708_1470_1967 148
392 3300047318 Ga0495636_0057465 Ga0495636_0057465_251_748 148
393 3300047320 Ga0495672_0037691 Ga0495672_0037691_2014_2511 148
394 3300047323 Ga0495683_0046046 Ga0495683_0046046_463_960 148
395 3300047445 Ga0495677_0002617 Ga0495677_0002617_6061_6558 148
396 3300047446 Ga0495679_021304 Ga0495679_021304_385_882 148
397 3300047447 Ga0495685_094385 Ga0495685_094385_22_519 148
398 3300047469 Ga0495673_0001330 Ga0495673_0001330_11440_11886 148
399 3300047469 Ga0495673_0017045 Ga0495673_0017045_1957_2454 148
400 3300048091 Ga0495626_0004695 Ga0495626_0004695_4351_4848 148
401 3300049459 Ga0495678_020297 Ga0495678_020297_1529_1975 148
402 3300049459 Ga0495678_021260 Ga0495678_021260_2014_2511 148
403 3300049459 Ga0495678_037109 Ga0495678_037109_1526_1972 148
404 3300049459 Ga0495678_098129 Ga0495678_098129_498_944 148
405 3300049460 Ga0495682_0026715 Ga0495682_0026715_1200_1697 148
406 3300053111 Ga0500572_005070 Ga0500572_005070_2190_2636 148
407 3300053177 Ga0500636_0002532 Ga0500636_0002532_8542_8988 148
408 3300005337 Ga0070682_100296628 Ga0070682_1002966281 149
409 3300005338 Ga0068868_100545915 Ga0068868_1005459152 149
410 3300026078 Ga0207702_11699766 Ga0207702_116997661 149
411 3300042013 Ga0439456_000028 Ga0439456_000028_30020_30469 149
412 3300003215 JGI25153J46596_10106197 JGI25153J46596_101061971 150
413 3300005347 Ga0070668_100256123 Ga0070668_1002561232 150
414 3300014497 Ga0182008_10048731 Ga0182008_100487312 150
415 3300015262 Ga0182007_10011976 Ga0182007_100119763 150
416 3300025297 Ga0209758_1023046 Ga0209758_10230462 150
417 3300048919 Ga0496116_0315352 Ga0496116_0315352_253_708 150
418 3300048920 Ga0496117_0065944 Ga0496117_0065944_1654_2106 150
419 3300048921 Ga0496118_0065350 Ga0496118_0065350_1739_2191 150
420 3300048921 Ga0496118_0118106 Ga0496118_0118106_527_982 150
421 3300048922 Ga0496119_0010805 Ga0496119_0010805_5529_5984 150
422 3300048923 Ga0496120_0072282 Ga0496120_0072282_290_745 150
423 3300048924 Ga0496121_0000034 Ga0496121_0000034_7640_8095 150
424 3300048924 Ga0496121_0455143 Ga0496121_0455143_110_577 150
425 3300048927 Ga0496124_0015709 Ga0496124_0015709_708_1163 150
426 3300048927 Ga0496124_0248179 Ga0496124_0248179_708_1163 150
427 3300048928 Ga0496125_0000030 Ga0496125_0000030_366838_367293 150
428 3300048929 Ga0496126_0092020 Ga0496126_0092020_621_1076 150
429 3300048929 Ga0496126_0219667 Ga0496126_0219667_570_1034 150
430 3300050491 nmdc:mga00v17_49881_c1 nmdc:mga00v17_49881_c1_765_1220 150
431 3300002737 JGI25162J39368_1000095 JGI25162J39368_100009547 151
432 3300002771 JGI25163J39215_1000303 JGI25163J39215_10003033 151
433 3300002772 JGI25164J39214_1000069 JGI25164J39214_100006949 151
434 3300003214 JGI25165J46597_1000168 JGI25165J46597_100016844 151
435 3300009148 Ga0105243_10000570 Ga0105243_100005702 151
436 3300009553 Ga0105249_10152930 Ga0105249_101529301 151
437 3300013102 Ga0157371_10001096 Ga0157371_1000109623 151
438 3300014497 Ga0182008_10001418 Ga0182008_100014189 151
439 3300025207 Ga0209760_100018 Ga0209760_100018114 151
440 3300025231 Ga0207427_100015 Ga0207427_100015394 151
441 3300025233 Ga0209437_100027 Ga0209437_100027121 151
442 3300025261 Ga0209233_1000039 Ga0209233_1000039394 151
443 3300025935 Ga0207709_10004792 Ga0207709_100047928 151
444 3300025961 Ga0207712_10368643 Ga0207712_103686432 151
445 3300048919 Ga0496116_0000514 Ga0496116_0000514_7652_8116 151
446 3300048920 Ga0496117_0001404 Ga0496117_0001404_7573_8037 151
447 3300048921 Ga0496118_0009033 Ga0496118_0009033_9551_10015 151
448 3300048924 Ga0496121_0000955 Ga0496121_0000955_44215_44679 151
449 3300048925 Ga0496122_0002553 Ga0496122_0002553_20737_21201 151
450 3300048926 Ga0496123_0001630 Ga0496123_0001630_7586_8050 151
451 3300048927 Ga0496124_0020627 Ga0496124_0020627_2401_2856 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

39

128

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f2e-assembly1.cif.gz_A crystal structure of pa1607, a putative transcription factor 0.9563 5 145
2f2e-assembly1.cif.gz_A crystal structure of pa1607, a putative transcription factor 0.9368 5 145
2hoe-assembly1.cif.gz_A crystal structure of n-acetylglucosamine kinase (tm1224) from thermotoga maritima at 2.46 a resolution 0.9131 39 84
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.8956 27 83
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.8885 12 103
ID Description Score Start End Superfamily
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9532 15 105 1.10.10.10
2f2eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9327 15 105 1.10.10.10
2hoeA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9131 39 84 1.10.10.10
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8984 11 146 1.10.10.10
af_P71983_1_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8979 11 107 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q7T653-F1-model_v4 deleted 0.9863 3 145
AF-A0A6N8SFI0-F1-model_v4 Transcriptional regulator 0.9851 3 151 GO:0003677
AF-F0KIW8-F1-model_v4 HTH hxlR-type domain-containing protein 0.9847 31 147 GO:0003677
AF-A0A1B3MFP9-F1-model_v4 deleted 0.9824 3 151
AF-A0A0A1PFI7-F1-model_v4 Putative HTH-type transcriptional regulator YybR 0.9794 3 145 GO:0003677

Feature Viewer

pLDDT pTM Quality
91.23 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map