F446763
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 451 | 345 | 375 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10147258|Ga0099794_101472582 |
| Length | 177 |
| Sequence | MQLHIAVIGETSCPVRKDAMVKRTSLEKAECPIARSLDAIGDWWSLLIIRDALMGINRFSEFQKHIGLAKNILTVRLRALVDHGILKTAPAADGSAYQEYVLTPKGRGVFPVLVALRQWSEEFGGEPDGFPTLLVDRGKGRPVRKLELRSADGRLLGIGDTEVRANPGVKRRRRVLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 2 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 3 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 4 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 5 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 9 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 10 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 11 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 12 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 13 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 14 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 15 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 16 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 17 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 18 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 19 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 20 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 21 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 22 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 23 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 24 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 25 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 26 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 27 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 28 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 29 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 30 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 31 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 32 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 33 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 34 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 35 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 36 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 37 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 38 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 39 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 40 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 41 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 42 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 43 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 44 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 45 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 46 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 47 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 48 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 49 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 50 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 51 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 52 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 53 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 54 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 55 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 56 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 57 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 58 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 59 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 60 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 61 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 62 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 63 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 64 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 65 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 66 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 67 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 68 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 69 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 70 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 71 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 72 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 76 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 78 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 79 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 80 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 84 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 98 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 99 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 100 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 164 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 165 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 166 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 184 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 185 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 186 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 187 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 188 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 189 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 190 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 191 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 192 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 193 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 194 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 195 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 285 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 288 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 315 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 317 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 318 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 319 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 320 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 321 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 323 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 325 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 326 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 327 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 329 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 331 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 333 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 335 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 336 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 337 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 338 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 339 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 340 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 341 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 342 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 343 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 344 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 345 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.15 |
| Metatranscriptomes | 0 |
| Isolates | 16.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.63 |
| Nodule | 6.21 |
| Rhizoplane | 6.43 |
| Rhizosphere | 62.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000095 | 3300002737 | Bacteria | 98329 |
| 2 | JGI25163J39215_1000303 | 3300002771 | Bacteria | 16649 |
| 3 | JGI25164J39214_1000069 | 3300002772 | Bacteria | 103125 |
| 4 | JGI25151J46595_10015502 | 3300003187 | Bacteria | 3354 |
| 5 | JGI25165J46597_1000168 | 3300003214 | Bacteria | 103125 |
| 6 | JGI25153J46596_10001025 | 3300003215 | Bacteria | 16999 |
| 7 | JGI25153J46596_10106197 | 3300003215 | Bacteria | 652 |
| 8 | Ga0055526_1060592 | 3300003771 | Bacteria | 809 |
| 9 | Ga0055524_1004374 | 3300003775 | Bacteria | 6524 |
| 10 | Ga0055536_1000082 | 3300003781 | Bacteria | 81873 |
| 11 | Ga0055528_1001797 | 3300003790 | Bacteria | 12295 |
| 12 | Ga0055530_10000124 | 3300003791 | Bacteria | 66816 |
| 13 | Ga0055540_1000467 | 3300003792 | Bacteria | 31316 |
| 14 | Ga0055531_10005197 | 3300003794 | Bacteria | 7659 |
| 15 | Ga0065165_1004734 | 3300005262 | Bacteria | 8166 |
| 16 | Ga0065165_1005082 | 3300005262 | Bacteria | 7644 |
| 17 | Ga0070658_10204895 | 3300005327 | Bacteria | 1665 |
| 18 | Ga0070680_100242876 | 3300005336 | Bacteria | 1522 |
| 19 | Ga0070682_100296628 | 3300005337 | Bacteria | 1184 |
| 20 | Ga0068868_100545915 | 3300005338 | Bacteria | 1021 |
| 21 | Ga0068868_101843410 | 3300005338 | Bacteria | 572 |
| 22 | Ga0070668_100256123 | 3300005347 | Bacteria | 1454 |
| 23 | Ga0070706_100235219 | 3300005467 | Bacteria | 1710 |
| 24 | Ga0070706_100275372 | 3300005467 | Bacteria | 1570 |
| 25 | Ga0070706_101678057 | 3300005467 | Bacteria | 579 |
| 26 | Ga0070707_100648203 | 3300005468 | Bacteria | 1019 |
| 27 | Ga0070699_100378425 | 3300005518 | Bacteria | 1278 |
| 28 | Ga0070679_100075610 | 3300005530 | Bacteria | 3357 |
| 29 | Ga0070697_100419363 | 3300005536 | Bacteria | 1163 |
| 30 | Ga0068853_100145819 | 3300005539 | Bacteria | 2127 |
| 31 | Ga0068853_100411253 | 3300005539 | Bacteria | 1267 |
| 32 | Ga0068855_100153492 | 3300005563 | Bacteria | 2617 |
| 33 | Ga0068855_100537150 | 3300005563 | Bacteria | 1267 |
| 34 | Ga0068857_100208430 | 3300005577 | Bacteria | 1783 |
| 35 | Ga0068856_100000427 | 3300005614 | Bacteria | 46259 |
| 36 | Ga0081455_10484354 | 3300005937 | Bacteria | 835 |
| 37 | Ga0075432_10009635 | 3300006058 | Bacteria | 3288 |
| 38 | Ga0070716_100622497 | 3300006173 | Bacteria | 815 |
| 39 | Ga0099825_1028003 | 3300006941 | Bacteria | 2798 |
| 40 | Ga0099824_1007084 | 3300006942 | Bacteria | 15049 |
| 41 | Ga0099822_1001392 | 3300006943 | Bacteria | 27954 |
| 42 | Ga0099794_10013241 | 3300007265 | Bacteria | 3585 |
| 43 | Ga0099794_10026161 | 3300007265 | Bacteria | 2695 |
| 44 | Ga0099794_10147258 | 3300007265 | Bacteria | 1194 |
| 45 | Ga0099795_10039243 | 3300007788 | Bacteria | 1675 |
| 46 | Ga0099795_10128740 | 3300007788 | Bacteria | 1019 |
| 47 | Ga0099795_10530526 | 3300007788 | Bacteria | 552 |
| 48 | Ga0105244_10029666 | 3300009036 | Bacteria | 2919 |
| 49 | Ga0105250_10020026 | 3300009092 | Bacteria | 2705 |
| 50 | Ga0105240_11383508 | 3300009093 | Bacteria | 740 |
| 51 | Ga0105243_10000570 | 3300009148 | Bacteria | 37174 |
| 52 | Ga0105243_10106930 | 3300009148 | Bacteria | 2333 |
| 53 | Ga0105237_10064347 | 3300009545 | Bacteria | 3664 |
| 54 | Ga0105249_10152930 | 3300009553 | Bacteria | 2223 |
| 55 | Ga0105249_11270170 | 3300009553 | Bacteria | 808 |
| 56 | Ga0099796_10009094 | 3300010159 | Bacteria | 2675 |
| 57 | Ga0099796_10340208 | 3300010159 | Bacteria | 645 |
| 58 | Ga0157373_10026664 | 3300013100 | Bacteria | 4171 |
| 59 | Ga0157371_10001096 | 3300013102 | Bacteria | 29365 |
| 60 | Ga0157371_10116147 | 3300013102 | Bacteria | 1901 |
| 61 | Ga0157369_10139016 | 3300013105 | Bacteria | 2571 |
| 62 | Ga0157374_10147436 | 3300013296 | Bacteria | 2286 |
| 63 | Ga0157374_11132615 | 3300013296 | Bacteria | 803 |
| 64 | Ga0163162_10130463 | 3300013306 | Bacteria | 2622 |
| 65 | Ga0163162_10154756 | 3300013306 | Bacteria | 2412 |
| 66 | Ga0157375_10766855 | 3300013308 | Bacteria | 1115 |
| 67 | Ga0182008_10001418 | 3300014497 | Bacteria | 16074 |
| 68 | Ga0182008_10048731 | 3300014497 | Bacteria | 2104 |
| 69 | Ga0182008_10089624 | 3300014497 | Bacteria | 1516 |
| 70 | Ga0182006_1000785 | 3300015261 | Bacteria | 21404 |
| 71 | Ga0182007_10000182 | 3300015262 | Bacteria | 42974 |
| 72 | Ga0182007_10011976 | 3300015262 | Bacteria | 3351 |
| 73 | Ga0182007_10172909 | 3300015262 | Bacteria | 744 |
| 74 | Ga0182005_1000622 | 3300015265 | Bacteria | 17081 |
| 75 | Ga0163161_10050021 | 3300017792 | Bacteria | 3023 |
| 76 | Ga0163161_10122971 | 3300017792 | Bacteria | 1951 |
| 77 | Ga0213876_10154659 | 3300021384 | Bacteria | 1220 |
| 78 | Ga0209760_100018 | 3300025207 | Bacteria | 172833 |
| 79 | Ga0207427_100015 | 3300025231 | Bacteria | 542133 |
| 80 | Ga0209437_100027 | 3300025233 | Bacteria | 542133 |
| 81 | Ga0209129_1000140 | 3300025258 | Bacteria | 122574 |
| 82 | Ga0209233_1000039 | 3300025261 | Bacteria | 542133 |
| 83 | Ga0209233_1005867 | 3300025261 | Bacteria | 4029 |
| 84 | Ga0209673_1000068 | 3300025273 | Bacteria | 245891 |
| 85 | Ga0209676_1000017 | 3300025292 | Bacteria | 643409 |
| 86 | Ga0209025_1003243 | 3300025294 | Bacteria | 15691 |
| 87 | Ga0209025_1005069 | 3300025294 | Bacteria | 10967 |
| 88 | Ga0209564_1013582 | 3300025295 | Bacteria | 3443 |
| 89 | Ga0209758_1000100 | 3300025297 | Bacteria | 227948 |
| 90 | Ga0209758_1023046 | 3300025297 | Bacteria | 2831 |
| 91 | Ga0209758_1065808 | 3300025297 | Bacteria | 1167 |
| 92 | Ga0209758_1074199 | 3300025297 | Bacteria | 1056 |
| 93 | Ga0209050_1000371 | 3300025298 | Bacteria | 85791 |
| 94 | Ga0209256_1001101 | 3300025299 | Bacteria | 31081 |
| 95 | Ga0209256_1007360 | 3300025299 | Bacteria | 5466 |
| 96 | Ga0207426_1088438 | 3300025302 | Bacteria | 825 |
| 97 | Ga0209051_1000234 | 3300025303 | Bacteria | 92914 |
| 98 | Ga0209257_1001443 | 3300025304 | Bacteria | 28086 |
| 99 | Ga0209257_1028072 | 3300025304 | Bacteria | 1859 |
| 100 | Ga0209257_1073781 | 3300025304 | Bacteria | 892 |
| 101 | Ga0207696_1025142 | 3300025711 | Bacteria | 1860 |
| 102 | Ga0207655_1001852 | 3300025728 | Bacteria | 18277 |
| 103 | Ga0207655_1009607 | 3300025728 | Bacteria | 5989 |
| 104 | Ga0207705_10103469 | 3300025909 | Bacteria | 2097 |
| 105 | Ga0207684_10110480 | 3300025910 | Bacteria | 2353 |
| 106 | Ga0207684_10803375 | 3300025910 | Bacteria | 795 |
| 107 | Ga0207684_11121851 | 3300025910 | Bacteria | 654 |
| 108 | Ga0207693_10124907 | 3300025915 | Bacteria | 2022 |
| 109 | Ga0207657_10011877 | 3300025919 | Bacteria | 8621 |
| 110 | Ga0207652_10218447 | 3300025921 | Bacteria | 1717 |
| 111 | Ga0207690_10846166 | 3300025932 | Bacteria | 757 |
| 112 | Ga0207709_10004792 | 3300025935 | Bacteria | 7753 |
| 113 | Ga0207665_10277012 | 3300025939 | Bacteria | 1247 |
| 114 | Ga0207667_10149085 | 3300025949 | Bacteria | 2408 |
| 115 | Ga0207667_11871323 | 3300025949 | Bacteria | 563 |
| 116 | Ga0207712_10368643 | 3300025961 | Bacteria | 1198 |
| 117 | Ga0207640_10033862 | 3300025981 | Bacteria | 3183 |
| 118 | Ga0207639_10209618 | 3300026041 | Bacteria | 1676 |
| 119 | Ga0207702_10002256 | 3300026078 | Bacteria | 18481 |
| 120 | Ga0207702_11699766 | 3300026078 | Bacteria | 624 |
| 121 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 122 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 123 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 124 | Ga0209588_1077496 | 3300027671 | Bacteria | 1074 |
| 125 | Ga0209588_1085073 | 3300027671 | Bacteria | 1021 |
| 126 | Ga0207428_10119101 | 3300027907 | Bacteria | 2026 |
| 127 | Ga0265330_10099481 | 3300031235 | Bacteria | 1245 |
| 128 | Ga0265316_10125149 | 3300031344 | Bacteria | 1939 |
| 129 | Ga0307509_10188086 | 3300031507 | Bacteria | 1920 |
| 130 | Ga0307508_10080181 | 3300031616 | Bacteria | 2846 |
| 131 | Ga0265314_10003900 | 3300031711 | Bacteria | 14176 |
| 132 | Ga0265314_10192895 | 3300031711 | Bacteria | 1211 |
| 133 | Ga0265342_10099438 | 3300031712 | Bacteria | 1659 |
| 134 | Ga0307414_10631406 | 3300032004 | Bacteria | 964 |
| 135 | Ga0307510_10002011 | 3300033180 | Bacteria | 22938 |
| 136 | Ga0307510_10005745 | 3300033180 | Bacteria | 14788 |
| 137 | Ga0315911_1000029 | 3300033442 | Bacteria | 82350 |
| 138 | Ga0373926_0005258 | 3300035083 | Bacteria | 4260 |
| 139 | Ga0373926_0062252 | 3300035083 | Bacteria | 1362 |
| 140 | Ga0373944_0196151 | 3300035089 | Bacteria | 729 |
| 141 | Ga0373923_0004116 | 3300035111 | Bacteria | 4785 |
| 142 | Ga0373923_0022318 | 3300035111 | Bacteria | 2481 |
| 143 | Ga0373936_0018274 | 3300035113 | Bacteria | 2706 |
| 144 | Ga0373936_0030449 | 3300035113 | Bacteria | 2128 |
| 145 | Ga0373936_0171334 | 3300035113 | Bacteria | 949 |
| 146 | Ga0373945_0023264 | 3300035116 | Bacteria | 2140 |
| 147 | Ga0373945_0028357 | 3300035116 | Bacteria | 1961 |
| 148 | Ga0373953_0049978 | 3300035117 | Bacteria | 1688 |
| 149 | Ga0373954_0180581 | 3300035118 | Bacteria | 1035 |
| 150 | Ga0373957_0092946 | 3300035120 | Bacteria | 1201 |
| 151 | Ga0373943_0010440 | 3300035170 | Bacteria | 4161 |
| 152 | Ga0373943_0014191 | 3300035170 | Bacteria | 3603 |
| 153 | Ga0373943_0553490 | 3300035170 | Bacteria | 675 |
| 154 | Ga0373946_0003822 | 3300035171 | Bacteria | 5346 |
| 155 | Ga0373931_0790525 | 3300035691 | Bacteria | 632 |
| 156 | Ga0373935_0006298 | 3300035692 | Bacteria | 7070 |
| 157 | Ga0373935_0168839 | 3300035692 | Bacteria | 1495 |
| 158 | Ga0373927_0000689 | 3300035695 | Bacteria | 25810 |
| 159 | Ga0373927_0059006 | 3300035695 | Bacteria | 2482 |
| 160 | Ga0373927_0161150 | 3300035695 | Bacteria | 1469 |
| 161 | Ga0373933_0037909 | 3300035724 | Bacteria | 2830 |
| 162 | Ga0373947_0002567 | 3300035725 | Bacteria | 10914 |
| 163 | Ga0373947_0036502 | 3300035725 | Bacteria | 2914 |
| 164 | Ga0373937_0002165 | 3300036401 | Bacteria | 16456 |
| 165 | Ga0373937_0432331 | 3300036401 | Bacteria | 1249 |
| 166 | Ga0373925_0003101 | 3300037068 | Bacteria | 13044 |
| 167 | Ga0373925_0009228 | 3300037068 | Bacteria | 7180 |
| 168 | Ga0395901_1206137 | 3300038443 | Bacteria | 722 |
| 169 | Ga0439447_009467 | 3300041407 | Bacteria | 2949 |
| 170 | Ga0439466_0000223 | 3300041411 | Bacteria | 22390 |
| 171 | Ga0439466_0013830 | 3300041411 | Bacteria | 2949 |
| 172 | Ga0439465_0053449 | 3300041413 | Bacteria | 1327 |
| 173 | Ga0439451_080902 | 3300042009 | Bacteria | 652 |
| 174 | Ga0439452_020791 | 3300042010 | Bacteria | 1717 |
| 175 | Ga0439456_000028 | 3300042013 | Bacteria | 53976 |
| 176 | Ga0439456_025599 | 3300042013 | Bacteria | 1253 |
| 177 | Ga0439456_031413 | 3300042013 | Bacteria | 1138 |
| 178 | Ga0439463_000157 | 3300042016 | Bacteria | 17433 |
| 179 | Ga0450903_031820 | 3300042138 | Bacteria | 795 |
| 180 | Ga0450907_000071 | 3300042146 | Bacteria | 39081 |
| 181 | Ga0439446_0023532 | 3300042156 | Bacteria | 1753 |
| 182 | Ga0450909_001772 | 3300042185 | Bacteria | 3038 |
| 183 | Ga0439434_0001048 | 3300042435 | Bacteria | 8014 |
| 184 | Ga0439440_0011850 | 3300042993 | Bacteria | 1845 |
| 185 | Ga0439440_0062630 | 3300042993 | Bacteria | 952 |
| 186 | Ga0466972_0033287 | 3300044658 | Bacteria | 2528 |
| 187 | Ga0466963_0284304 | 3300044694 | Bacteria | 1163 |
| 188 | Ga0466968_0023052 | 3300044735 | Bacteria | 2534 |
| 189 | Ga0466967_0179791 | 3300045976 | Bacteria | 1995 |
| 190 | Ga0466967_0786516 | 3300045976 | Bacteria | 944 |
| 191 | Ga0495617_023586 | 3300046452 | Bacteria | 2078 |
| 192 | Ga0495592_0022417 | 3300046454 | Bacteria | 4805 |
| 193 | Ga0495592_0102460 | 3300046454 | Bacteria | 2038 |
| 194 | Ga0495603_0001582 | 3300046455 | Bacteria | 13328 |
| 195 | Ga0495603_0046296 | 3300046455 | Bacteria | 2592 |
| 196 | Ga0495590_0004815 | 3300046457 | Bacteria | 5407 |
| 197 | Ga0495591_015234 | 3300046458 | Bacteria | 2725 |
| 198 | Ga0495629_0001500 | 3300046459 | Bacteria | 18364 |
| 199 | Ga0495638_0098889 | 3300046460 | Bacteria | 1747 |
| 200 | Ga0495641_0019862 | 3300046461 | Bacteria | 3424 |
| 201 | Ga0495641_0073247 | 3300046461 | Bacteria | 1537 |
| 202 | Ga0495653_0192973 | 3300046463 | Bacteria | 1388 |
| 203 | Ga0495650_0013397 | 3300046471 | Bacteria | 4337 |
| 204 | Ga0495580_0017445 | 3300046472 | Bacteria | 5370 |
| 205 | Ga0495580_0026091 | 3300046472 | Bacteria | 4263 |
| 206 | Ga0495582_0001498 | 3300046473 | Bacteria | 13187 |
| 207 | Ga0495582_0096896 | 3300046473 | Bacteria | 1649 |
| 208 | Ga0495605_0055964 | 3300046474 | Bacteria | 1903 |
| 209 | Ga0495639_0002214 | 3300046475 | Bacteria | 8558 |
| 210 | Ga0495639_0010545 | 3300046475 | Bacteria | 3980 |
| 211 | Ga0495662_0022039 | 3300046476 | Bacteria | 3077 |
| 212 | Ga0495664_0020455 | 3300046477 | Bacteria | 3817 |
| 213 | Ga0495664_0053599 | 3300046477 | Bacteria | 2398 |
| 214 | Ga0495584_0001433 | 3300046491 | Bacteria | 14353 |
| 215 | Ga0495584_0205679 | 3300046491 | Bacteria | 1000 |
| 216 | Ga0495585_0003679 | 3300046492 | Bacteria | 10251 |
| 217 | Ga0495594_0002146 | 3300046499 | Bacteria | 10267 |
| 218 | Ga0495607_0010965 | 3300046501 | Bacteria | 6061 |
| 219 | Ga0495583_0000918 | 3300046506 | Bacteria | 34803 |
| 220 | Ga0495583_0010664 | 3300046506 | Bacteria | 5341 |
| 221 | Ga0495608_0185300 | 3300046511 | Bacteria | 1316 |
| 222 | Ga0495616_0004213 | 3300046513 | Bacteria | 9106 |
| 223 | Ga0495618_0312617 | 3300046514 | Bacteria | 974 |
| 224 | Ga0495628_0041912 | 3300046516 | Bacteria | 3653 |
| 225 | Ga0495630_0002211 | 3300046517 | Bacteria | 13546 |
| 226 | Ga0495630_0057885 | 3300046517 | Bacteria | 2905 |
| 227 | Ga0495631_0164599 | 3300046518 | Bacteria | 951 |
| 228 | Ga0495632_0003436 | 3300046519 | Bacteria | 11242 |
| 229 | Ga0495637_0013956 | 3300046520 | Bacteria | 3801 |
| 230 | Ga0495643_0031707 | 3300046522 | Bacteria | 2939 |
| 231 | Ga0495643_0215864 | 3300046522 | Bacteria | 913 |
| 232 | Ga0495644_0019366 | 3300046523 | Bacteria | 2599 |
| 233 | Ga0495648_0076129 | 3300046524 | Bacteria | 1927 |
| 234 | Ga0495666_0021904 | 3300046526 | Bacteria | 3164 |
| 235 | Ga0495666_0042977 | 3300046526 | Bacteria | 2184 |
| 236 | Ga0495652_0043460 | 3300046529 | Bacteria | 3870 |
| 237 | Ga0495654_0164255 | 3300046530 | Bacteria | 972 |
| 238 | Ga0495665_0003724 | 3300046531 | Bacteria | 8266 |
| 239 | Ga0495640_0011188 | 3300046533 | Bacteria | 6908 |
| 240 | Ga0495640_0016796 | 3300046533 | Bacteria | 5471 |
| 241 | Ga0495586_0234979 | 3300046535 | Bacteria | 1044 |
| 242 | Ga0495587_0035212 | 3300046536 | Bacteria | 3017 |
| 243 | Ga0495609_0006680 | 3300046538 | Bacteria | 5855 |
| 244 | Ga0495622_0007988 | 3300046557 | Bacteria | 4906 |
| 245 | Ga0495634_0001270 | 3300046642 | Bacteria | 23127 |
| 246 | Ga0495634_0035380 | 3300046642 | Bacteria | 3421 |
| 247 | Ga0495611_0208497 | 3300046648 | Bacteria | 910 |
| 248 | Ga0495625_0366772 | 3300046660 | Bacteria | 906 |
| 249 | Ga0495635_0015274 | 3300046663 | Bacteria | 5372 |
| 250 | Ga0495635_0043334 | 3300046663 | Bacteria | 3106 |
| 251 | Ga0495659_0023237 | 3300046664 | Bacteria | 2105 |
| 252 | Ga0495661_0207106 | 3300046665 | Bacteria | 1023 |
| 253 | Ga0495588_0002635 | 3300046674 | Bacteria | 7683 |
| 254 | Ga0495657_0151918 | 3300046675 | Bacteria | 1437 |
| 255 | Ga0495599_0139554 | 3300046678 | Bacteria | 1503 |
| 256 | Ga0495646_0053215 | 3300046680 | Bacteria | 2441 |
| 257 | Ga0495646_0073374 | 3300046680 | Bacteria | 2010 |
| 258 | Ga0495647_0000649 | 3300046681 | Bacteria | 10310 |
| 259 | Ga0495658_0001998 | 3300046683 | Bacteria | 10393 |
| 260 | Ga0495669_0036836 | 3300046684 | Bacteria | 2163 |
| 261 | Ga0495613_0004899 | 3300046689 | Bacteria | 10058 |
| 262 | Ga0495624_0015721 | 3300046690 | Bacteria | 5103 |
| 263 | Ga0495670_0023497 | 3300046691 | Bacteria | 3042 |
| 264 | Ga0495671_0174169 | 3300046692 | Bacteria | 1045 |
| 265 | Ga0495589_0026195 | 3300046794 | Bacteria | 2955 |
| 266 | Ga0495660_0013918 | 3300046810 | Bacteria | 4663 |
| 267 | Ga0495660_0051708 | 3300046810 | Bacteria | 2234 |
| 268 | Ga0495581_0005949 | 3300047315 | Bacteria | 7070 |
| 269 | Ga0495581_0119835 | 3300047315 | Bacteria | 1531 |
| 270 | Ga0495604_0286443 | 3300047317 | Bacteria | 1111 |
| 271 | Ga0495636_0057465 | 3300047318 | Bacteria | 1638 |
| 272 | Ga0495674_0001148 | 3300047319 | Bacteria | 25513 |
| 273 | Ga0495674_0009113 | 3300047319 | Bacteria | 9428 |
| 274 | Ga0495672_0037691 | 3300047320 | Bacteria | 2955 |
| 275 | Ga0495676_0014823 | 3300047321 | Bacteria | 6960 |
| 276 | Ga0495683_0046046 | 3300047323 | Bacteria | 2189 |
| 277 | Ga0495683_0046800 | 3300047323 | Bacteria | 2171 |
| 278 | Ga0495677_0002617 | 3300047445 | Bacteria | 7042 |
| 279 | Ga0495679_021304 | 3300047446 | Bacteria | 2241 |
| 280 | Ga0495685_094385 | 3300047447 | Bacteria | 990 |
| 281 | Ga0495673_0001330 | 3300047469 | Bacteria | 20066 |
| 282 | Ga0495673_0017045 | 3300047469 | Bacteria | 3698 |
| 283 | Ga0495673_0041944 | 3300047469 | Bacteria | 2057 |
| 284 | Ga0495684_0010447 | 3300047471 | Bacteria | 7180 |
| 285 | Ga0495684_0087639 | 3300047471 | Bacteria | 2359 |
| 286 | Ga0495593_0023156 | 3300047673 | Bacteria | 3454 |
| 287 | Ga0495593_0231489 | 3300047673 | Bacteria | 926 |
| 288 | Ga0495614_0081522 | 3300048089 | Bacteria | 1402 |
| 289 | Ga0495626_0004695 | 3300048091 | Bacteria | 8285 |
| 290 | Ga0496104_0572277 | 3300048907 | Bacteria | 1040 |
| 291 | Ga0496106_0000705 | 3300048909 | Bacteria | 24064 |
| 292 | Ga0496108_0563532 | 3300048911 | Bacteria | 993 |
| 293 | Ga0496109_0016445 | 3300048912 | Bacteria | 6468 |
| 294 | Ga0496110_0150665 | 3300048913 | Bacteria | 2106 |
| 295 | Ga0496111_0036632 | 3300048914 | Bacteria | 3508 |
| 296 | Ga0496112_0286244 | 3300048915 | Bacteria | 1594 |
| 297 | Ga0496114_0273387 | 3300048917 | Bacteria | 1489 |
| 298 | Ga0496115_0321669 | 3300048918 | Bacteria | 1265 |
| 299 | Ga0496115_1029353 | 3300048918 | Bacteria | 628 |
| 300 | Ga0496116_0000514 | 3300048919 | Bacteria | 52327 |
| 301 | Ga0496116_0315352 | 3300048919 | Bacteria | 735 |
| 302 | Ga0496117_0001404 | 3300048920 | Bacteria | 34972 |
| 303 | Ga0496117_0065944 | 3300048920 | Bacteria | 2458 |
| 304 | Ga0496118_0009033 | 3300048921 | Bacteria | 10161 |
| 305 | Ga0496118_0065350 | 3300048921 | Bacteria | 2662 |
| 306 | Ga0496118_0118106 | 3300048921 | Bacteria | 1738 |
| 307 | Ga0496119_0010805 | 3300048922 | Bacteria | 7640 |
| 308 | Ga0496120_0072282 | 3300048923 | Bacteria | 1890 |
| 309 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 310 | Ga0496121_0000955 | 3300048924 | Bacteria | 52253 |
| 311 | Ga0496121_0399934 | 3300048924 | Bacteria | 900 |
| 312 | Ga0496121_0455143 | 3300048924 | Bacteria | 824 |
| 313 | Ga0496122_0002553 | 3300048925 | Bacteria | 25577 |
| 314 | Ga0496123_0001630 | 3300048926 | Bacteria | 30236 |
| 315 | Ga0496124_0015709 | 3300048927 | Bacteria | 7238 |
| 316 | Ga0496124_0020627 | 3300048927 | Bacteria | 6083 |
| 317 | Ga0496124_0248179 | 3300048927 | Bacteria | 1318 |
| 318 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 319 | Ga0496126_0029296 | 3300048929 | Bacteria | 5231 |
| 320 | Ga0496126_0092020 | 3300048929 | Bacteria | 2665 |
| 321 | Ga0496126_0219667 | 3300048929 | Bacteria | 1597 |
| 322 | Ga0496126_0297124 | 3300048929 | Bacteria | 1334 |
| 323 | Ga0496126_0754232 | 3300048929 | Bacteria | 751 |
| 324 | Ga0495678_020297 | 3300049459 | Bacteria | 2946 |
| 325 | Ga0495678_021260 | 3300049459 | Bacteria | 2860 |
| 326 | Ga0495678_037109 | 3300049459 | Bacteria | 1983 |
| 327 | Ga0495678_098129 | 3300049459 | Bacteria | 1019 |
| 328 | Ga0495682_0026715 | 3300049460 | Bacteria | 2141 |
| 329 | Ga0501033_0051177 | 3300049570 | Bacteria | 3061 |
| 330 | Ga0501033_0053026 | 3300049570 | Bacteria | 3004 |
| 331 | Ga0501034_0362062 | 3300049571 | Bacteria | 1377 |
| 332 | Ga0501037_0154048 | 3300049573 | Bacteria | 1641 |
| 333 | Ga0501043_0194667 | 3300049579 | Bacteria | 1575 |
| 334 | Ga0501047_0073966 | 3300049581 | Bacteria | 3280 |
| 335 | Ga0501048_0349285 | 3300049582 | Bacteria | 1055 |
| 336 | Ga0501067_0106520 | 3300049583 | Bacteria | 1558 |
| 337 | Ga0501069_0140436 | 3300049585 | Bacteria | 1386 |
| 338 | Ga0501070_0241832 | 3300049586 | Bacteria | 1477 |
| 339 | Ga0501070_0773978 | 3300049586 | Bacteria | 755 |
| 340 | Ga0501079_1035943 | 3300049741 | Bacteria | 646 |
| 341 | Ga0501080_0403041 | 3300049742 | Bacteria | 1230 |
| 342 | Ga0501035_0239006 | 3300049822 | Bacteria | 1545 |
| 343 | Ga0501044_0510446 | 3300049823 | Bacteria | 1102 |
| 344 | nmdc:mga00v17_49881_c1 | 3300050491 | Bacteria | 2541 |
| 345 | Ga0495601_0037763 | 3300053077 | Bacteria | 3019 |
| 346 | Ga0495612_0083194 | 3300053078 | Bacteria | 1347 |
| 347 | Ga0495612_0086302 | 3300053078 | Bacteria | 1324 |
| 348 | Ga0495619_0210527 | 3300053085 | Bacteria | 1346 |
| 349 | Ga0495619_0666502 | 3300053085 | Bacteria | 709 |
| 350 | Ga0500643_000025 | 3300053087 | Bacteria | 259605 |
| 351 | Ga0500566_0000516 | 3300053094 | Bacteria | 21571 |
| 352 | Ga0500640_002117 | 3300053095 | Bacteria | 6424 |
| 353 | Ga0500554_067632 | 3300053102 | Bacteria | 1157 |
| 354 | Ga0500556_0141421 | 3300053104 | Bacteria | 946 |
| 355 | Ga0500572_000055 | 3300053111 | Bacteria | 34260 |
| 356 | Ga0500572_005070 | 3300053111 | Bacteria | 2981 |
| 357 | Ga0500591_068279 | 3300053115 | Bacteria | 1618 |
| 358 | Ga0500608_006046 | 3300053122 | Bacteria | 4882 |
| 359 | Ga0500614_002236 | 3300053123 | Bacteria | 4369 |
| 360 | Ga0500618_001381 | 3300053125 | Bacteria | 10986 |
| 361 | Ga0500618_105602 | 3300053125 | Bacteria | 635 |
| 362 | Ga0500559_0238228 | 3300053136 | Bacteria | 857 |
| 363 | Ga0500589_144695 | 3300053147 | Bacteria | 975 |
| 364 | Ga0500590_074139 | 3300053148 | Bacteria | 1686 |
| 365 | Ga0500590_104301 | 3300053148 | Bacteria | 1356 |
| 366 | Ga0500603_000052 | 3300053150 | Bacteria | 28617 |
| 367 | Ga0500603_001546 | 3300053150 | Bacteria | 5227 |
| 368 | Ga0500630_001061 | 3300053159 | Bacteria | 12856 |
| 369 | Ga0500638_104094 | 3300053162 | Bacteria | 1320 |
| 370 | Ga0500639_000004 | 3300053163 | Bacteria | 216921 |
| 371 | Ga0500636_0002532 | 3300053177 | Bacteria | 10151 |
| 372 | Ga0500637_0058314 | 3300053178 | Bacteria | 2208 |
| 373 | Ga0500596_004634 | 3300053735 | Bacteria | 2505 |
| 374 | Ga0500601_002675 | 3300053737 | Bacteria | 1915 |
| 375 | Ga0500601_016275 | 3300053737 | Bacteria | 848 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8017057580 | 8017061959 | 131 |
| 2 | 3300045976 | Ga0466967_0179791 | Ga0466967_0179791_154_639 | 135 |
| 3 | iso_pu_bacteria | 2643221651 | 2644288143 | 137 |
| 4 | 3300049585 | Ga0501069_0140436 | Ga0501069_0140436_245_685 | 140 |
| 5 | 3300049586 | Ga0501070_0773978 | Ga0501070_0773978_43_495 | 140 |
| 6 | 3300048929 | Ga0496126_0029296 | Ga0496126_0029296_2081_2539 | 141 |
| 7 | 3300005327 | Ga0070658_10204895 | Ga0070658_102048952 | 142 |
| 8 | 3300005336 | Ga0070680_100242876 | Ga0070680_1002428761 | 142 |
| 9 | 3300005530 | Ga0070679_100075610 | Ga0070679_1000756103 | 142 |
| 10 | 3300005539 | Ga0068853_100145819 | Ga0068853_1001458192 | 142 |
| 11 | 3300005563 | Ga0068855_100153492 | Ga0068855_1001534923 | 142 |
| 12 | 3300005577 | Ga0068857_100208430 | Ga0068857_1002084302 | 142 |
| 13 | 3300009036 | Ga0105244_10029666 | Ga0105244_100296662 | 142 |
| 14 | 3300013100 | Ga0157373_10026664 | Ga0157373_100266643 | 142 |
| 15 | 3300014497 | Ga0182008_10089624 | Ga0182008_100896242 | 142 |
| 16 | 3300015261 | Ga0182006_1000785 | Ga0182006_10007852 | 142 |
| 17 | 3300015262 | Ga0182007_10000182 | Ga0182007_100001828 | 142 |
| 18 | 3300015265 | Ga0182005_1000622 | Ga0182005_100062213 | 142 |
| 19 | 3300025909 | Ga0207705_10103469 | Ga0207705_101034692 | 142 |
| 20 | 3300025919 | Ga0207657_10011877 | Ga0207657_100118772 | 142 |
| 21 | 3300025921 | Ga0207652_10218447 | Ga0207652_102184472 | 142 |
| 22 | 3300025932 | Ga0207690_10846166 | Ga0207690_108461662 | 142 |
| 23 | 3300025949 | Ga0207667_10149085 | Ga0207667_101490853 | 142 |
| 24 | 3300026041 | Ga0207639_10209618 | Ga0207639_102096182 | 142 |
| 25 | 3300031507 | Ga0307509_10188086 | Ga0307509_101880862 | 142 |
| 26 | 3300033180 | Ga0307510_10005745 | Ga0307510_1000574512 | 142 |
| 27 | 3300038443 | Ga0395901_1206137 | Ga0395901_1206137_130_591 | 142 |
| 28 | 3300046455 | Ga0495603_0046296 | Ga0495603_0046296_1961_2413 | 142 |
| 29 | 3300046522 | Ga0495643_0215864 | Ga0495643_0215864_223_669 | 142 |
| 30 | 3300046526 | Ga0495666_0042977 | Ga0495666_0042977_31_483 | 142 |
| 31 | 3300047323 | Ga0495683_0046800 | Ga0495683_0046800_221_667 | 142 |
| 32 | 3300049570 | Ga0501033_0051177 | Ga0501033_0051177_2241_2702 | 142 |
| 33 | 3300049570 | Ga0501033_0053026 | Ga0501033_0053026_2241_2702 | 142 |
| 34 | 3300049571 | Ga0501034_0362062 | Ga0501034_0362062_226_687 | 142 |
| 35 | 3300049573 | Ga0501037_0154048 | Ga0501037_0154048_371_832 | 142 |
| 36 | 3300049579 | Ga0501043_0194667 | Ga0501043_0194667_976_1437 | 142 |
| 37 | 3300049581 | Ga0501047_0073966 | Ga0501047_0073966_921_1382 | 142 |
| 38 | 3300049582 | Ga0501048_0349285 | Ga0501048_0349285_533_994 | 142 |
| 39 | 3300049583 | Ga0501067_0106520 | Ga0501067_0106520_230_691 | 142 |
| 40 | 3300049586 | Ga0501070_0241832 | Ga0501070_0241832_677_1138 | 142 |
| 41 | 3300049741 | Ga0501079_1035943 | Ga0501079_1035943_101_562 | 142 |
| 42 | 3300049742 | Ga0501080_0403041 | Ga0501080_0403041_228_689 | 142 |
| 43 | 3300049822 | Ga0501035_0239006 | Ga0501035_0239006_414_875 | 142 |
| 44 | 3300049823 | Ga0501044_0510446 | Ga0501044_0510446_410_871 | 142 |
| 45 | 3300053102 | Ga0500554_067632 | Ga0500554_067632_597_1049 | 142 |
| 46 | 3300053150 | Ga0500603_001546 | Ga0500603_001546_1176_1628 | 142 |
| 47 | 3300053162 | Ga0500638_104094 | Ga0500638_104094_762_1214 | 142 |
| 48 | 3300053178 | Ga0500637_0058314 | Ga0500637_0058314_1054_1506 | 142 |
| 49 | iso_pu_bacteria | 2517572143 | 2517893268 | 142 |
| 50 | iso_pu_bacteria | 2617270741 | 2617376645 | 142 |
| 51 | iso_pu_bacteria | 2824679649 | 2824682534 | 142 |
| 52 | iso_pu_bacteria | 2824746037 | 2824751678 | 142 |
| 53 | iso_pu_bacteria | 2885374607 | 2885374862 | 142 |
| 54 | iso_pu_bacteria | 2903748898 | 2903755732 | 142 |
| 55 | iso_pu_bacteria | 2904690495 | 2904696688 | 142 |
| 56 | iso_pu_bacteria | 2908756301 | 2908761308 | 142 |
| 57 | iso_pu_bacteria | 2922393267 | 2922395460 | 142 |
| 58 | iso_pu_bacteria | 2935630451 | 2935634207 | 142 |
| 59 | iso_pu_bacteria | 2935984226 | 2935989156 | 142 |
| 60 | iso_pu_bacteria | 2941507105 | 2941511097 | 142 |
| 61 | iso_pu_bacteria | 2941515067 | 2941518481 | 142 |
| 62 | iso_pu_bacteria | 2941523033 | 2941527256 | 142 |
| 63 | iso_pu_bacteria | 3005474847 | 3005479373 | 142 |
| 64 | iso_pu_bacteria | 8056689827 | 8056695779 | 142 |
| 65 | 3300045976 | Ga0466967_0786516 | Ga0466967_0786516_49_513 | 143 |
| 66 | 3300048929 | Ga0496126_0754232 | Ga0496126_0754232_80_544 | 143 |
| 67 | iso_pu_bacteria | 2513237137 | 2513859641 | 143 |
| 68 | iso_pu_bacteria | 2513237145 | 2513921692 | 143 |
| 69 | iso_pu_bacteria | 2885409591 | 2885410328 | 143 |
| 70 | iso_pu_bacteria | 2906635258 | 2906642273 | 143 |
| 71 | iso_pu_bacteria | 2906660503 | 2906667975 | 143 |
| 72 | iso_pu_bacteria | 2908739725 | 2908743663 | 143 |
| 73 | iso_pu_bacteria | 3005483717 | 3005490055 | 143 |
| 74 | 3300021384 | Ga0213876_10154659 | Ga0213876_101546592 | 144 |
| 75 | iso_pu_bacteria | 2511231004 | 2511253691 | 144 |
| 76 | iso_pu_bacteria | 2511231006 | 2511267565 | 144 |
| 77 | iso_pu_bacteria | 2511231018 | 2511339819 | 144 |
| 78 | iso_pu_bacteria | 2511231022 | 2511364003 | 144 |
| 79 | iso_pu_bacteria | 2512047018 | 2512325562 | 144 |
| 80 | iso_pu_bacteria | 2582580891 | 2583793090 | 144 |
| 81 | iso_pu_bacteria | 2597489887 | 2597858962 | 144 |
| 82 | iso_pu_bacteria | 2599185185 | 2599487600 | 144 |
| 83 | iso_pu_bacteria | 2599185257 | 2599806075 | 144 |
| 84 | iso_pu_bacteria | 2600254931 | 2600366782 | 144 |
| 85 | iso_pu_bacteria | 2623620446 | 2624493118 | 144 |
| 86 | iso_pu_bacteria | 2671180172 | 2671772859 | 144 |
| 87 | iso_pu_bacteria | 2740892503 | 2743738484 | 144 |
| 88 | iso_pu_bacteria | 2844665904 | 2844671498 | 144 |
| 89 | iso_pu_bacteria | 2919697872 | 2919699616 | 144 |
| 90 | iso_pu_bacteria | 2923153595 | 2923157542 | 144 |
| 91 | iso_pu_bacteria | 2984286254 | 2984288593 | 144 |
| 92 | iso_pu_bacteria | 3007395558 | 3007396864 | 144 |
| 93 | iso_pu_bacteria | 8015687852 | 8015691704 | 144 |
| 94 | iso_pu_bacteria | 8019769354 | 8019772112 | 144 |
| 95 | iso_pu_bacteria | 8019775933 | 8019776113 | 144 |
| 96 | iso_pu_bacteria | 8055770955 | 8055774892 | 144 |
| 97 | iso_pu_bacteria | 8056155041 | 8056160361 | 144 |
| 98 | iso_pu_bacteria | 8057798959 | 8057801418 | 144 |
| 99 | 3300005614 | Ga0068856_100000427 | Ga0068856_10000042729 | 145 |
| 100 | 3300006173 | Ga0070716_100622497 | Ga0070716_1006224971 | 145 |
| 101 | 3300025981 | Ga0207640_10033862 | Ga0207640_100338622 | 145 |
| 102 | 3300026078 | Ga0207702_10002256 | Ga0207702_100022563 | 145 |
| 103 | 3300031711 | Ga0265314_10003900 | Ga0265314_100039006 | 145 |
| 104 | iso_pu_bacteria | 2912963787 | 2912966050 | 145 |
| 105 | iso_pu_bacteria | 2939651529 | 2939656479 | 145 |
| 106 | 3300003215 | JGI25153J46596_10001025 | JGI25153J46596_1000102513 | 146 |
| 107 | 3300003794 | Ga0055531_10005197 | Ga0055531_100051974 | 146 |
| 108 | 3300005262 | Ga0065165_1004734 | Ga0065165_10047348 | 146 |
| 109 | 3300007788 | Ga0099795_10128740 | Ga0099795_101287401 | 146 |
| 110 | 3300025261 | Ga0209233_1005867 | Ga0209233_10058673 | 146 |
| 111 | 3300025297 | Ga0209758_1000100 | Ga0209758_1000100156 | 146 |
| 112 | 3300025299 | Ga0209256_1007360 | Ga0209256_10073604 | 146 |
| 113 | 3300025304 | Ga0209257_1001443 | Ga0209257_100144316 | 146 |
| 114 | 3300025304 | Ga0209257_1028072 | Ga0209257_10280721 | 146 |
| 115 | 3300033180 | Ga0307510_10002011 | Ga0307510_100020114 | 146 |
| 116 | 3300035083 | Ga0373926_0005258 | Ga0373926_0005258_83_556 | 146 |
| 117 | 3300035111 | Ga0373923_0004116 | Ga0373923_0004116_699_1172 | 146 |
| 118 | 3300035113 | Ga0373936_0171334 | Ga0373936_0171334_53_526 | 146 |
| 119 | 3300035116 | Ga0373945_0028357 | Ga0373945_0028357_27_500 | 146 |
| 120 | 3300035117 | Ga0373953_0049978 | Ga0373953_0049978_192_665 | 146 |
| 121 | 3300035120 | Ga0373957_0092946 | Ga0373957_0092946_611_1084 | 146 |
| 122 | 3300035170 | Ga0373943_0010440 | Ga0373943_0010440_1063_1536 | 146 |
| 123 | 3300035171 | Ga0373946_0003822 | Ga0373946_0003822_2657_3130 | 146 |
| 124 | 3300035692 | Ga0373935_0168839 | Ga0373935_0168839_414_887 | 146 |
| 125 | 3300035695 | Ga0373927_0161150 | Ga0373927_0161150_529_1002 | 146 |
| 126 | 3300035724 | Ga0373933_0037909 | Ga0373933_0037909_1145_1618 | 146 |
| 127 | 3300035725 | Ga0373947_0036502 | Ga0373947_0036502_418_891 | 146 |
| 128 | 3300036401 | Ga0373937_0432331 | Ga0373937_0432331_140_613 | 146 |
| 129 | 3300037068 | Ga0373925_0003101 | Ga0373925_0003101_9207_9680 | 146 |
| 130 | 3300046454 | Ga0495592_0102460 | Ga0495592_0102460_285_758 | 146 |
| 131 | 3300046461 | Ga0495641_0073247 | Ga0495641_0073247_488_961 | 146 |
| 132 | 3300046472 | Ga0495580_0026091 | Ga0495580_0026091_2681_3154 | 146 |
| 133 | 3300046473 | Ga0495582_0096896 | Ga0495582_0096896_1065_1538 | 146 |
| 134 | 3300046475 | Ga0495639_0010545 | Ga0495639_0010545_446_919 | 146 |
| 135 | 3300046477 | Ga0495664_0020455 | Ga0495664_0020455_688_1161 | 146 |
| 136 | 3300046514 | Ga0495618_0312617 | Ga0495618_0312617_302_775 | 146 |
| 137 | 3300046517 | Ga0495630_0057885 | Ga0495630_0057885_2412_2885 | 146 |
| 138 | 3300046526 | Ga0495666_0021904 | Ga0495666_0021904_2494_2967 | 146 |
| 139 | 3300046529 | Ga0495652_0043460 | Ga0495652_0043460_1050_1523 | 146 |
| 140 | 3300046533 | Ga0495640_0011188 | Ga0495640_0011188_4366_4839 | 146 |
| 141 | 3300046535 | Ga0495586_0234979 | Ga0495586_0234979_79_552 | 146 |
| 142 | 3300046536 | Ga0495587_0035212 | Ga0495587_0035212_216_689 | 146 |
| 143 | 3300046642 | Ga0495634_0035380 | Ga0495634_0035380_2627_3100 | 146 |
| 144 | 3300046663 | Ga0495635_0043334 | Ga0495635_0043334_1515_1988 | 146 |
| 145 | 3300046680 | Ga0495646_0073374 | Ga0495646_0073374_457_930 | 146 |
| 146 | 3300047315 | Ga0495581_0119835 | Ga0495581_0119835_415_888 | 146 |
| 147 | 3300047319 | Ga0495674_0009113 | Ga0495674_0009113_6281_6754 | 146 |
| 148 | 3300047471 | Ga0495684_0010447 | Ga0495684_0010447_992_1465 | 146 |
| 149 | 3300047673 | Ga0495593_0231489 | Ga0495593_0231489_309_782 | 146 |
| 150 | 3300048089 | Ga0495614_0081522 | Ga0495614_0081522_392_865 | 146 |
| 151 | 3300048909 | Ga0496106_0000705 | Ga0496106_0000705_4418_4864 | 146 |
| 152 | 3300048924 | Ga0496121_0399934 | Ga0496121_0399934_281_754 | 146 |
| 153 | 3300048929 | Ga0496126_0297124 | Ga0496126_0297124_331_798 | 146 |
| 154 | 3300053077 | Ga0495601_0037763 | Ga0495601_0037763_2491_2964 | 146 |
| 155 | 3300053078 | Ga0495612_0083194 | Ga0495612_0083194_822_1295 | 146 |
| 156 | 3300053078 | Ga0495612_0086302 | Ga0495612_0086302_554_1054 | 146 |
| 157 | 3300053085 | Ga0495619_0666502 | Ga0495619_0666502_84_557 | 146 |
| 158 | 3300053087 | Ga0500643_000025 | Ga0500643_000025_58252_58719 | 146 |
| 159 | 3300053104 | Ga0500556_0141421 | Ga0500556_0141421_414_914 | 146 |
| 160 | 3300053125 | Ga0500618_001381 | Ga0500618_001381_7913_8371 | 146 |
| 161 | 3300053125 | Ga0500618_105602 | Ga0500618_105602_26_493 | 146 |
| 162 | 3300053147 | Ga0500589_144695 | Ga0500589_144695_472_939 | 146 |
| 163 | 3300053148 | Ga0500590_104301 | Ga0500590_104301_144_617 | 146 |
| 164 | 3300053737 | Ga0500601_002675 | Ga0500601_002675_145_618 | 146 |
| 165 | iso_pu_bacteria | 2834028612 | 2834032780 | 146 |
| 166 | iso_pu_bacteria | 2840764183 | 2840764507 | 146 |
| 167 | iso_pu_bacteria | 2929138655 | 2929142057 | 146 |
| 168 | 3300003187 | JGI25151J46595_10015502 | JGI25151J46595_100155024 | 147 |
| 169 | 3300003771 | Ga0055526_1060592 | Ga0055526_10605922 | 147 |
| 170 | 3300003775 | Ga0055524_1004374 | Ga0055524_10043742 | 147 |
| 171 | 3300003790 | Ga0055528_1001797 | Ga0055528_100179710 | 147 |
| 172 | 3300005262 | Ga0065165_1005082 | Ga0065165_10050827 | 147 |
| 173 | 3300005338 | Ga0068868_101843410 | Ga0068868_1018434101 | 147 |
| 174 | 3300005467 | Ga0070706_100235219 | Ga0070706_1002352192 | 147 |
| 175 | 3300005467 | Ga0070706_100275372 | Ga0070706_1002753722 | 147 |
| 176 | 3300005468 | Ga0070707_100648203 | Ga0070707_1006482031 | 147 |
| 177 | 3300005518 | Ga0070699_100378425 | Ga0070699_1003784252 | 147 |
| 178 | 3300005536 | Ga0070697_100419363 | Ga0070697_1004193632 | 147 |
| 179 | 3300005539 | Ga0068853_100411253 | Ga0068853_1004112532 | 147 |
| 180 | 3300005563 | Ga0068855_100537150 | Ga0068855_1005371502 | 147 |
| 181 | 3300005937 | Ga0081455_10484354 | Ga0081455_104843541 | 147 |
| 182 | 3300006941 | Ga0099825_1028003 | Ga0099825_10280033 | 147 |
| 183 | 3300006942 | Ga0099824_1007084 | Ga0099824_100708416 | 147 |
| 184 | 3300006943 | Ga0099822_1001392 | Ga0099822_100139212 | 147 |
| 185 | 3300007265 | Ga0099794_10013241 | Ga0099794_100132414 | 147 |
| 186 | 3300007265 | Ga0099794_10026161 | Ga0099794_100261612 | 147 |
| 187 | 3300007265 | Ga0099794_10147258 | Ga0099794_101472582 | 147 |
| 188 | 3300007788 | Ga0099795_10039243 | Ga0099795_100392432 | 147 |
| 189 | 3300007788 | Ga0099795_10530526 | Ga0099795_105305261 | 147 |
| 190 | 3300009093 | Ga0105240_11383508 | Ga0105240_113835081 | 147 |
| 191 | 3300009545 | Ga0105237_10064347 | Ga0105237_100643472 | 147 |
| 192 | 3300009553 | Ga0105249_11270170 | Ga0105249_112701702 | 147 |
| 193 | 3300010159 | Ga0099796_10009094 | Ga0099796_100090944 | 147 |
| 194 | 3300010159 | Ga0099796_10340208 | Ga0099796_103402081 | 147 |
| 195 | 3300013296 | Ga0157374_10147436 | Ga0157374_101474363 | 147 |
| 196 | 3300013296 | Ga0157374_11132615 | Ga0157374_111326151 | 147 |
| 197 | 3300013306 | Ga0163162_10154756 | Ga0163162_101547562 | 147 |
| 198 | 3300025258 | Ga0209129_1000140 | Ga0209129_1000140107 | 147 |
| 199 | 3300025273 | Ga0209673_1000068 | Ga0209673_100006882 | 147 |
| 200 | 3300025294 | Ga0209025_1003243 | Ga0209025_10032438 | 147 |
| 201 | 3300025294 | Ga0209025_1005069 | Ga0209025_10050695 | 147 |
| 202 | 3300025295 | Ga0209564_1013582 | Ga0209564_10135823 | 147 |
| 203 | 3300025297 | Ga0209758_1065808 | Ga0209758_10658081 | 147 |
| 204 | 3300025297 | Ga0209758_1074199 | Ga0209758_10741992 | 147 |
| 205 | 3300025299 | Ga0209256_1001101 | Ga0209256_100110114 | 147 |
| 206 | 3300025302 | Ga0207426_1088438 | Ga0207426_10884381 | 147 |
| 207 | 3300025304 | Ga0209257_1073781 | Ga0209257_10737811 | 147 |
| 208 | 3300025910 | Ga0207684_10110480 | Ga0207684_101104803 | 147 |
| 209 | 3300025910 | Ga0207684_10803375 | Ga0207684_108033751 | 147 |
| 210 | 3300025915 | Ga0207693_10124907 | Ga0207693_101249072 | 147 |
| 211 | 3300025939 | Ga0207665_10277012 | Ga0207665_102770122 | 147 |
| 212 | 3300025949 | Ga0207667_11871323 | Ga0207667_118713231 | 147 |
| 213 | 3300027357 | Ga0209589_1000023 | Ga0209589_1000023171 | 147 |
| 214 | 3300027361 | Ga0209489_100032 | Ga0209489_100032171 | 147 |
| 215 | 3300027363 | Ga0209700_100040 | Ga0209700_100040171 | 147 |
| 216 | 3300027671 | Ga0209588_1077496 | Ga0209588_10774962 | 147 |
| 217 | 3300027671 | Ga0209588_1085073 | Ga0209588_10850732 | 147 |
| 218 | 3300031235 | Ga0265330_10099481 | Ga0265330_100994811 | 147 |
| 219 | 3300031344 | Ga0265316_10125149 | Ga0265316_101251493 | 147 |
| 220 | 3300031616 | Ga0307508_10080181 | Ga0307508_100801813 | 147 |
| 221 | 3300031711 | Ga0265314_10192895 | Ga0265314_101928952 | 147 |
| 222 | 3300031712 | Ga0265342_10099438 | Ga0265342_100994381 | 147 |
| 223 | 3300033442 | Ga0315911_1000029 | Ga0315911_100002921 | 147 |
| 224 | 3300035083 | Ga0373926_0062252 | Ga0373926_0062252_472_948 | 147 |
| 225 | 3300035089 | Ga0373944_0196151 | Ga0373944_0196151_29_505 | 147 |
| 226 | 3300035111 | Ga0373923_0022318 | Ga0373923_0022318_1167_1643 | 147 |
| 227 | 3300035113 | Ga0373936_0018274 | Ga0373936_0018274_1625_2101 | 147 |
| 228 | 3300035113 | Ga0373936_0030449 | Ga0373936_0030449_1391_1867 | 147 |
| 229 | 3300035116 | Ga0373945_0023264 | Ga0373945_0023264_1549_2025 | 147 |
| 230 | 3300035118 | Ga0373954_0180581 | Ga0373954_0180581_419_895 | 147 |
| 231 | 3300035170 | Ga0373943_0014191 | Ga0373943_0014191_772_1248 | 147 |
| 232 | 3300035170 | Ga0373943_0553490 | Ga0373943_0553490_153_638 | 147 |
| 233 | 3300035691 | Ga0373931_0790525 | Ga0373931_0790525_28_504 | 147 |
| 234 | 3300035692 | Ga0373935_0006298 | Ga0373935_0006298_5517_5993 | 147 |
| 235 | 3300035695 | Ga0373927_0000689 | Ga0373927_0000689_9402_9878 | 147 |
| 236 | 3300035695 | Ga0373927_0059006 | Ga0373927_0059006_1290_1775 | 147 |
| 237 | 3300035725 | Ga0373947_0002567 | Ga0373947_0002567_3084_3560 | 147 |
| 238 | 3300036401 | Ga0373937_0002165 | Ga0373937_0002165_8719_9195 | 147 |
| 239 | 3300037068 | Ga0373925_0009228 | Ga0373925_0009228_4509_4985 | 147 |
| 240 | 3300044694 | Ga0466963_0284304 | Ga0466963_0284304_551_1024 | 147 |
| 241 | 3300044735 | Ga0466968_0023052 | Ga0466968_0023052_1954_2424 | 147 |
| 242 | 3300046454 | Ga0495592_0022417 | Ga0495592_0022417_4058_4534 | 147 |
| 243 | 3300046455 | Ga0495603_0001582 | Ga0495603_0001582_2496_2972 | 147 |
| 244 | 3300046459 | Ga0495629_0001500 | Ga0495629_0001500_8850_9326 | 147 |
| 245 | 3300046461 | Ga0495641_0019862 | Ga0495641_0019862_2356_2832 | 147 |
| 246 | 3300046463 | Ga0495653_0192973 | Ga0495653_0192973_349_825 | 147 |
| 247 | 3300046472 | Ga0495580_0017445 | Ga0495580_0017445_4225_4701 | 147 |
| 248 | 3300046473 | Ga0495582_0001498 | Ga0495582_0001498_7194_7670 | 147 |
| 249 | 3300046475 | Ga0495639_0002214 | Ga0495639_0002214_445_921 | 147 |
| 250 | 3300046476 | Ga0495662_0022039 | Ga0495662_0022039_2477_2953 | 147 |
| 251 | 3300046477 | Ga0495664_0053599 | Ga0495664_0053599_1259_1735 | 147 |
| 252 | 3300046499 | Ga0495594_0002146 | Ga0495594_0002146_7639_8115 | 147 |
| 253 | 3300046511 | Ga0495608_0185300 | Ga0495608_0185300_572_1087 | 147 |
| 254 | 3300046516 | Ga0495628_0041912 | Ga0495628_0041912_2622_3098 | 147 |
| 255 | 3300046517 | Ga0495630_0002211 | Ga0495630_0002211_10110_10586 | 147 |
| 256 | 3300046531 | Ga0495665_0003724 | Ga0495665_0003724_4247_4723 | 147 |
| 257 | 3300046533 | Ga0495640_0016796 | Ga0495640_0016796_532_1008 | 147 |
| 258 | 3300046557 | Ga0495622_0007988 | Ga0495622_0007988_1898_2374 | 147 |
| 259 | 3300046642 | Ga0495634_0001270 | Ga0495634_0001270_11286_11762 | 147 |
| 260 | 3300046663 | Ga0495635_0015274 | Ga0495635_0015274_2452_2928 | 147 |
| 261 | 3300046674 | Ga0495588_0002635 | Ga0495588_0002635_1959_2435 | 147 |
| 262 | 3300046675 | Ga0495657_0151918 | Ga0495657_0151918_423_899 | 147 |
| 263 | 3300046678 | Ga0495599_0139554 | Ga0495599_0139554_766_1242 | 147 |
| 264 | 3300046680 | Ga0495646_0053215 | Ga0495646_0053215_784_1260 | 147 |
| 265 | 3300046681 | Ga0495647_0000649 | Ga0495647_0000649_6758_7234 | 147 |
| 266 | 3300046683 | Ga0495658_0001998 | Ga0495658_0001998_4495_4971 | 147 |
| 267 | 3300046689 | Ga0495613_0004899 | Ga0495613_0004899_3691_4167 | 147 |
| 268 | 3300046690 | Ga0495624_0015721 | Ga0495624_0015721_1685_2161 | 147 |
| 269 | 3300047315 | Ga0495581_0005949 | Ga0495581_0005949_3517_3993 | 147 |
| 270 | 3300047317 | Ga0495604_0286443 | Ga0495604_0286443_215_691 | 147 |
| 271 | 3300047319 | Ga0495674_0001148 | Ga0495674_0001148_22924_23400 | 147 |
| 272 | 3300047321 | Ga0495676_0014823 | Ga0495676_0014823_5328_5804 | 147 |
| 273 | 3300047469 | Ga0495673_0041944 | Ga0495673_0041944_1131_1607 | 147 |
| 274 | 3300047471 | Ga0495684_0087639 | Ga0495684_0087639_1716_2192 | 147 |
| 275 | 3300047673 | Ga0495593_0023156 | Ga0495593_0023156_754_1230 | 147 |
| 276 | 3300048907 | Ga0496104_0572277 | Ga0496104_0572277_93_569 | 147 |
| 277 | 3300048911 | Ga0496108_0563532 | Ga0496108_0563532_436_912 | 147 |
| 278 | 3300048912 | Ga0496109_0016445 | Ga0496109_0016445_4799_5275 | 147 |
| 279 | 3300048913 | Ga0496110_0150665 | Ga0496110_0150665_291_767 | 147 |
| 280 | 3300048914 | Ga0496111_0036632 | Ga0496111_0036632_202_678 | 147 |
| 281 | 3300048915 | Ga0496112_0286244 | Ga0496112_0286244_295_771 | 147 |
| 282 | 3300048917 | Ga0496114_0273387 | Ga0496114_0273387_997_1473 | 147 |
| 283 | 3300048918 | Ga0496115_0321669 | Ga0496115_0321669_718_1251 | 147 |
| 284 | 3300048918 | Ga0496115_1029353 | Ga0496115_1029353_116_592 | 147 |
| 285 | 3300053085 | Ga0495619_0210527 | Ga0495619_0210527_620_1096 | 147 |
| 286 | 3300053094 | Ga0500566_0000516 | Ga0500566_0000516_10174_10650 | 147 |
| 287 | 3300053095 | Ga0500640_002117 | Ga0500640_002117_3922_4398 | 147 |
| 288 | 3300053111 | Ga0500572_000055 | Ga0500572_000055_10174_10650 | 147 |
| 289 | 3300053115 | Ga0500591_068279 | Ga0500591_068279_637_1113 | 147 |
| 290 | 3300053122 | Ga0500608_006046 | Ga0500608_006046_894_1370 | 147 |
| 291 | 3300053123 | Ga0500614_002236 | Ga0500614_002236_986_1462 | 147 |
| 292 | 3300053136 | Ga0500559_0238228 | Ga0500559_0238228_337_813 | 147 |
| 293 | 3300053148 | Ga0500590_074139 | Ga0500590_074139_314_790 | 147 |
| 294 | 3300053150 | Ga0500603_000052 | Ga0500603_000052_23634_24110 | 147 |
| 295 | 3300053159 | Ga0500630_001061 | Ga0500630_001061_1115_1591 | 147 |
| 296 | 3300053163 | Ga0500639_000004 | Ga0500639_000004_141188_141664 | 147 |
| 297 | 3300053735 | Ga0500596_004634 | Ga0500596_004634_1928_2404 | 147 |
| 298 | 3300053737 | Ga0500601_016275 | Ga0500601_016275_102_578 | 147 |
| 299 | iso_pu_bacteria | 2554235341 | 2555670945 | 147 |
| 300 | iso_pu_bacteria | 2599185160 | 2599357492 | 147 |
| 301 | iso_pu_bacteria | 2599185161 | 2599364282 | 147 |
| 302 | iso_pu_bacteria | 2599185162 | 2599370603 | 147 |
| 303 | iso_pu_bacteria | 2599185163 | 2599377204 | 147 |
| 304 | iso_pu_bacteria | 2599185164 | 2599382791 | 147 |
| 305 | iso_pu_bacteria | 2599185165 | 2599389239 | 147 |
| 306 | iso_pu_bacteria | 2599185166 | 2599395828 | 147 |
| 307 | iso_pu_bacteria | 2599185168 | 2599408218 | 147 |
| 308 | iso_pu_bacteria | 2599185181 | 2599464019 | 147 |
| 309 | iso_pu_bacteria | 2599185182 | 2599471046 | 147 |
| 310 | iso_pu_bacteria | 2599185186 | 2599493038 | 147 |
| 311 | iso_pu_bacteria | 2599185356 | 2600217161 | 147 |
| 312 | iso_pu_bacteria | 2600255313 | 2601777332 | 147 |
| 313 | iso_pu_bacteria | 2667528171 | 2671100446 | 147 |
| 314 | iso_pu_bacteria | 2818991464 | 2819706107 | 147 |
| 315 | iso_pu_bacteria | 2917070673 | 2917074807 | 147 |
| 316 | iso_pu_bacteria | 2935353572 | 2935355206 | 147 |
| 317 | iso_pu_bacteria | 2945928738 | 2945932798 | 147 |
| 318 | iso_pu_bacteria | 637000220 | 637321280 | 147 |
| 319 | iso_pu_bacteria | 8055878733 | 8055881102 | 147 |
| 320 | iso_pu_bacteria | 8056161164 | 8056165366 | 147 |
| 321 | 3300003781 | Ga0055536_1000082 | Ga0055536_100008238 | 148 |
| 322 | 3300003791 | Ga0055530_10000124 | Ga0055530_1000012426 | 148 |
| 323 | 3300003792 | Ga0055540_1000467 | Ga0055540_10004679 | 148 |
| 324 | 3300005467 | Ga0070706_101678057 | Ga0070706_1016780571 | 148 |
| 325 | 3300006058 | Ga0075432_10009635 | Ga0075432_100096353 | 148 |
| 326 | 3300009092 | Ga0105250_10020026 | Ga0105250_100200263 | 148 |
| 327 | 3300009148 | Ga0105243_10106930 | Ga0105243_101069303 | 148 |
| 328 | 3300013102 | Ga0157371_10116147 | Ga0157371_101161472 | 148 |
| 329 | 3300013105 | Ga0157369_10139016 | Ga0157369_101390162 | 148 |
| 330 | 3300013306 | Ga0163162_10130463 | Ga0163162_101304632 | 148 |
| 331 | 3300013308 | Ga0157375_10766855 | Ga0157375_107668552 | 148 |
| 332 | 3300015262 | Ga0182007_10172909 | Ga0182007_101729091 | 148 |
| 333 | 3300017792 | Ga0163161_10050021 | Ga0163161_100500212 | 148 |
| 334 | 3300017792 | Ga0163161_10122971 | Ga0163161_101229712 | 148 |
| 335 | 3300025292 | Ga0209676_1000017 | Ga0209676_1000017265 | 148 |
| 336 | 3300025298 | Ga0209050_1000371 | Ga0209050_100037135 | 148 |
| 337 | 3300025303 | Ga0209051_1000234 | Ga0209051_100023436 | 148 |
| 338 | 3300025711 | Ga0207696_1025142 | Ga0207696_10251422 | 148 |
| 339 | 3300025728 | Ga0207655_1001852 | Ga0207655_10018522 | 148 |
| 340 | 3300025728 | Ga0207655_1009607 | Ga0207655_10096072 | 148 |
| 341 | 3300025910 | Ga0207684_11121851 | Ga0207684_111218511 | 148 |
| 342 | 3300027907 | Ga0207428_10119101 | Ga0207428_101191012 | 148 |
| 343 | 3300032004 | Ga0307414_10631406 | Ga0307414_106314062 | 148 |
| 344 | 3300041407 | Ga0439447_009467 | Ga0439447_009467_507_1013 | 148 |
| 345 | 3300041411 | Ga0439466_0000223 | Ga0439466_0000223_21677_22123 | 148 |
| 346 | 3300041411 | Ga0439466_0013830 | Ga0439466_0013830_507_1013 | 148 |
| 347 | 3300041413 | Ga0439465_0053449 | Ga0439465_0053449_544_1050 | 148 |
| 348 | 3300042009 | Ga0439451_080902 | Ga0439451_080902_177_623 | 148 |
| 349 | 3300042010 | Ga0439452_020791 | Ga0439452_020791_507_1013 | 148 |
| 350 | 3300042013 | Ga0439456_025599 | Ga0439456_025599_302_808 | 148 |
| 351 | 3300042013 | Ga0439456_031413 | Ga0439456_031413_452_898 | 148 |
| 352 | 3300042016 | Ga0439463_000157 | Ga0439463_000157_452_898 | 148 |
| 353 | 3300042138 | Ga0450903_031820 | Ga0450903_031820_182_688 | 148 |
| 354 | 3300042146 | Ga0450907_000071 | Ga0450907_000071_33438_33944 | 148 |
| 355 | 3300042156 | Ga0439446_0023532 | Ga0439446_0023532_626_1132 | 148 |
| 356 | 3300042185 | Ga0450909_001772 | Ga0450909_001772_1827_2333 | 148 |
| 357 | 3300042435 | Ga0439434_0001048 | Ga0439434_0001048_6750_7256 | 148 |
| 358 | 3300042993 | Ga0439440_0011850 | Ga0439440_0011850_886_1392 | 148 |
| 359 | 3300042993 | Ga0439440_0062630 | Ga0439440_0062630_20_466 | 148 |
| 360 | 3300044658 | Ga0466972_0033287 | Ga0466972_0033287_1377_1886 | 148 |
| 361 | 3300046452 | Ga0495617_023586 | Ga0495617_023586_1361_1858 | 148 |
| 362 | 3300046457 | Ga0495590_0004815 | Ga0495590_0004815_4620_5117 | 148 |
| 363 | 3300046458 | Ga0495591_015234 | Ga0495591_015234_326_823 | 148 |
| 364 | 3300046460 | Ga0495638_0098889 | Ga0495638_0098889_121_618 | 148 |
| 365 | 3300046471 | Ga0495650_0013397 | Ga0495650_0013397_550_1047 | 148 |
| 366 | 3300046474 | Ga0495605_0055964 | Ga0495605_0055964_195_692 | 148 |
| 367 | 3300046491 | Ga0495584_0001433 | Ga0495584_0001433_7263_7709 | 148 |
| 368 | 3300046491 | Ga0495584_0205679 | Ga0495584_0205679_195_692 | 148 |
| 369 | 3300046492 | Ga0495585_0003679 | Ga0495585_0003679_7068_7565 | 148 |
| 370 | 3300046501 | Ga0495607_0010965 | Ga0495607_0010965_3514_4011 | 148 |
| 371 | 3300046506 | Ga0495583_0000918 | Ga0495583_0000918_30391_30888 | 148 |
| 372 | 3300046506 | Ga0495583_0010664 | Ga0495583_0010664_2739_3185 | 148 |
| 373 | 3300046513 | Ga0495616_0004213 | Ga0495616_0004213_8112_8609 | 148 |
| 374 | 3300046518 | Ga0495631_0164599 | Ga0495631_0164599_42_539 | 148 |
| 375 | 3300046519 | Ga0495632_0003436 | Ga0495632_0003436_8124_8621 | 148 |
| 376 | 3300046520 | Ga0495637_0013956 | Ga0495637_0013956_2733_3230 | 148 |
| 377 | 3300046522 | Ga0495643_0031707 | Ga0495643_0031707_2047_2544 | 148 |
| 378 | 3300046523 | Ga0495644_0019366 | Ga0495644_0019366_176_673 | 148 |
| 379 | 3300046524 | Ga0495648_0076129 | Ga0495648_0076129_994_1491 | 148 |
| 380 | 3300046530 | Ga0495654_0164255 | Ga0495654_0164255_354_851 | 148 |
| 381 | 3300046538 | Ga0495609_0006680 | Ga0495609_0006680_4159_4656 | 148 |
| 382 | 3300046648 | Ga0495611_0208497 | Ga0495611_0208497_169_666 | 148 |
| 383 | 3300046660 | Ga0495625_0366772 | Ga0495625_0366772_356_853 | 148 |
| 384 | 3300046664 | Ga0495659_0023237 | Ga0495659_0023237_1349_1846 | 148 |
| 385 | 3300046665 | Ga0495661_0207106 | Ga0495661_0207106_404_901 | 148 |
| 386 | 3300046684 | Ga0495669_0036836 | Ga0495669_0036836_437_934 | 148 |
| 387 | 3300046691 | Ga0495670_0023497 | Ga0495670_0023497_1245_1742 | 148 |
| 388 | 3300046692 | Ga0495671_0174169 | Ga0495671_0174169_250_747 | 148 |
| 389 | 3300046794 | Ga0495589_0026195 | Ga0495589_0026195_2014_2511 | 148 |
| 390 | 3300046810 | Ga0495660_0013918 | Ga0495660_0013918_2097_2543 | 148 |
| 391 | 3300046810 | Ga0495660_0051708 | Ga0495660_0051708_1470_1967 | 148 |
| 392 | 3300047318 | Ga0495636_0057465 | Ga0495636_0057465_251_748 | 148 |
| 393 | 3300047320 | Ga0495672_0037691 | Ga0495672_0037691_2014_2511 | 148 |
| 394 | 3300047323 | Ga0495683_0046046 | Ga0495683_0046046_463_960 | 148 |
| 395 | 3300047445 | Ga0495677_0002617 | Ga0495677_0002617_6061_6558 | 148 |
| 396 | 3300047446 | Ga0495679_021304 | Ga0495679_021304_385_882 | 148 |
| 397 | 3300047447 | Ga0495685_094385 | Ga0495685_094385_22_519 | 148 |
| 398 | 3300047469 | Ga0495673_0001330 | Ga0495673_0001330_11440_11886 | 148 |
| 399 | 3300047469 | Ga0495673_0017045 | Ga0495673_0017045_1957_2454 | 148 |
| 400 | 3300048091 | Ga0495626_0004695 | Ga0495626_0004695_4351_4848 | 148 |
| 401 | 3300049459 | Ga0495678_020297 | Ga0495678_020297_1529_1975 | 148 |
| 402 | 3300049459 | Ga0495678_021260 | Ga0495678_021260_2014_2511 | 148 |
| 403 | 3300049459 | Ga0495678_037109 | Ga0495678_037109_1526_1972 | 148 |
| 404 | 3300049459 | Ga0495678_098129 | Ga0495678_098129_498_944 | 148 |
| 405 | 3300049460 | Ga0495682_0026715 | Ga0495682_0026715_1200_1697 | 148 |
| 406 | 3300053111 | Ga0500572_005070 | Ga0500572_005070_2190_2636 | 148 |
| 407 | 3300053177 | Ga0500636_0002532 | Ga0500636_0002532_8542_8988 | 148 |
| 408 | 3300005337 | Ga0070682_100296628 | Ga0070682_1002966281 | 149 |
| 409 | 3300005338 | Ga0068868_100545915 | Ga0068868_1005459152 | 149 |
| 410 | 3300026078 | Ga0207702_11699766 | Ga0207702_116997661 | 149 |
| 411 | 3300042013 | Ga0439456_000028 | Ga0439456_000028_30020_30469 | 149 |
| 412 | 3300003215 | JGI25153J46596_10106197 | JGI25153J46596_101061971 | 150 |
| 413 | 3300005347 | Ga0070668_100256123 | Ga0070668_1002561232 | 150 |
| 414 | 3300014497 | Ga0182008_10048731 | Ga0182008_100487312 | 150 |
| 415 | 3300015262 | Ga0182007_10011976 | Ga0182007_100119763 | 150 |
| 416 | 3300025297 | Ga0209758_1023046 | Ga0209758_10230462 | 150 |
| 417 | 3300048919 | Ga0496116_0315352 | Ga0496116_0315352_253_708 | 150 |
| 418 | 3300048920 | Ga0496117_0065944 | Ga0496117_0065944_1654_2106 | 150 |
| 419 | 3300048921 | Ga0496118_0065350 | Ga0496118_0065350_1739_2191 | 150 |
| 420 | 3300048921 | Ga0496118_0118106 | Ga0496118_0118106_527_982 | 150 |
| 421 | 3300048922 | Ga0496119_0010805 | Ga0496119_0010805_5529_5984 | 150 |
| 422 | 3300048923 | Ga0496120_0072282 | Ga0496120_0072282_290_745 | 150 |
| 423 | 3300048924 | Ga0496121_0000034 | Ga0496121_0000034_7640_8095 | 150 |
| 424 | 3300048924 | Ga0496121_0455143 | Ga0496121_0455143_110_577 | 150 |
| 425 | 3300048927 | Ga0496124_0015709 | Ga0496124_0015709_708_1163 | 150 |
| 426 | 3300048927 | Ga0496124_0248179 | Ga0496124_0248179_708_1163 | 150 |
| 427 | 3300048928 | Ga0496125_0000030 | Ga0496125_0000030_366838_367293 | 150 |
| 428 | 3300048929 | Ga0496126_0092020 | Ga0496126_0092020_621_1076 | 150 |
| 429 | 3300048929 | Ga0496126_0219667 | Ga0496126_0219667_570_1034 | 150 |
| 430 | 3300050491 | nmdc:mga00v17_49881_c1 | nmdc:mga00v17_49881_c1_765_1220 | 150 |
| 431 | 3300002737 | JGI25162J39368_1000095 | JGI25162J39368_100009547 | 151 |
| 432 | 3300002771 | JGI25163J39215_1000303 | JGI25163J39215_10003033 | 151 |
| 433 | 3300002772 | JGI25164J39214_1000069 | JGI25164J39214_100006949 | 151 |
| 434 | 3300003214 | JGI25165J46597_1000168 | JGI25165J46597_100016844 | 151 |
| 435 | 3300009148 | Ga0105243_10000570 | Ga0105243_100005702 | 151 |
| 436 | 3300009553 | Ga0105249_10152930 | Ga0105249_101529301 | 151 |
| 437 | 3300013102 | Ga0157371_10001096 | Ga0157371_1000109623 | 151 |
| 438 | 3300014497 | Ga0182008_10001418 | Ga0182008_100014189 | 151 |
| 439 | 3300025207 | Ga0209760_100018 | Ga0209760_100018114 | 151 |
| 440 | 3300025231 | Ga0207427_100015 | Ga0207427_100015394 | 151 |
| 441 | 3300025233 | Ga0209437_100027 | Ga0209437_100027121 | 151 |
| 442 | 3300025261 | Ga0209233_1000039 | Ga0209233_1000039394 | 151 |
| 443 | 3300025935 | Ga0207709_10004792 | Ga0207709_100047928 | 151 |
| 444 | 3300025961 | Ga0207712_10368643 | Ga0207712_103686432 | 151 |
| 445 | 3300048919 | Ga0496116_0000514 | Ga0496116_0000514_7652_8116 | 151 |
| 446 | 3300048920 | Ga0496117_0001404 | Ga0496117_0001404_7573_8037 | 151 |
| 447 | 3300048921 | Ga0496118_0009033 | Ga0496118_0009033_9551_10015 | 151 |
| 448 | 3300048924 | Ga0496121_0000955 | Ga0496121_0000955_44215_44679 | 151 |
| 449 | 3300048925 | Ga0496122_0002553 | Ga0496122_0002553_20737_21201 | 151 |
| 450 | 3300048926 | Ga0496123_0001630 | Ga0496123_0001630_7586_8050 | 151 |
| 451 | 3300048927 | Ga0496124_0020627 | Ga0496124_0020627_2401_2856 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f2e-assembly1.cif.gz_A | crystal structure of pa1607, a putative transcription factor | 0.9563 | 5 | 145 |
| 2f2e-assembly1.cif.gz_A | crystal structure of pa1607, a putative transcription factor | 0.9368 | 5 | 145 |
| 2hoe-assembly1.cif.gz_A | crystal structure of n-acetylglucosamine kinase (tm1224) from thermotoga maritima at 2.46 a resolution | 0.9131 | 39 | 84 |
| 4ija-assembly1.cif.gz_B | structure of s. aureus methicillin resistance factor mecr2 | 0.8956 | 27 | 83 |
| 4a5m-assembly1.cif.gz_B | redox regulator hypr in its oxidized form | 0.8885 | 12 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f2eB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9532 | 15 | 105 | 1.10.10.10 |
| 2f2eB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9327 | 15 | 105 | 1.10.10.10 |
| 2hoeA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9131 | 39 | 84 | 1.10.10.10 |
| af_P9WMG3_11_158_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8984 | 11 | 146 | 1.10.10.10 |
| af_P71983_1_102_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8979 | 11 | 107 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q7T653-F1-model_v4 | deleted | 0.9863 | 3 | 145 |
|
| AF-A0A6N8SFI0-F1-model_v4 | Transcriptional regulator | 0.9851 | 3 | 151 |
GO:0003677
|
| AF-F0KIW8-F1-model_v4 | HTH hxlR-type domain-containing protein | 0.9847 | 31 | 147 |
GO:0003677
|
| AF-A0A1B3MFP9-F1-model_v4 | deleted | 0.9824 | 3 | 151 |
|
| AF-A0A0A1PFI7-F1-model_v4 | Putative HTH-type transcriptional regulator YybR | 0.9794 | 3 | 145 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar