F446798
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 451 | 226 | 445 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300025919|Ga0207657_11012420|Ga0207657_110124201 |
| Length | 112 |
| Sequence | MPPAARVGDTTGHPGVITGPGVSTVLLGGQPAAVVGDLHTCSFPPPAVHPIVMDTHACPLVDGLKPHVGGVVAVGSTTVLIGGLFAARQGDQVIEAGAPNPIAAGAATVTIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 2 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 3 | 2904699407 | |||
| 4 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 167 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 169 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 173 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 174 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 204 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 205 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 206 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 207 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 208 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 216 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 218 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 219 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 223 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 224 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 225 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 226 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.67 |
| Metatranscriptomes | 0.22 |
| Isolates | 1.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.33 |
| Nodule | 0.22 |
| Rhizoplane | 7.76 |
| Rhizosphere | 89.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000008 | 3300002074 | Bacteria | 191483 |
| 2 | JGI24749J21850_1000014 | 3300002076 | Bacteria | 36092 |
| 3 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 4 | JGI24742J22300_10021316 | 3300002244 | Viruses | 1106 |
| 5 | JGI24751J29686_10000028 | 3300002459 | Bacteria | 94523 |
| 6 | rootL2_10237773 | 3300003322 | Viruses | 5224 |
| 7 | Ga0055526_1000001 | 3300003771 | Bacteria | 669703 |
| 8 | Ga0065714_10484319 | 3300005288 | Unclassified | 533 |
| 9 | Ga0065712_10001937 | 3300005290 | Bacteria | 5340 |
| 10 | Ga0065715_10029636 | 3300005293 | Bacteria | 1504 |
| 11 | Ga0065715_10207382 | 3300005293 | Unclassified | 1308 |
| 12 | Ga0070683_100661903 | 3300005329 | Bacteria | 1000 |
| 13 | Ga0070690_100988783 | 3300005330 | Unclassified | 662 |
| 14 | Ga0070670_100000093 | 3300005331 | Bacteria | 84800 |
| 15 | Ga0070670_101293729 | 3300005331 | Bacteria | 667 |
| 16 | Ga0068869_100131846 | 3300005334 | Bacteria | 1922 |
| 17 | Ga0068869_100384236 | 3300005334 | Bacteria | 1151 |
| 18 | Ga0070666_10054491 | 3300005335 | Bacteria | 2698 |
| 19 | Ga0070666_10185506 | 3300005335 | Bacteria | 1460 |
| 20 | Ga0070666_10547734 | 3300005335 | Unclassified | 841 |
| 21 | Ga0070666_10980573 | 3300005335 | Unclassified | 626 |
| 22 | Ga0070680_101563033 | 3300005336 | Unclassified | 571 |
| 23 | Ga0070682_100005456 | 3300005337 | Bacteria | 7080 |
| 24 | Ga0068868_100037865 | 3300005338 | Bacteria | 3741 |
| 25 | Ga0070689_100000841 | 3300005340 | Bacteria | 19071 |
| 26 | Ga0070689_100192971 | 3300005340 | Bacteria | 1659 |
| 27 | Ga0070689_100239051 | 3300005340 | Bacteria | 1495 |
| 28 | Ga0070687_100209543 | 3300005343 | Unclassified | 1186 |
| 29 | Ga0070687_100952416 | 3300005343 | Bacteria | 619 |
| 30 | Ga0070661_101748163 | 3300005344 | Unclassified | 527 |
| 31 | Ga0070692_10002029 | 3300005345 | Bacteria | 7690 |
| 32 | Ga0070692_10361531 | 3300005345 | Bacteria | 905 |
| 33 | Ga0070692_10855921 | 3300005345 | Bacteria | 625 |
| 34 | Ga0070668_100083262 | 3300005347 | Bacteria | 2511 |
| 35 | Ga0070669_100022236 | 3300005353 | Bacteria | 4535 |
| 36 | Ga0070669_100056846 | 3300005353 | Bacteria | 2869 |
| 37 | Ga0070669_100061477 | 3300005353 | Unclassified | 2760 |
| 38 | Ga0070675_100439519 | 3300005354 | Bacteria | 1169 |
| 39 | Ga0070671_100009376 | 3300005355 | Bacteria | 7862 |
| 40 | Ga0070671_100341312 | 3300005355 | Bacteria | 1278 |
| 41 | Ga0070674_102119873 | 3300005356 | Unclassified | 513 |
| 42 | Ga0070673_100011302 | 3300005364 | Bacteria | 6087 |
| 43 | Ga0070673_100243833 | 3300005364 | Unclassified | 1564 |
| 44 | Ga0070673_100581084 | 3300005364 | Bacteria | 1020 |
| 45 | Ga0070688_100095281 | 3300005365 | Bacteria | 1953 |
| 46 | Ga0070688_100977697 | 3300005365 | Bacteria | 671 |
| 47 | Ga0070688_101321359 | 3300005365 | Unclassified | 582 |
| 48 | Ga0070667_100001690 | 3300005367 | Bacteria | 19736 |
| 49 | Ga0070667_100012817 | 3300005367 | Bacteria | 6928 |
| 50 | Ga0070667_100138327 | 3300005367 | Bacteria | 2131 |
| 51 | Ga0070714_101371607 | 3300005435 | Bacteria | 690 |
| 52 | Ga0070714_101453999 | 3300005435 | Viruses | 669 |
| 53 | Ga0070701_10160680 | 3300005438 | Viruses | 1301 |
| 54 | Ga0070701_10760823 | 3300005438 | Bacteria | 657 |
| 55 | Ga0070711_100509373 | 3300005439 | Unclassified | 993 |
| 56 | Ga0070705_100017866 | 3300005440 | Bacteria | 3709 |
| 57 | Ga0070705_100714780 | 3300005440 | Bacteria | 788 |
| 58 | Ga0070705_100800389 | 3300005440 | Bacteria | 750 |
| 59 | Ga0070705_100860877 | 3300005440 | Bacteria | 726 |
| 60 | Ga0070705_101439340 | 3300005440 | Unclassified | 575 |
| 61 | Ga0070700_100005688 | 3300005441 | Bacteria | 6615 |
| 62 | Ga0070700_100045471 | 3300005441 | Bacteria | 2708 |
| 63 | Ga0070700_100631712 | 3300005441 | Bacteria | 843 |
| 64 | Ga0070694_100000051 | 3300005444 | Bacteria | 54318 |
| 65 | Ga0070694_100040746 | 3300005444 | Bacteria | 3096 |
| 66 | Ga0070694_100154224 | 3300005444 | Unclassified | 1680 |
| 67 | Ga0070694_100167811 | 3300005444 | Bacteria | 1615 |
| 68 | Ga0070694_100261739 | 3300005444 | Bacteria | 1312 |
| 69 | Ga0070694_100373480 | 3300005444 | Bacteria | 1110 |
| 70 | Ga0070694_100646877 | 3300005444 | Viruses | 855 |
| 71 | Ga0070708_100057527 | 3300005445 | Viruses | 3462 |
| 72 | Ga0070708_100064542 | 3300005445 | Bacteria | 3281 |
| 73 | Ga0070708_100924999 | 3300005445 | Unclassified | 818 |
| 74 | Ga0070663_100943173 | 3300005455 | Unclassified | 748 |
| 75 | Ga0070678_100053815 | 3300005456 | Bacteria | 2929 |
| 76 | Ga0070678_100270731 | 3300005456 | Unclassified | 1432 |
| 77 | Ga0070678_100364408 | 3300005456 | Bacteria | 1246 |
| 78 | Ga0070681_10006958 | 3300005458 | Bacteria | 11006 |
| 79 | Ga0070681_11092721 | 3300005458 | Bacteria | 718 |
| 80 | Ga0068867_100065592 | 3300005459 | Bacteria | 2702 |
| 81 | Ga0070685_10396014 | 3300005466 | Bacteria | 955 |
| 82 | Ga0070706_100017307 | 3300005467 | Bacteria | 6652 |
| 83 | Ga0070706_100225880 | 3300005467 | Bacteria | 1748 |
| 84 | Ga0070706_100246460 | 3300005467 | Unclassified | 1668 |
| 85 | Ga0070707_100015314 | 3300005468 | Bacteria | 7195 |
| 86 | Ga0070698_100003623 | 3300005471 | Bacteria | 16971 |
| 87 | Ga0070698_100028055 | 3300005471 | Bacteria | 5851 |
| 88 | Ga0070698_100059758 | 3300005471 | Bacteria | 3849 |
| 89 | Ga0070698_100692380 | 3300005471 | Bacteria | 961 |
| 90 | Ga0070698_101792734 | 3300005471 | Bacteria | 566 |
| 91 | Ga0070699_100027943 | 3300005518 | Viruses | 4865 |
| 92 | Ga0070679_101536707 | 3300005530 | Bacteria | 613 |
| 93 | Ga0070697_100109014 | 3300005536 | Viruses | 2305 |
| 94 | Ga0070697_100210248 | 3300005536 | Bacteria | 1656 |
| 95 | Ga0070697_100728199 | 3300005536 | Bacteria | 876 |
| 96 | Ga0068853_100086012 | 3300005539 | Bacteria | 2757 |
| 97 | Ga0068853_101217333 | 3300005539 | Bacteria | 727 |
| 98 | Ga0070672_100030826 | 3300005543 | Bacteria | 4033 |
| 99 | Ga0070672_100042541 | 3300005543 | Bacteria | 3498 |
| 100 | Ga0070672_100635939 | 3300005543 | Bacteria | 931 |
| 101 | Ga0070686_100628317 | 3300005544 | Bacteria | 849 |
| 102 | Ga0070686_101538284 | 3300005544 | Bacteria | 561 |
| 103 | Ga0070695_100000132 | 3300005545 | Bacteria | 34051 |
| 104 | Ga0070695_100041724 | 3300005545 | Bacteria | 2909 |
| 105 | Ga0070695_100214978 | 3300005545 | Bacteria | 1382 |
| 106 | Ga0070695_100295074 | 3300005545 | Bacteria | 1196 |
| 107 | Ga0070695_101394168 | 3300005545 | Viruses | 581 |
| 108 | Ga0070696_100104352 | 3300005546 | Bacteria | 2035 |
| 109 | Ga0070696_100357705 | 3300005546 | Unclassified | 1132 |
| 110 | Ga0070696_101578098 | 3300005546 | Unclassified | 563 |
| 111 | Ga0070693_100008064 | 3300005547 | Bacteria | 5171 |
| 112 | Ga0070693_100495912 | 3300005547 | Bacteria | 865 |
| 113 | Ga0070665_100059058 | 3300005548 | Bacteria | 3845 |
| 114 | Ga0070665_100730226 | 3300005548 | Bacteria | 1003 |
| 115 | Ga0070665_101123202 | 3300005548 | Unclassified | 797 |
| 116 | Ga0070704_100135160 | 3300005549 | Bacteria | 1917 |
| 117 | Ga0070664_100000981 | 3300005564 | Bacteria | 22345 |
| 118 | Ga0070664_100035409 | 3300005564 | Bacteria | 4191 |
| 119 | Ga0070664_100093270 | 3300005564 | Unclassified | 2608 |
| 120 | Ga0070664_100920338 | 3300005564 | Bacteria | 820 |
| 121 | Ga0068857_100001605 | 3300005577 | Bacteria | 18138 |
| 122 | Ga0068854_100542738 | 3300005578 | Bacteria | 985 |
| 123 | Ga0068856_100027841 | 3300005614 | Bacteria | 5514 |
| 124 | Ga0070702_100013341 | 3300005615 | Bacteria | 4147 |
| 125 | Ga0070702_100064184 | 3300005615 | Unclassified | 2147 |
| 126 | Ga0070702_100736886 | 3300005615 | Bacteria | 755 |
| 127 | Ga0068852_100418457 | 3300005616 | Bacteria | 1321 |
| 128 | Ga0068852_100858013 | 3300005616 | Bacteria | 924 |
| 129 | Ga0068859_100000901 | 3300005617 | Bacteria | 30305 |
| 130 | Ga0068859_100001569 | 3300005617 | Bacteria | 23304 |
| 131 | Ga0068859_100205257 | 3300005617 | Unclassified | 2056 |
| 132 | Ga0068859_102959927 | 3300005617 | Unclassified | 519 |
| 133 | Ga0068859_102971794 | 3300005617 | Bacteria | 518 |
| 134 | Ga0068864_100000087 | 3300005618 | Bacteria | 98532 |
| 135 | Ga0068864_100000730 | 3300005618 | Bacteria | 27499 |
| 136 | Ga0068864_100001498 | 3300005618 | Bacteria | 19249 |
| 137 | Ga0068864_100381321 | 3300005618 | Bacteria | 1336 |
| 138 | Ga0068864_100678354 | 3300005618 | Unclassified | 1005 |
| 139 | Ga0068861_100004876 | 3300005719 | Bacteria | 9030 |
| 140 | Ga0068861_100009079 | 3300005719 | Bacteria | 6854 |
| 141 | Ga0068861_100520624 | 3300005719 | Bacteria | 1079 |
| 142 | Ga0068861_101939584 | 3300005719 | Unclassified | 586 |
| 143 | Ga0068851_10068276 | 3300005834 | Bacteria | 1835 |
| 144 | Ga0068870_10052415 | 3300005840 | Bacteria | 2163 |
| 145 | Ga0068863_100001792 | 3300005841 | Bacteria | 21314 |
| 146 | Ga0068863_100012858 | 3300005841 | Bacteria | 8072 |
| 147 | Ga0068863_100081823 | 3300005841 | Bacteria | 3059 |
| 148 | Ga0068863_100117541 | 3300005841 | Bacteria | 2534 |
| 149 | Ga0068863_100176446 | 3300005841 | Bacteria | 2051 |
| 150 | Ga0068858_100000300 | 3300005842 | Bacteria | 53038 |
| 151 | Ga0068858_100000470 | 3300005842 | Bacteria | 42012 |
| 152 | Ga0068858_100009128 | 3300005842 | Bacteria | 9481 |
| 153 | Ga0068858_100209353 | 3300005842 | Unclassified | 1845 |
| 154 | Ga0068858_100223541 | 3300005842 | Bacteria | 1784 |
| 155 | Ga0068860_100911415 | 3300005843 | Bacteria | 895 |
| 156 | Ga0068862_100000534 | 3300005844 | Bacteria | 39782 |
| 157 | Ga0068862_102304953 | 3300005844 | Bacteria | 550 |
| 158 | Ga0075427_10097290 | 3300006194 | Unclassified | 545 |
| 159 | Ga0097621_100004458 | 3300006237 | Bacteria | 9752 |
| 160 | Ga0097621_100438191 | 3300006237 | Viruses | 1175 |
| 161 | Ga0097621_102147434 | 3300006237 | Bacteria | 534 |
| 162 | Ga0097621_102307503 | 3300006237 | Bacteria | 515 |
| 163 | Ga0068871_100080673 | 3300006358 | Bacteria | 2694 |
| 164 | Ga0068871_101003352 | 3300006358 | Bacteria | 777 |
| 165 | Ga0075428_100744928 | 3300006844 | Viruses | 1042 |
| 166 | Ga0075434_100791284 | 3300006871 | Unclassified | 965 |
| 167 | Ga0068865_100693539 | 3300006881 | Unclassified | 869 |
| 168 | Ga0097620_100000901 | 3300006931 | Bacteria | 30305 |
| 169 | Ga0097620_100001569 | 3300006931 | Bacteria | 23304 |
| 170 | Ga0097620_100205259 | 3300006931 | Unclassified | 2056 |
| 171 | Ga0097620_102961334 | 3300006931 | Unclassified | 519 |
| 172 | Ga0097620_102972588 | 3300006931 | Bacteria | 518 |
| 173 | Ga0111539_10001077 | 3300009094 | Bacteria | 36044 |
| 174 | Ga0111539_10067152 | 3300009094 | Bacteria | 4235 |
| 175 | Ga0111539_10105307 | 3300009094 | Bacteria | 3309 |
| 176 | Ga0111539_10440471 | 3300009094 | Bacteria | 1517 |
| 177 | Ga0111539_12542449 | 3300009094 | Bacteria | 594 |
| 178 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 179 | Ga0105247_10000273 | 3300009101 | Bacteria | 47941 |
| 180 | Ga0105247_10001576 | 3300009101 | Bacteria | 16197 |
| 181 | Ga0105247_10548949 | 3300009101 | Unclassified | 849 |
| 182 | Ga0114129_10022697 | 3300009147 | Bacteria | 8900 |
| 183 | Ga0114129_11309758 | 3300009147 | Viruses | 897 |
| 184 | Ga0114129_12172434 | 3300009147 | Unclassified | 668 |
| 185 | Ga0105241_10071776 | 3300009174 | Bacteria | 2689 |
| 186 | Ga0105242_10187217 | 3300009176 | Bacteria | 1830 |
| 187 | Ga0105248_10002535 | 3300009177 | Bacteria | 20341 |
| 188 | Ga0105248_10002695 | 3300009177 | Bacteria | 19727 |
| 189 | Ga0105248_10087401 | 3300009177 | Bacteria | 3508 |
| 190 | Ga0105248_10596977 | 3300009177 | Bacteria | 1246 |
| 191 | Ga0105248_11229356 | 3300009177 | Bacteria | 847 |
| 192 | Ga0105248_11834845 | 3300009177 | Unclassified | 688 |
| 193 | Ga0105237_10211067 | 3300009545 | Bacteria | 1941 |
| 194 | Ga0105237_10435341 | 3300009545 | Bacteria | 1317 |
| 195 | Ga0105238_10084423 | 3300009551 | Bacteria | 3165 |
| 196 | Ga0105249_10087514 | 3300009553 | Bacteria | 2907 |
| 197 | Ga0105249_10144230 | 3300009553 | Bacteria | 2286 |
| 198 | Ga0105249_10397604 | 3300009553 | Unclassified | 1407 |
| 199 | Ga0105249_10552339 | 3300009553 | Unclassified | 1202 |
| 200 | Ga0105249_11206248 | 3300009553 | Bacteria | 828 |
| 201 | Ga0105246_10046273 | 3300011119 | Bacteria | 2967 |
| 202 | Ga0105246_10721949 | 3300011119 | Bacteria | 876 |
| 203 | Ga0157371_10085991 | 3300013102 | Unclassified | 2227 |
| 204 | Ga0157369_10007182 | 3300013105 | Bacteria | 12834 |
| 205 | Ga0157369_10425091 | 3300013105 | Unclassified | 1377 |
| 206 | Ga0157374_10617713 | 3300013296 | Bacteria | 1094 |
| 207 | Ga0157374_11424504 | 3300013296 | Unclassified | 716 |
| 208 | Ga0157374_12548641 | 3300013296 | Unclassified | 539 |
| 209 | Ga0157378_10000039 | 3300013297 | Bacteria | 115427 |
| 210 | Ga0157378_10000400 | 3300013297 | Bacteria | 42656 |
| 211 | Ga0157378_10888987 | 3300013297 | Unclassified | 921 |
| 212 | Ga0163162_10008417 | 3300013306 | Bacteria | 10059 |
| 213 | Ga0163162_10049960 | 3300013306 | Bacteria | 4193 |
| 214 | Ga0163162_10058503 | 3300013306 | Bacteria | 3883 |
| 215 | Ga0163162_10200989 | 3300013306 | Bacteria | 2122 |
| 216 | Ga0163162_11714405 | 3300013306 | Unclassified | 718 |
| 217 | Ga0157372_10840092 | 3300013307 | Bacteria | 1066 |
| 218 | Ga0157372_10990741 | 3300013307 | Bacteria | 974 |
| 219 | Ga0157375_10000009 | 3300013308 | Bacteria | 366440 |
| 220 | Ga0157375_10007636 | 3300013308 | Bacteria | 9461 |
| 221 | Ga0157375_10098826 | 3300013308 | Bacteria | 2996 |
| 222 | Ga0157375_11366254 | 3300013308 | Unclassified | 834 |
| 223 | Ga0157375_11845750 | 3300013308 | Bacteria | 717 |
| 224 | Ga0163163_10088563 | 3300014325 | Bacteria | 3107 |
| 225 | Ga0163163_10309413 | 3300014325 | Bacteria | 1633 |
| 226 | Ga0157380_10000155 | 3300014326 | Bacteria | 39407 |
| 227 | Ga0157380_10006572 | 3300014326 | Bacteria | 8198 |
| 228 | Ga0182008_10001611 | 3300014497 | Bacteria | 14976 |
| 229 | Ga0157377_10269792 | 3300014745 | Bacteria | 1111 |
| 230 | Ga0157379_10057488 | 3300014968 | Bacteria | 3476 |
| 231 | Ga0157379_10100823 | 3300014968 | Bacteria | 2592 |
| 232 | Ga0157379_10604507 | 3300014968 | Unclassified | 1024 |
| 233 | Ga0182006_1109507 | 3300015261 | Bacteria | 971 |
| 234 | Ga0182007_10001949 | 3300015262 | Bacteria | 10677 |
| 235 | Ga0163161_10012539 | 3300017792 | Bacteria | 5885 |
| 236 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 237 | Ga0207697_10034066 | 3300025315 | Bacteria | 2085 |
| 238 | Ga0207656_10090065 | 3300025321 | Bacteria | 1391 |
| 239 | Ga0207653_10000144 | 3300025885 | Bacteria | 50761 |
| 240 | Ga0207710_10000267 | 3300025900 | Bacteria | 42967 |
| 241 | Ga0207710_10015464 | 3300025900 | Bacteria | 3225 |
| 242 | Ga0207710_10298743 | 3300025900 | Unclassified | 813 |
| 243 | Ga0207680_10099733 | 3300025903 | Bacteria | 1864 |
| 244 | Ga0207680_10492433 | 3300025903 | Unclassified | 873 |
| 245 | Ga0207645_10126802 | 3300025907 | Bacteria | 1659 |
| 246 | Ga0207643_10160679 | 3300025908 | Bacteria | 1352 |
| 247 | Ga0207643_10392445 | 3300025908 | Bacteria | 876 |
| 248 | Ga0207643_10526469 | 3300025908 | Unclassified | 757 |
| 249 | Ga0207643_11083040 | 3300025908 | Unclassified | 517 |
| 250 | Ga0207705_10087153 | 3300025909 | Bacteria | 2282 |
| 251 | Ga0207684_10010878 | 3300025910 | Bacteria | 7983 |
| 252 | Ga0207654_10021236 | 3300025911 | Bacteria | 3450 |
| 253 | Ga0207654_10778829 | 3300025911 | Bacteria | 690 |
| 254 | Ga0207707_10414768 | 3300025912 | Viruses | 1155 |
| 255 | Ga0207707_10928396 | 3300025912 | Bacteria | 718 |
| 256 | Ga0207707_11246093 | 3300025912 | Bacteria | 600 |
| 257 | Ga0207695_11575526 | 3300025913 | Unclassified | 537 |
| 258 | Ga0207671_10559002 | 3300025914 | Viruses | 912 |
| 259 | Ga0207671_10669268 | 3300025914 | Bacteria | 826 |
| 260 | Ga0207663_10486289 | 3300025916 | Unclassified | 957 |
| 261 | Ga0207660_10011962 | 3300025917 | Bacteria | 5665 |
| 262 | Ga0207657_11012420 | 3300025919 | Bacteria | 637 |
| 263 | Ga0207649_10000859 | 3300025920 | Bacteria | 19343 |
| 264 | Ga0207649_11333137 | 3300025920 | Unclassified | 568 |
| 265 | Ga0207652_10256672 | 3300025921 | Bacteria | 1577 |
| 266 | Ga0207646_10013512 | 3300025922 | Bacteria | 7802 |
| 267 | Ga0207681_10023038 | 3300025923 | Bacteria | 3977 |
| 268 | Ga0207681_10510991 | 3300025923 | Bacteria | 985 |
| 269 | Ga0207681_10554614 | 3300025923 | Unclassified | 946 |
| 270 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 271 | Ga0207650_10003683 | 3300025925 | Bacteria | 10478 |
| 272 | Ga0207650_10383987 | 3300025925 | Viruses | 1160 |
| 273 | Ga0207650_10517112 | 3300025925 | Bacteria | 999 |
| 274 | Ga0207687_10002111 | 3300025927 | Bacteria | 13587 |
| 275 | Ga0207700_10875566 | 3300025928 | Bacteria | 804 |
| 276 | Ga0207644_10804157 | 3300025931 | Bacteria | 786 |
| 277 | Ga0207690_10004924 | 3300025932 | Bacteria | 7878 |
| 278 | Ga0207706_10027988 | 3300025933 | Bacteria | 5036 |
| 279 | Ga0207706_10119874 | 3300025933 | Bacteria | 2313 |
| 280 | Ga0207686_10152856 | 3300025934 | Bacteria | 1609 |
| 281 | Ga0207686_10500684 | 3300025934 | Bacteria | 942 |
| 282 | Ga0207686_11248884 | 3300025934 | Bacteria | 609 |
| 283 | Ga0207670_10000860 | 3300025936 | Bacteria | 15940 |
| 284 | Ga0207670_10513907 | 3300025936 | Bacteria | 974 |
| 285 | Ga0207669_11489831 | 3300025937 | Bacteria | 577 |
| 286 | Ga0207691_10008323 | 3300025940 | Bacteria | 9961 |
| 287 | Ga0207691_10056881 | 3300025940 | Bacteria | 3562 |
| 288 | Ga0207691_10754790 | 3300025940 | Bacteria | 819 |
| 289 | Ga0207711_10000973 | 3300025941 | Bacteria | 27429 |
| 290 | Ga0207711_10005552 | 3300025941 | Bacteria | 10666 |
| 291 | Ga0207711_10055006 | 3300025941 | Bacteria | 3417 |
| 292 | Ga0207711_10469216 | 3300025941 | Bacteria | 1172 |
| 293 | Ga0207711_10582869 | 3300025941 | Bacteria | 1043 |
| 294 | Ga0207711_11239554 | 3300025941 | Unclassified | 688 |
| 295 | Ga0207689_10007977 | 3300025942 | Bacteria | 9250 |
| 296 | Ga0207689_10020022 | 3300025942 | Bacteria | 5636 |
| 297 | Ga0207689_10023233 | 3300025942 | Bacteria | 5206 |
| 298 | Ga0207689_10214193 | 3300025942 | Bacteria | 1592 |
| 299 | Ga0207661_10000194 | 3300025944 | Bacteria | 39579 |
| 300 | Ga0207679_10000255 | 3300025945 | Bacteria | 40708 |
| 301 | Ga0207679_10091225 | 3300025945 | Bacteria | 2357 |
| 302 | Ga0207667_10028542 | 3300025949 | Bacteria | 6059 |
| 303 | Ga0207667_10621002 | 3300025949 | Bacteria | 1088 |
| 304 | Ga0207651_10072362 | 3300025960 | Viruses | 2447 |
| 305 | Ga0207651_10576708 | 3300025960 | Unclassified | 981 |
| 306 | Ga0207651_10836943 | 3300025960 | Unclassified | 817 |
| 307 | Ga0207712_10108937 | 3300025961 | Unclassified | 2074 |
| 308 | Ga0207712_10237298 | 3300025961 | Bacteria | 1467 |
| 309 | Ga0207712_10800626 | 3300025961 | Bacteria | 828 |
| 310 | Ga0207668_10078936 | 3300025972 | Bacteria | 2379 |
| 311 | Ga0207668_10249821 | 3300025972 | Bacteria | 1440 |
| 312 | Ga0207640_10288982 | 3300025981 | Bacteria | 1292 |
| 313 | Ga0207640_10326388 | 3300025981 | Bacteria | 1224 |
| 314 | Ga0207640_11817922 | 3300025981 | Unclassified | 551 |
| 315 | Ga0207658_10001122 | 3300025986 | Bacteria | 21606 |
| 316 | Ga0207658_10003901 | 3300025986 | Bacteria | 10490 |
| 317 | Ga0207658_12113122 | 3300025986 | Unclassified | 512 |
| 318 | Ga0207703_10001875 | 3300026035 | Bacteria | 18690 |
| 319 | Ga0207703_10005164 | 3300026035 | Bacteria | 10555 |
| 320 | Ga0207703_10076353 | 3300026035 | Bacteria | 2779 |
| 321 | Ga0207703_10200957 | 3300026035 | Bacteria | 1771 |
| 322 | Ga0207703_11106439 | 3300026035 | Unclassified | 761 |
| 323 | Ga0207703_11336656 | 3300026035 | Bacteria | 689 |
| 324 | Ga0207703_11673273 | 3300026035 | Unclassified | 612 |
| 325 | Ga0207703_12052308 | 3300026035 | Unclassified | 548 |
| 326 | Ga0207639_10748736 | 3300026041 | Bacteria | 908 |
| 327 | Ga0207678_10465586 | 3300026067 | Bacteria | 1100 |
| 328 | Ga0207708_10014852 | 3300026075 | Bacteria | 5829 |
| 329 | Ga0207708_10133055 | 3300026075 | Unclassified | 1946 |
| 330 | Ga0207702_10033060 | 3300026078 | Bacteria | 4317 |
| 331 | Ga0207641_10008505 | 3300026088 | Bacteria | 8481 |
| 332 | Ga0207641_10024821 | 3300026088 | Unclassified | 4941 |
| 333 | Ga0207641_10225352 | 3300026088 | Unclassified | 1740 |
| 334 | Ga0207641_10328691 | 3300026088 | Bacteria | 1452 |
| 335 | Ga0207641_11042623 | 3300026088 | Bacteria | 815 |
| 336 | Ga0207648_10065058 | 3300026089 | Bacteria | 3179 |
| 337 | Ga0207648_10602348 | 3300026089 | Bacteria | 1013 |
| 338 | Ga0207676_10000143 | 3300026095 | Bacteria | 62176 |
| 339 | Ga0207676_10012135 | 3300026095 | Bacteria | 6167 |
| 340 | Ga0207676_10197761 | 3300026095 | Bacteria | 1774 |
| 341 | Ga0207676_10518895 | 3300026095 | Bacteria | 1134 |
| 342 | Ga0207674_10000570 | 3300026116 | Bacteria | 48354 |
| 343 | Ga0207674_10301231 | 3300026116 | Unclassified | 1552 |
| 344 | Ga0207675_100060409 | 3300026118 | Bacteria | 3539 |
| 345 | Ga0207675_100935369 | 3300026118 | Unclassified | 884 |
| 346 | Ga0207683_10001071 | 3300026121 | Bacteria | 24964 |
| 347 | Ga0207683_10213398 | 3300026121 | Bacteria | 1757 |
| 348 | Ga0207683_10954977 | 3300026121 | Bacteria | 796 |
| 349 | Ga0207683_11188262 | 3300026121 | Unclassified | 707 |
| 350 | Ga0207698_10204726 | 3300026142 | Bacteria | 1770 |
| 351 | Ga0207698_10969270 | 3300026142 | Unclassified | 860 |
| 352 | Ga0207428_10001769 | 3300027907 | Bacteria | 22136 |
| 353 | Ga0207428_10666669 | 3300027907 | Unclassified | 746 |
| 354 | Ga0268266_10041093 | 3300028379 | Bacteria | 3944 |
| 355 | Ga0268266_11028852 | 3300028379 | Unclassified | 797 |
| 356 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 357 | Ga0268264_10023412 | 3300028381 | Bacteria | 5039 |
| 358 | Ga0268264_10443802 | 3300028381 | Bacteria | 1256 |
| 359 | Ga0268264_10450449 | 3300028381 | Unclassified | 1247 |
| 360 | Ga0265760_10051947 | 3300031090 | Unclassified | 1235 |
| 361 | Ga0307508_10161662 | 3300031616 | Bacteria | 1843 |
| 362 | Ga0373934_0218515 | 3300035086 | Bacteria | 786 |
| 363 | Ga0373957_0208593 | 3300035120 | Bacteria | 816 |
| 364 | Ga0373961_0122150 | 3300035241 | Unclassified | 864 |
| 365 | Ga0373933_0493417 | 3300035724 | Bacteria | 802 |
| 366 | Ga0373937_0337245 | 3300036401 | Bacteria | 1427 |
| 367 | Ga0439435_0008888 | 3300042436 | Unclassified | 2342 |
| 368 | Ga0453684_0013456 | 3300044712 | Bacteria | 13282 |
| 369 | Ga0495651_0271718 | 3300046462 | Bacteria | 1149 |
| 370 | Ga0495653_0863860 | 3300046463 | Unclassified | 541 |
| 371 | Ga0495580_0021924 | 3300046472 | Bacteria | 4709 |
| 372 | Ga0495584_0027372 | 3300046491 | Unclassified | 2889 |
| 373 | Ga0495606_0012280 | 3300046507 | Bacteria | 6889 |
| 374 | Ga0495608_0589976 | 3300046511 | Bacteria | 667 |
| 375 | Ga0495630_1013181 | 3300046517 | Bacteria | 631 |
| 376 | Ga0495632_0481900 | 3300046519 | Unclassified | 536 |
| 377 | Ga0495643_0000079 | 3300046522 | Bacteria | 162735 |
| 378 | Ga0495643_0477336 | 3300046522 | Unclassified | 539 |
| 379 | Ga0495652_0477611 | 3300046529 | Bacteria | 868 |
| 380 | Ga0495621_0013401 | 3300046539 | Bacteria | 2575 |
| 381 | Ga0495597_0023958 | 3300046542 | Bacteria | 2821 |
| 382 | Ga0495667_0300143 | 3300046559 | Bacteria | 1018 |
| 383 | Ga0495656_0549393 | 3300046615 | Bacteria | 615 |
| 384 | Ga0495611_0191022 | 3300046648 | Bacteria | 956 |
| 385 | Ga0495625_0063658 | 3300046660 | Bacteria | 2604 |
| 386 | Ga0495661_0031301 | 3300046665 | Bacteria | 3379 |
| 387 | Ga0495657_0081093 | 3300046675 | Bacteria | 2099 |
| 388 | Ga0495599_0550862 | 3300046678 | Bacteria | 675 |
| 389 | Ga0495623_0636386 | 3300046679 | Bacteria | 551 |
| 390 | Ga0495624_0532585 | 3300046690 | Unclassified | 702 |
| 391 | Ga0495624_0786338 | 3300046690 | Bacteria | 563 |
| 392 | Ga0495670_0003887 | 3300046691 | Bacteria | 7337 |
| 393 | Ga0495604_0338509 | 3300047317 | Bacteria | 1002 |
| 394 | Ga0495680_0741620 | 3300047322 | Bacteria | 646 |
| 395 | Ga0495683_0018811 | 3300047323 | Bacteria | 3568 |
| 396 | Ga0495687_000187 | 3300047443 | Bacteria | 90147 |
| 397 | Ga0495687_130371 | 3300047443 | Bacteria | 891 |
| 398 | Ga0496100_0136710 | 3300048903 | Bacteria | 1732 |
| 399 | Ga0496100_0414257 | 3300048903 | Unclassified | 1028 |
| 400 | Ga0496101_0248559 | 3300048904 | Bacteria | 1385 |
| 401 | Ga0496102_0004345 | 3300048905 | Bacteria | 11980 |
| 402 | Ga0496102_0355391 | 3300048905 | Bacteria | 1379 |
| 403 | Ga0496102_0563642 | 3300048905 | Bacteria | 1062 |
| 404 | Ga0496103_0162688 | 3300048906 | Bacteria | 1432 |
| 405 | Ga0496103_0580779 | 3300048906 | Unclassified | 714 |
| 406 | Ga0496104_0004448 | 3300048907 | Bacteria | 12207 |
| 407 | Ga0496104_0224055 | 3300048907 | Viruses | 1793 |
| 408 | Ga0496105_0045730 | 3300048908 | Unclassified | 3612 |
| 409 | Ga0496106_0015712 | 3300048909 | Bacteria | 5601 |
| 410 | Ga0496106_0023803 | 3300048909 | Bacteria | 4552 |
| 411 | Ga0496106_0181185 | 3300048909 | Bacteria | 1672 |
| 412 | Ga0496107_0023277 | 3300048910 | Unclassified | 4380 |
| 413 | Ga0496107_0498886 | 3300048910 | Unclassified | 903 |
| 414 | Ga0496108_0002232 | 3300048911 | Bacteria | 15524 |
| 415 | Ga0496108_0006982 | 3300048911 | Bacteria | 9139 |
| 416 | Ga0496108_0688407 | 3300048911 | Unclassified | 887 |
| 417 | Ga0496109_0040979 | 3300048912 | Unclassified | 4195 |
| 418 | Ga0496109_0046803 | 3300048912 | Bacteria | 3930 |
| 419 | Ga0496110_0012584 | 3300048913 | Bacteria | 6959 |
| 420 | Ga0496112_0000842 | 3300048915 | Bacteria | 21887 |
| 421 | Ga0496112_0056731 | 3300048915 | Bacteria | 3855 |
| 422 | Ga0496112_0823475 | 3300048915 | Bacteria | 852 |
| 423 | Ga0496112_1033599 | 3300048915 | Unclassified | 741 |
| 424 | Ga0496113_0016027 | 3300048916 | Bacteria | 5171 |
| 425 | Ga0496113_0169607 | 3300048916 | Bacteria | 1728 |
| 426 | Ga0496114_0276440 | 3300048917 | Bacteria | 1480 |
| 427 | Ga0496114_0319255 | 3300048917 | Bacteria | 1372 |
| 428 | Ga0496114_0705964 | 3300048917 | Unclassified | 884 |
| 429 | Ga0496114_1260907 | 3300048917 | Unclassified | 626 |
| 430 | Ga0496115_0014894 | 3300048918 | Bacteria | 5897 |
| 431 | Ga0496115_0436370 | 3300048918 | Bacteria | 1059 |
| 432 | Ga0496115_1441837 | 3300048918 | Unclassified | 507 |
| 433 | Ga0496121_0890158 | 3300048924 | Unclassified | 513 |
| 434 | Ga0495682_0061526 | 3300049460 | Bacteria | 1355 |
| 435 | Ga0501294_028542 | 3300049517 | Unclassified | 640 |
| 436 | Ga0501217_277748 | 3300049661 | Unclassified | 547 |
| 437 | nmdc:mga05p37_310801_c1 | 3300050507 | Unclassified | 1868 |
| 438 | nmdc:mga08y16_2045143_c1 | 3300050511 | Bacteria | 521 |
| 439 | nmdc:mga08y16_399536_c1 | 3300050511 | Bacteria | 1407 |
| 440 | nmdc:mga08y16_569827_c1 | 3300050511 | Bacteria | 1144 |
| 441 | Ga0495601_0560936 | 3300053077 | Bacteria | 734 |
| 442 | Ga0500651_0018416 | 3300053093 | Unclassified | 4323 |
| 443 | Ga0500568_0003238 | 3300053139 | Bacteria | 9207 |
| 444 | Ga0500568_0005012 | 3300053139 | Bacteria | 6943 |
| 445 | Ga0500616_0002597 | 3300053153 | Bacteria | 14817 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005471 | Ga0070698_100059758 | Ga0070698_1000597583 | 60 |
| 2 | 3300046472 | Ga0495580_0021924 | Ga0495580_0021924_1119_1415 | 65 |
| 3 | 3300047323 | Ga0495683_0018811 | Ga0495683_0018811_1113_1409 | 65 |
| 4 | 3300047443 | Ga0495687_130371 | Ga0495687_130371_321_617 | 65 |
| 5 | 3300049460 | Ga0495682_0061526 | Ga0495682_0061526_677_973 | 65 |
| 6 | iso_pu_bacteria | 2861520306 | 2861523525 | 65 |
| 7 | iso_pu_bacteria | 8057568493 | 8057573648 | 65 |
| 8 | 3300053139 | Ga0500568_0003238 | Ga0500568_0003238_2360_2656 | 66 |
| 9 | 3300005340 | Ga0070689_100000841 | Ga0070689_10000084110 | 67 |
| 10 | 3300005458 | Ga0070681_11092721 | Ga0070681_110927212 | 67 |
| 11 | 3300005842 | Ga0068858_100000470 | Ga0068858_1000004701 | 67 |
| 12 | 3300025912 | Ga0207707_10928396 | Ga0207707_109283962 | 67 |
| 13 | 3300046522 | Ga0495643_0477336 | Ga0495643_0477336_81_377 | 67 |
| 14 | 3300046542 | Ga0495597_0023958 | Ga0495597_0023958_1312_1608 | 67 |
| 15 | 3300047443 | Ga0495687_000187 | Ga0495687_000187_57589_57885 | 67 |
| 16 | iso_pu_bacteria | 2842134933 | 2842136647 | 67 |
| 17 | 3300005471 | Ga0070698_100692380 | Ga0070698_1006923802 | 68 |
| 18 | 3300005618 | Ga0068864_100678354 | Ga0068864_1006783542 | 68 |
| 19 | 3300025942 | Ga0207689_10214193 | Ga0207689_102141933 | 68 |
| 20 | 3300048903 | Ga0496100_0414257 | Ga0496100_0414257_354_620 | 68 |
| 21 | 3300048904 | Ga0496101_0248559 | Ga0496101_0248559_468_734 | 68 |
| 22 | 3300048905 | Ga0496102_0355391 | Ga0496102_0355391_805_1071 | 68 |
| 23 | 3300048906 | Ga0496103_0162688 | Ga0496103_0162688_325_591 | 68 |
| 24 | 3300048909 | Ga0496106_0181185 | Ga0496106_0181185_997_1263 | 68 |
| 25 | 3300048910 | Ga0496107_0498886 | Ga0496107_0498886_194_460 | 68 |
| 26 | 3300048917 | Ga0496114_0319255 | Ga0496114_0319255_385_651 | 68 |
| 27 | 3300048918 | Ga0496115_0436370 | Ga0496115_0436370_250_516 | 68 |
| 28 | 3300005548 | Ga0070665_101123202 | Ga0070665_1011232022 | 69 |
| 29 | 3300025927 | Ga0207687_10002111 | Ga0207687_100021116 | 69 |
| 30 | 3300025936 | Ga0207670_10000860 | Ga0207670_100008601 | 69 |
| 31 | 3300026035 | Ga0207703_10001875 | Ga0207703_1000187510 | 69 |
| 32 | 3300028379 | Ga0268266_11028852 | Ga0268266_110288522 | 69 |
| 33 | 3300048917 | Ga0496114_0705964 | Ga0496114_0705964_477_773 | 69 |
| 34 | 3300013308 | Ga0157375_11845750 | Ga0157375_118457502 | 70 |
| 35 | 3300009094 | Ga0111539_10001077 | Ga0111539_1000107727 | 71 |
| 36 | 3300009553 | Ga0105249_10397604 | Ga0105249_103976042 | 71 |
| 37 | 3300035724 | Ga0373933_0493417 | Ga0373933_0493417_466_762 | 71 |
| 38 | 3300046517 | Ga0495630_1013181 | Ga0495630_1013181_287_583 | 71 |
| 39 | 3300046678 | Ga0495599_0550862 | Ga0495599_0550862_294_590 | 71 |
| 40 | 3300046690 | Ga0495624_0532585 | Ga0495624_0532585_381_677 | 71 |
| 41 | 3300046690 | Ga0495624_0786338 | Ga0495624_0786338_83_379 | 71 |
| 42 | 3300048917 | Ga0496114_1260907 | Ga0496114_1260907_232_528 | 71 |
| 43 | iso_pu_bacteria | 2904699407 | 2904708340 | 74 |
| 44 | iso_pu_bacteria | 3005445848 | 3005452202 | 74 |
| 45 | iso_pu_bacteria | 637000159 | 637078512 | 74 |
| 46 | 3300025919 | Ga0207657_11012420 | Ga0207657_110124201 | 76 |
| 47 | 3300035086 | Ga0373934_0218515 | Ga0373934_0218515_447_737 | 76 |
| 48 | 3300035120 | Ga0373957_0208593 | Ga0373957_0208593_405_695 | 76 |
| 49 | 3300036401 | Ga0373937_0337245 | Ga0373937_0337245_946_1236 | 76 |
| 50 | 3300046511 | Ga0495608_0589976 | Ga0495608_0589976_107_397 | 76 |
| 51 | 3300046529 | Ga0495652_0477611 | Ga0495652_0477611_435_725 | 76 |
| 52 | 3300046559 | Ga0495667_0300143 | Ga0495667_0300143_309_599 | 76 |
| 53 | 3300046675 | Ga0495657_0081093 | Ga0495657_0081093_1053_1343 | 76 |
| 54 | 3300046679 | Ga0495623_0636386 | Ga0495623_0636386_85_375 | 76 |
| 55 | 3300047322 | Ga0495680_0741620 | Ga0495680_0741620_247_537 | 76 |
| 56 | 3300005441 | Ga0070700_100005688 | Ga0070700_1000056884 | 77 |
| 57 | 3300005444 | Ga0070694_100646877 | Ga0070694_1006468772 | 77 |
| 58 | 3300005445 | Ga0070708_100064542 | Ga0070708_1000645422 | 77 |
| 59 | 3300005546 | Ga0070696_101578098 | Ga0070696_1015780982 | 77 |
| 60 | 3300005547 | Ga0070693_100495912 | Ga0070693_1004959122 | 77 |
| 61 | 3300006871 | Ga0075434_100791284 | Ga0075434_1007912841 | 77 |
| 62 | 3300014497 | Ga0182008_10001611 | Ga0182008_100016118 | 77 |
| 63 | 3300015261 | Ga0182006_1109507 | Ga0182006_11095071 | 77 |
| 64 | 3300015262 | Ga0182007_10001949 | Ga0182007_1000194912 | 77 |
| 65 | 3300025885 | Ga0207653_10000144 | Ga0207653_1000014412 | 77 |
| 66 | 3300025908 | Ga0207643_11083040 | Ga0207643_110830401 | 77 |
| 67 | 3300025925 | Ga0207650_10383987 | Ga0207650_103839872 | 77 |
| 68 | 3300025961 | Ga0207712_10237298 | Ga0207712_102372982 | 77 |
| 69 | 3300026075 | Ga0207708_10014852 | Ga0207708_100148524 | 77 |
| 70 | 3300027907 | Ga0207428_10001769 | Ga0207428_100017699 | 77 |
| 71 | 3300031090 | Ga0265760_10051947 | Ga0265760_100519473 | 77 |
| 72 | 3300002074 | JGI24748J21848_1000008 | JGI24748J21848_1000008166 | 78 |
| 73 | 3300002076 | JGI24749J21850_1000014 | JGI24749J21850_100001420 | 78 |
| 74 | 3300002239 | JGI24034J26672_10000002 | JGI24034J26672_10000002312 | 78 |
| 75 | 3300002244 | JGI24742J22300_10021316 | JGI24742J22300_100213163 | 78 |
| 76 | 3300002459 | JGI24751J29686_10000028 | JGI24751J29686_1000002853 | 78 |
| 77 | 3300003322 | rootL2_10237773 | rootL2_102377734 | 78 |
| 78 | 3300003771 | Ga0055526_1000001 | Ga0055526_1000001113 | 78 |
| 79 | 3300005288 | Ga0065714_10484319 | Ga0065714_104843192 | 78 |
| 80 | 3300005290 | Ga0065712_10001937 | Ga0065712_100019379 | 78 |
| 81 | 3300005293 | Ga0065715_10029636 | Ga0065715_100296363 | 78 |
| 82 | 3300005293 | Ga0065715_10207382 | Ga0065715_102073822 | 78 |
| 83 | 3300005329 | Ga0070683_100661903 | Ga0070683_1006619032 | 78 |
| 84 | 3300005330 | Ga0070690_100988783 | Ga0070690_1009887832 | 78 |
| 85 | 3300005331 | Ga0070670_100000093 | Ga0070670_10000009373 | 78 |
| 86 | 3300005331 | Ga0070670_101293729 | Ga0070670_1012937292 | 78 |
| 87 | 3300005334 | Ga0068869_100131846 | Ga0068869_1001318463 | 78 |
| 88 | 3300005334 | Ga0068869_100384236 | Ga0068869_1003842363 | 78 |
| 89 | 3300005335 | Ga0070666_10054491 | Ga0070666_100544913 | 78 |
| 90 | 3300005335 | Ga0070666_10185506 | Ga0070666_101855061 | 78 |
| 91 | 3300005335 | Ga0070666_10547734 | Ga0070666_105477342 | 78 |
| 92 | 3300005335 | Ga0070666_10980573 | Ga0070666_109805732 | 78 |
| 93 | 3300005336 | Ga0070680_101563033 | Ga0070680_1015630332 | 78 |
| 94 | 3300005337 | Ga0070682_100005456 | Ga0070682_1000054563 | 78 |
| 95 | 3300005338 | Ga0068868_100037865 | Ga0068868_1000378651 | 78 |
| 96 | 3300005340 | Ga0070689_100192971 | Ga0070689_1001929713 | 78 |
| 97 | 3300005340 | Ga0070689_100239051 | Ga0070689_1002390513 | 78 |
| 98 | 3300005343 | Ga0070687_100209543 | Ga0070687_1002095433 | 78 |
| 99 | 3300005343 | Ga0070687_100952416 | Ga0070687_1009524161 | 78 |
| 100 | 3300005344 | Ga0070661_101748163 | Ga0070661_1017481631 | 78 |
| 101 | 3300005345 | Ga0070692_10002029 | Ga0070692_100020294 | 78 |
| 102 | 3300005345 | Ga0070692_10361531 | Ga0070692_103615311 | 78 |
| 103 | 3300005345 | Ga0070692_10855921 | Ga0070692_108559212 | 78 |
| 104 | 3300005347 | Ga0070668_100083262 | Ga0070668_1000832623 | 78 |
| 105 | 3300005353 | Ga0070669_100022236 | Ga0070669_1000222363 | 78 |
| 106 | 3300005353 | Ga0070669_100056846 | Ga0070669_1000568463 | 78 |
| 107 | 3300005353 | Ga0070669_100061477 | Ga0070669_1000614774 | 78 |
| 108 | 3300005354 | Ga0070675_100439519 | Ga0070675_1004395192 | 78 |
| 109 | 3300005355 | Ga0070671_100009376 | Ga0070671_10000937610 | 78 |
| 110 | 3300005355 | Ga0070671_100341312 | Ga0070671_1003413122 | 78 |
| 111 | 3300005356 | Ga0070674_102119873 | Ga0070674_1021198732 | 78 |
| 112 | 3300005364 | Ga0070673_100011302 | Ga0070673_1000113025 | 78 |
| 113 | 3300005364 | Ga0070673_100243833 | Ga0070673_1002438333 | 78 |
| 114 | 3300005364 | Ga0070673_100581084 | Ga0070673_1005810842 | 78 |
| 115 | 3300005365 | Ga0070688_100095281 | Ga0070688_1000952812 | 78 |
| 116 | 3300005365 | Ga0070688_100977697 | Ga0070688_1009776972 | 78 |
| 117 | 3300005365 | Ga0070688_101321359 | Ga0070688_1013213591 | 78 |
| 118 | 3300005367 | Ga0070667_100001690 | Ga0070667_10000169018 | 78 |
| 119 | 3300005367 | Ga0070667_100012817 | Ga0070667_1000128177 | 78 |
| 120 | 3300005367 | Ga0070667_100138327 | Ga0070667_1001383272 | 78 |
| 121 | 3300005435 | Ga0070714_101371607 | Ga0070714_1013716072 | 78 |
| 122 | 3300005435 | Ga0070714_101453999 | Ga0070714_1014539992 | 78 |
| 123 | 3300005438 | Ga0070701_10160680 | Ga0070701_101606803 | 78 |
| 124 | 3300005438 | Ga0070701_10760823 | Ga0070701_107608232 | 78 |
| 125 | 3300005439 | Ga0070711_100509373 | Ga0070711_1005093731 | 78 |
| 126 | 3300005440 | Ga0070705_100017866 | Ga0070705_1000178662 | 78 |
| 127 | 3300005440 | Ga0070705_100714780 | Ga0070705_1007147802 | 78 |
| 128 | 3300005440 | Ga0070705_100800389 | Ga0070705_1008003892 | 78 |
| 129 | 3300005440 | Ga0070705_100860877 | Ga0070705_1008608772 | 78 |
| 130 | 3300005440 | Ga0070705_101439340 | Ga0070705_1014393402 | 78 |
| 131 | 3300005441 | Ga0070700_100045471 | Ga0070700_1000454713 | 78 |
| 132 | 3300005441 | Ga0070700_100631712 | Ga0070700_1006317122 | 78 |
| 133 | 3300005444 | Ga0070694_100000051 | Ga0070694_10000005127 | 78 |
| 134 | 3300005444 | Ga0070694_100040746 | Ga0070694_1000407463 | 78 |
| 135 | 3300005444 | Ga0070694_100154224 | Ga0070694_1001542242 | 78 |
| 136 | 3300005444 | Ga0070694_100167811 | Ga0070694_1001678113 | 78 |
| 137 | 3300005444 | Ga0070694_100261739 | Ga0070694_1002617391 | 78 |
| 138 | 3300005444 | Ga0070694_100373480 | Ga0070694_1003734802 | 78 |
| 139 | 3300005445 | Ga0070708_100057527 | Ga0070708_1000575275 | 78 |
| 140 | 3300005445 | Ga0070708_100924999 | Ga0070708_1009249992 | 78 |
| 141 | 3300005455 | Ga0070663_100943173 | Ga0070663_1009431732 | 78 |
| 142 | 3300005456 | Ga0070678_100053815 | Ga0070678_1000538152 | 78 |
| 143 | 3300005456 | Ga0070678_100270731 | Ga0070678_1002707312 | 78 |
| 144 | 3300005456 | Ga0070678_100364408 | Ga0070678_1003644082 | 78 |
| 145 | 3300005458 | Ga0070681_10006958 | Ga0070681_100069583 | 78 |
| 146 | 3300005459 | Ga0068867_100065592 | Ga0068867_1000655924 | 78 |
| 147 | 3300005466 | Ga0070685_10396014 | Ga0070685_103960142 | 78 |
| 148 | 3300005467 | Ga0070706_100017307 | Ga0070706_1000173075 | 78 |
| 149 | 3300005467 | Ga0070706_100225880 | Ga0070706_1002258801 | 78 |
| 150 | 3300005467 | Ga0070706_100246460 | Ga0070706_1002464603 | 78 |
| 151 | 3300005468 | Ga0070707_100015314 | Ga0070707_1000153145 | 78 |
| 152 | 3300005471 | Ga0070698_100003623 | Ga0070698_1000036232 | 78 |
| 153 | 3300005471 | Ga0070698_100028055 | Ga0070698_1000280553 | 78 |
| 154 | 3300005471 | Ga0070698_101792734 | Ga0070698_1017927341 | 78 |
| 155 | 3300005518 | Ga0070699_100027943 | Ga0070699_1000279433 | 78 |
| 156 | 3300005530 | Ga0070679_101536707 | Ga0070679_1015367071 | 78 |
| 157 | 3300005536 | Ga0070697_100109014 | Ga0070697_1001090142 | 78 |
| 158 | 3300005536 | Ga0070697_100210248 | Ga0070697_1002102483 | 78 |
| 159 | 3300005536 | Ga0070697_100728199 | Ga0070697_1007281992 | 78 |
| 160 | 3300005539 | Ga0068853_100086012 | Ga0068853_1000860123 | 78 |
| 161 | 3300005539 | Ga0068853_101217333 | Ga0068853_1012173332 | 78 |
| 162 | 3300005543 | Ga0070672_100030826 | Ga0070672_1000308264 | 78 |
| 163 | 3300005543 | Ga0070672_100042541 | Ga0070672_1000425413 | 78 |
| 164 | 3300005543 | Ga0070672_100635939 | Ga0070672_1006359392 | 78 |
| 165 | 3300005544 | Ga0070686_100628317 | Ga0070686_1006283172 | 78 |
| 166 | 3300005544 | Ga0070686_101538284 | Ga0070686_1015382842 | 78 |
| 167 | 3300005545 | Ga0070695_100000132 | Ga0070695_10000013217 | 78 |
| 168 | 3300005545 | Ga0070695_100041724 | Ga0070695_1000417244 | 78 |
| 169 | 3300005545 | Ga0070695_100214978 | Ga0070695_1002149783 | 78 |
| 170 | 3300005545 | Ga0070695_100295074 | Ga0070695_1002950741 | 78 |
| 171 | 3300005545 | Ga0070695_101394168 | Ga0070695_1013941681 | 78 |
| 172 | 3300005546 | Ga0070696_100104352 | Ga0070696_1001043523 | 78 |
| 173 | 3300005546 | Ga0070696_100357705 | Ga0070696_1003577052 | 78 |
| 174 | 3300005547 | Ga0070693_100008064 | Ga0070693_1000080643 | 78 |
| 175 | 3300005548 | Ga0070665_100059058 | Ga0070665_1000590583 | 78 |
| 176 | 3300005548 | Ga0070665_100730226 | Ga0070665_1007302261 | 78 |
| 177 | 3300005549 | Ga0070704_100135160 | Ga0070704_1001351603 | 78 |
| 178 | 3300005564 | Ga0070664_100000981 | Ga0070664_1000009815 | 78 |
| 179 | 3300005564 | Ga0070664_100035409 | Ga0070664_1000354093 | 78 |
| 180 | 3300005564 | Ga0070664_100093270 | Ga0070664_1000932703 | 78 |
| 181 | 3300005564 | Ga0070664_100920338 | Ga0070664_1009203382 | 78 |
| 182 | 3300005577 | Ga0068857_100001605 | Ga0068857_1000016058 | 78 |
| 183 | 3300005578 | Ga0068854_100542738 | Ga0068854_1005427382 | 78 |
| 184 | 3300005614 | Ga0068856_100027841 | Ga0068856_1000278413 | 78 |
| 185 | 3300005615 | Ga0070702_100013341 | Ga0070702_1000133415 | 78 |
| 186 | 3300005615 | Ga0070702_100064184 | Ga0070702_1000641843 | 78 |
| 187 | 3300005615 | Ga0070702_100736886 | Ga0070702_1007368861 | 78 |
| 188 | 3300005616 | Ga0068852_100418457 | Ga0068852_1004184572 | 78 |
| 189 | 3300005616 | Ga0068852_100858013 | Ga0068852_1008580131 | 78 |
| 190 | 3300005617 | Ga0068859_100000901 | Ga0068859_1000009018 | 78 |
| 191 | 3300005617 | Ga0068859_100001569 | Ga0068859_10000156919 | 78 |
| 192 | 3300005617 | Ga0068859_100205257 | Ga0068859_1002052571 | 78 |
| 193 | 3300005617 | Ga0068859_102959927 | Ga0068859_1029599272 | 78 |
| 194 | 3300005617 | Ga0068859_102971794 | Ga0068859_1029717942 | 78 |
| 195 | 3300005618 | Ga0068864_100000087 | Ga0068864_10000008774 | 78 |
| 196 | 3300005618 | Ga0068864_100000730 | Ga0068864_1000007305 | 78 |
| 197 | 3300005618 | Ga0068864_100001498 | Ga0068864_1000014988 | 78 |
| 198 | 3300005618 | Ga0068864_100381321 | Ga0068864_1003813213 | 78 |
| 199 | 3300005719 | Ga0068861_100004876 | Ga0068861_10000487612 | 78 |
| 200 | 3300005719 | Ga0068861_100009079 | Ga0068861_1000090793 | 78 |
| 201 | 3300005719 | Ga0068861_100520624 | Ga0068861_1005206242 | 78 |
| 202 | 3300005719 | Ga0068861_101939584 | Ga0068861_1019395841 | 78 |
| 203 | 3300005834 | Ga0068851_10068276 | Ga0068851_100682761 | 78 |
| 204 | 3300005840 | Ga0068870_10052415 | Ga0068870_100524153 | 78 |
| 205 | 3300005841 | Ga0068863_100001792 | Ga0068863_10000179216 | 78 |
| 206 | 3300005841 | Ga0068863_100012858 | Ga0068863_1000128583 | 78 |
| 207 | 3300005841 | Ga0068863_100081823 | Ga0068863_1000818233 | 78 |
| 208 | 3300005841 | Ga0068863_100117541 | Ga0068863_1001175413 | 78 |
| 209 | 3300005841 | Ga0068863_100176446 | Ga0068863_1001764462 | 78 |
| 210 | 3300005842 | Ga0068858_100000300 | Ga0068858_10000030034 | 78 |
| 211 | 3300005842 | Ga0068858_100009128 | Ga0068858_1000091285 | 78 |
| 212 | 3300005842 | Ga0068858_100209353 | Ga0068858_1002093531 | 78 |
| 213 | 3300005842 | Ga0068858_100223541 | Ga0068858_1002235412 | 78 |
| 214 | 3300005843 | Ga0068860_100911415 | Ga0068860_1009114152 | 78 |
| 215 | 3300005844 | Ga0068862_100000534 | Ga0068862_10000053412 | 78 |
| 216 | 3300005844 | Ga0068862_102304953 | Ga0068862_1023049531 | 78 |
| 217 | 3300006194 | Ga0075427_10097290 | Ga0075427_100972901 | 78 |
| 218 | 3300006237 | Ga0097621_100004458 | Ga0097621_1000044585 | 78 |
| 219 | 3300006237 | Ga0097621_100438191 | Ga0097621_1004381912 | 78 |
| 220 | 3300006237 | Ga0097621_102147434 | Ga0097621_1021474341 | 78 |
| 221 | 3300006237 | Ga0097621_102307503 | Ga0097621_1023075032 | 78 |
| 222 | 3300006358 | Ga0068871_100080673 | Ga0068871_1000806733 | 78 |
| 223 | 3300006358 | Ga0068871_101003352 | Ga0068871_1010033522 | 78 |
| 224 | 3300006844 | Ga0075428_100744928 | Ga0075428_1007449281 | 78 |
| 225 | 3300006881 | Ga0068865_100693539 | Ga0068865_1006935392 | 78 |
| 226 | 3300006931 | Ga0097620_100000901 | Ga0097620_1000009018 | 78 |
| 227 | 3300006931 | Ga0097620_100001569 | Ga0097620_10000156919 | 78 |
| 228 | 3300006931 | Ga0097620_100205259 | Ga0097620_1002052591 | 78 |
| 229 | 3300006931 | Ga0097620_102961334 | Ga0097620_1029613342 | 78 |
| 230 | 3300006931 | Ga0097620_102972588 | Ga0097620_1029725882 | 78 |
| 231 | 3300009094 | Ga0111539_10067152 | Ga0111539_100671522 | 78 |
| 232 | 3300009094 | Ga0111539_10105307 | Ga0111539_101053073 | 78 |
| 233 | 3300009094 | Ga0111539_10440471 | Ga0111539_104404713 | 78 |
| 234 | 3300009094 | Ga0111539_12542449 | Ga0111539_125424492 | 78 |
| 235 | 3300009101 | Ga0105247_10000001 | Ga0105247_10000001333 | 78 |
| 236 | 3300009101 | Ga0105247_10000273 | Ga0105247_1000027321 | 78 |
| 237 | 3300009101 | Ga0105247_10001576 | Ga0105247_100015765 | 78 |
| 238 | 3300009101 | Ga0105247_10548949 | Ga0105247_105489492 | 78 |
| 239 | 3300009147 | Ga0114129_10022697 | Ga0114129_100226974 | 78 |
| 240 | 3300009147 | Ga0114129_11309758 | Ga0114129_113097582 | 78 |
| 241 | 3300009147 | Ga0114129_12172434 | Ga0114129_121724342 | 78 |
| 242 | 3300009174 | Ga0105241_10071776 | Ga0105241_100717762 | 78 |
| 243 | 3300009176 | Ga0105242_10187217 | Ga0105242_101872173 | 78 |
| 244 | 3300009177 | Ga0105248_10002535 | Ga0105248_100025354 | 78 |
| 245 | 3300009177 | Ga0105248_10002695 | Ga0105248_1000269511 | 78 |
| 246 | 3300009177 | Ga0105248_10087401 | Ga0105248_100874013 | 78 |
| 247 | 3300009177 | Ga0105248_10596977 | Ga0105248_105969772 | 78 |
| 248 | 3300009177 | Ga0105248_11229356 | Ga0105248_112293561 | 78 |
| 249 | 3300009177 | Ga0105248_11834845 | Ga0105248_118348452 | 78 |
| 250 | 3300009545 | Ga0105237_10211067 | Ga0105237_102110673 | 78 |
| 251 | 3300009545 | Ga0105237_10435341 | Ga0105237_104353412 | 78 |
| 252 | 3300009551 | Ga0105238_10084423 | Ga0105238_100844234 | 78 |
| 253 | 3300009553 | Ga0105249_10087514 | Ga0105249_100875143 | 78 |
| 254 | 3300009553 | Ga0105249_10144230 | Ga0105249_101442304 | 78 |
| 255 | 3300009553 | Ga0105249_10552339 | Ga0105249_105523392 | 78 |
| 256 | 3300009553 | Ga0105249_11206248 | Ga0105249_112062482 | 78 |
| 257 | 3300011119 | Ga0105246_10046273 | Ga0105246_100462732 | 78 |
| 258 | 3300011119 | Ga0105246_10721949 | Ga0105246_107219492 | 78 |
| 259 | 3300013102 | Ga0157371_10085991 | Ga0157371_100859913 | 78 |
| 260 | 3300013105 | Ga0157369_10007182 | Ga0157369_100071823 | 78 |
| 261 | 3300013105 | Ga0157369_10425091 | Ga0157369_104250912 | 78 |
| 262 | 3300013296 | Ga0157374_10617713 | Ga0157374_106177132 | 78 |
| 263 | 3300013296 | Ga0157374_11424504 | Ga0157374_114245042 | 78 |
| 264 | 3300013296 | Ga0157374_12548641 | Ga0157374_125486412 | 78 |
| 265 | 3300013297 | Ga0157378_10000039 | Ga0157378_1000003973 | 78 |
| 266 | 3300013297 | Ga0157378_10000400 | Ga0157378_1000040025 | 78 |
| 267 | 3300013297 | Ga0157378_10888987 | Ga0157378_108889872 | 78 |
| 268 | 3300013306 | Ga0163162_10008417 | Ga0163162_100084179 | 78 |
| 269 | 3300013306 | Ga0163162_10049960 | Ga0163162_100499603 | 78 |
| 270 | 3300013306 | Ga0163162_10058503 | Ga0163162_100585033 | 78 |
| 271 | 3300013306 | Ga0163162_10200989 | Ga0163162_102009893 | 78 |
| 272 | 3300013306 | Ga0163162_11714405 | Ga0163162_117144052 | 78 |
| 273 | 3300013307 | Ga0157372_10840092 | Ga0157372_108400922 | 78 |
| 274 | 3300013307 | Ga0157372_10990741 | Ga0157372_109907412 | 78 |
| 275 | 3300013308 | Ga0157375_10000009 | Ga0157375_10000009224 | 78 |
| 276 | 3300013308 | Ga0157375_10007636 | Ga0157375_1000763610 | 78 |
| 277 | 3300013308 | Ga0157375_10098826 | Ga0157375_100988263 | 78 |
| 278 | 3300013308 | Ga0157375_11366254 | Ga0157375_113662541 | 78 |
| 279 | 3300014325 | Ga0163163_10088563 | Ga0163163_100885633 | 78 |
| 280 | 3300014325 | Ga0163163_10309413 | Ga0163163_103094133 | 78 |
| 281 | 3300014326 | Ga0157380_10000155 | Ga0157380_1000015522 | 78 |
| 282 | 3300014326 | Ga0157380_10006572 | Ga0157380_100065729 | 78 |
| 283 | 3300014745 | Ga0157377_10269792 | Ga0157377_102697921 | 78 |
| 284 | 3300014968 | Ga0157379_10057488 | Ga0157379_100574882 | 78 |
| 285 | 3300014968 | Ga0157379_10100823 | Ga0157379_101008232 | 78 |
| 286 | 3300014968 | Ga0157379_10604507 | Ga0157379_106045072 | 78 |
| 287 | 3300017792 | Ga0163161_10012539 | Ga0163161_100125399 | 78 |
| 288 | 3300025295 | Ga0209564_1000002 | Ga0209564_1000002452 | 78 |
| 289 | 3300025315 | Ga0207697_10034066 | Ga0207697_100340662 | 78 |
| 290 | 3300025321 | Ga0207656_10090065 | Ga0207656_100900652 | 78 |
| 291 | 3300025900 | Ga0207710_10000267 | Ga0207710_1000026721 | 78 |
| 292 | 3300025900 | Ga0207710_10015464 | Ga0207710_100154645 | 78 |
| 293 | 3300025900 | Ga0207710_10298743 | Ga0207710_102987432 | 78 |
| 294 | 3300025903 | Ga0207680_10099733 | Ga0207680_100997332 | 78 |
| 295 | 3300025903 | Ga0207680_10492433 | Ga0207680_104924332 | 78 |
| 296 | 3300025907 | Ga0207645_10126802 | Ga0207645_101268022 | 78 |
| 297 | 3300025908 | Ga0207643_10160679 | Ga0207643_101606793 | 78 |
| 298 | 3300025908 | Ga0207643_10392445 | Ga0207643_103924452 | 78 |
| 299 | 3300025908 | Ga0207643_10526469 | Ga0207643_105264692 | 78 |
| 300 | 3300025909 | Ga0207705_10087153 | Ga0207705_100871533 | 78 |
| 301 | 3300025910 | Ga0207684_10010878 | Ga0207684_100108785 | 78 |
| 302 | 3300025911 | Ga0207654_10021236 | Ga0207654_100212363 | 78 |
| 303 | 3300025911 | Ga0207654_10778829 | Ga0207654_107788291 | 78 |
| 304 | 3300025912 | Ga0207707_10414768 | Ga0207707_104147683 | 78 |
| 305 | 3300025912 | Ga0207707_11246093 | Ga0207707_112460932 | 78 |
| 306 | 3300025913 | Ga0207695_11575526 | Ga0207695_115755262 | 78 |
| 307 | 3300025914 | Ga0207671_10559002 | Ga0207671_105590021 | 78 |
| 308 | 3300025914 | Ga0207671_10669268 | Ga0207671_106692682 | 78 |
| 309 | 3300025916 | Ga0207663_10486289 | Ga0207663_104862892 | 78 |
| 310 | 3300025917 | Ga0207660_10011962 | Ga0207660_100119623 | 78 |
| 311 | 3300025920 | Ga0207649_10000859 | Ga0207649_100008592 | 78 |
| 312 | 3300025920 | Ga0207649_11333137 | Ga0207649_113331372 | 78 |
| 313 | 3300025921 | Ga0207652_10256672 | Ga0207652_102566723 | 78 |
| 314 | 3300025922 | Ga0207646_10013512 | Ga0207646_100135123 | 78 |
| 315 | 3300025923 | Ga0207681_10023038 | Ga0207681_100230383 | 78 |
| 316 | 3300025923 | Ga0207681_10510991 | Ga0207681_105109913 | 78 |
| 317 | 3300025923 | Ga0207681_10554614 | Ga0207681_105546141 | 78 |
| 318 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004730 | 78 |
| 319 | 3300025925 | Ga0207650_10003683 | Ga0207650_100036836 | 78 |
| 320 | 3300025925 | Ga0207650_10517112 | Ga0207650_105171122 | 78 |
| 321 | 3300025928 | Ga0207700_10875566 | Ga0207700_108755662 | 78 |
| 322 | 3300025931 | Ga0207644_10804157 | Ga0207644_108041572 | 78 |
| 323 | 3300025932 | Ga0207690_10004924 | Ga0207690_100049243 | 78 |
| 324 | 3300025933 | Ga0207706_10027988 | Ga0207706_100279882 | 78 |
| 325 | 3300025933 | Ga0207706_10119874 | Ga0207706_101198742 | 78 |
| 326 | 3300025934 | Ga0207686_10152856 | Ga0207686_101528562 | 78 |
| 327 | 3300025934 | Ga0207686_10500684 | Ga0207686_105006841 | 78 |
| 328 | 3300025934 | Ga0207686_11248884 | Ga0207686_112488841 | 78 |
| 329 | 3300025936 | Ga0207670_10513907 | Ga0207670_105139072 | 78 |
| 330 | 3300025937 | Ga0207669_11489831 | Ga0207669_114898312 | 78 |
| 331 | 3300025940 | Ga0207691_10008323 | Ga0207691_100083238 | 78 |
| 332 | 3300025940 | Ga0207691_10056881 | Ga0207691_100568815 | 78 |
| 333 | 3300025940 | Ga0207691_10754790 | Ga0207691_107547902 | 78 |
| 334 | 3300025941 | Ga0207711_10000973 | Ga0207711_1000097322 | 78 |
| 335 | 3300025941 | Ga0207711_10005552 | Ga0207711_100055524 | 78 |
| 336 | 3300025941 | Ga0207711_10055006 | Ga0207711_100550063 | 78 |
| 337 | 3300025941 | Ga0207711_10469216 | Ga0207711_104692162 | 78 |
| 338 | 3300025941 | Ga0207711_10582869 | Ga0207711_105828691 | 78 |
| 339 | 3300025941 | Ga0207711_11239554 | Ga0207711_112395542 | 78 |
| 340 | 3300025942 | Ga0207689_10007977 | Ga0207689_100079774 | 78 |
| 341 | 3300025942 | Ga0207689_10020022 | Ga0207689_100200222 | 78 |
| 342 | 3300025942 | Ga0207689_10023233 | Ga0207689_100232334 | 78 |
| 343 | 3300025944 | Ga0207661_10000194 | Ga0207661_1000019411 | 78 |
| 344 | 3300025945 | Ga0207679_10000255 | Ga0207679_1000025518 | 78 |
| 345 | 3300025945 | Ga0207679_10091225 | Ga0207679_100912251 | 78 |
| 346 | 3300025949 | Ga0207667_10028542 | Ga0207667_100285423 | 78 |
| 347 | 3300025949 | Ga0207667_10621002 | Ga0207667_106210022 | 78 |
| 348 | 3300025960 | Ga0207651_10072362 | Ga0207651_100723623 | 78 |
| 349 | 3300025960 | Ga0207651_10576708 | Ga0207651_105767081 | 78 |
| 350 | 3300025960 | Ga0207651_10836943 | Ga0207651_108369432 | 78 |
| 351 | 3300025961 | Ga0207712_10108937 | Ga0207712_101089373 | 78 |
| 352 | 3300025961 | Ga0207712_10800626 | Ga0207712_108006262 | 78 |
| 353 | 3300025972 | Ga0207668_10078936 | Ga0207668_100789363 | 78 |
| 354 | 3300025972 | Ga0207668_10249821 | Ga0207668_102498212 | 78 |
| 355 | 3300025981 | Ga0207640_10288982 | Ga0207640_102889823 | 78 |
| 356 | 3300025981 | Ga0207640_10326388 | Ga0207640_103263882 | 78 |
| 357 | 3300025981 | Ga0207640_11817922 | Ga0207640_118179221 | 78 |
| 358 | 3300025986 | Ga0207658_10001122 | Ga0207658_100011223 | 78 |
| 359 | 3300025986 | Ga0207658_10003901 | Ga0207658_100039014 | 78 |
| 360 | 3300025986 | Ga0207658_12113122 | Ga0207658_121131222 | 78 |
| 361 | 3300026035 | Ga0207703_10005164 | Ga0207703_100051644 | 78 |
| 362 | 3300026035 | Ga0207703_10076353 | Ga0207703_100763532 | 78 |
| 363 | 3300026035 | Ga0207703_10200957 | Ga0207703_102009572 | 78 |
| 364 | 3300026035 | Ga0207703_11106439 | Ga0207703_111064392 | 78 |
| 365 | 3300026035 | Ga0207703_11336656 | Ga0207703_113366562 | 78 |
| 366 | 3300026035 | Ga0207703_11673273 | Ga0207703_116732732 | 78 |
| 367 | 3300026035 | Ga0207703_12052308 | Ga0207703_120523081 | 78 |
| 368 | 3300026041 | Ga0207639_10748736 | Ga0207639_107487362 | 78 |
| 369 | 3300026067 | Ga0207678_10465586 | Ga0207678_104655862 | 78 |
| 370 | 3300026075 | Ga0207708_10133055 | Ga0207708_101330554 | 78 |
| 371 | 3300026078 | Ga0207702_10033060 | Ga0207702_100330605 | 78 |
| 372 | 3300026088 | Ga0207641_10008505 | Ga0207641_100085053 | 78 |
| 373 | 3300026088 | Ga0207641_10024821 | Ga0207641_100248213 | 78 |
| 374 | 3300026088 | Ga0207641_10225352 | Ga0207641_102253523 | 78 |
| 375 | 3300026088 | Ga0207641_10328691 | Ga0207641_103286912 | 78 |
| 376 | 3300026088 | Ga0207641_11042623 | Ga0207641_110426232 | 78 |
| 377 | 3300026089 | Ga0207648_10065058 | Ga0207648_100650585 | 78 |
| 378 | 3300026089 | Ga0207648_10602348 | Ga0207648_106023482 | 78 |
| 379 | 3300026095 | Ga0207676_10000143 | Ga0207676_1000014319 | 78 |
| 380 | 3300026095 | Ga0207676_10012135 | Ga0207676_100121353 | 78 |
| 381 | 3300026095 | Ga0207676_10197761 | Ga0207676_101977612 | 78 |
| 382 | 3300026095 | Ga0207676_10518895 | Ga0207676_105188951 | 78 |
| 383 | 3300026116 | Ga0207674_10000570 | Ga0207674_1000057020 | 78 |
| 384 | 3300026116 | Ga0207674_10301231 | Ga0207674_103012311 | 78 |
| 385 | 3300026118 | Ga0207675_100060409 | Ga0207675_1000604093 | 78 |
| 386 | 3300026118 | Ga0207675_100935369 | Ga0207675_1009353692 | 78 |
| 387 | 3300026121 | Ga0207683_10001071 | Ga0207683_1000107115 | 78 |
| 388 | 3300026121 | Ga0207683_10213398 | Ga0207683_102133982 | 78 |
| 389 | 3300026121 | Ga0207683_10954977 | Ga0207683_109549771 | 78 |
| 390 | 3300026121 | Ga0207683_11188262 | Ga0207683_111882622 | 78 |
| 391 | 3300026142 | Ga0207698_10204726 | Ga0207698_102047263 | 78 |
| 392 | 3300026142 | Ga0207698_10969270 | Ga0207698_109692702 | 78 |
| 393 | 3300027907 | Ga0207428_10666669 | Ga0207428_106666691 | 78 |
| 394 | 3300028379 | Ga0268266_10041093 | Ga0268266_100410934 | 78 |
| 395 | 3300028380 | Ga0268265_10000001 | Ga0268265_100000011191 | 78 |
| 396 | 3300028381 | Ga0268264_10023412 | Ga0268264_100234122 | 78 |
| 397 | 3300028381 | Ga0268264_10443802 | Ga0268264_104438022 | 78 |
| 398 | 3300028381 | Ga0268264_10450449 | Ga0268264_104504492 | 78 |
| 399 | 3300031616 | Ga0307508_10161662 | Ga0307508_101616623 | 78 |
| 400 | 3300035241 | Ga0373961_0122150 | Ga0373961_0122150_103_399 | 78 |
| 401 | 3300042436 | Ga0439435_0008888 | Ga0439435_0008888_1408_1701 | 78 |
| 402 | 3300044712 | Ga0453684_0013456 | Ga0453684_0013456_9604_9915 | 78 |
| 403 | 3300046462 | Ga0495651_0271718 | Ga0495651_0271718_392_688 | 78 |
| 404 | 3300046463 | Ga0495653_0863860 | Ga0495653_0863860_51_347 | 78 |
| 405 | 3300046491 | Ga0495584_0027372 | Ga0495584_0027372_2321_2617 | 78 |
| 406 | 3300046507 | Ga0495606_0012280 | Ga0495606_0012280_4933_5229 | 78 |
| 407 | 3300046519 | Ga0495632_0481900 | Ga0495632_0481900_81_377 | 78 |
| 408 | 3300046522 | Ga0495643_0000079 | Ga0495643_0000079_119564_119860 | 78 |
| 409 | 3300046539 | Ga0495621_0013401 | Ga0495621_0013401_1754_2047 | 78 |
| 410 | 3300046615 | Ga0495656_0549393 | Ga0495656_0549393_291_587 | 78 |
| 411 | 3300046648 | Ga0495611_0191022 | Ga0495611_0191022_537_833 | 78 |
| 412 | 3300046660 | Ga0495625_0063658 | Ga0495625_0063658_136_432 | 78 |
| 413 | 3300046665 | Ga0495661_0031301 | Ga0495661_0031301_1569_1865 | 78 |
| 414 | 3300046691 | Ga0495670_0003887 | Ga0495670_0003887_3784_4080 | 78 |
| 415 | 3300047317 | Ga0495604_0338509 | Ga0495604_0338509_30_326 | 78 |
| 416 | 3300048903 | Ga0496100_0136710 | Ga0496100_0136710_1405_1701 | 78 |
| 417 | 3300048905 | Ga0496102_0004345 | Ga0496102_0004345_9695_9991 | 78 |
| 418 | 3300048905 | Ga0496102_0563642 | Ga0496102_0563642_543_839 | 78 |
| 419 | 3300048906 | Ga0496103_0580779 | Ga0496103_0580779_379_675 | 78 |
| 420 | 3300048907 | Ga0496104_0004448 | Ga0496104_0004448_10678_10974 | 78 |
| 421 | 3300048907 | Ga0496104_0224055 | Ga0496104_0224055_724_1020 | 78 |
| 422 | 3300048908 | Ga0496105_0045730 | Ga0496105_0045730_1319_1615 | 78 |
| 423 | 3300048909 | Ga0496106_0015712 | Ga0496106_0015712_1153_1449 | 78 |
| 424 | 3300048909 | Ga0496106_0023803 | Ga0496106_0023803_405_701 | 78 |
| 425 | 3300048910 | Ga0496107_0023277 | Ga0496107_0023277_2010_2306 | 78 |
| 426 | 3300048911 | Ga0496108_0002232 | Ga0496108_0002232_13841_14137 | 78 |
| 427 | 3300048911 | Ga0496108_0006982 | Ga0496108_0006982_5915_6211 | 78 |
| 428 | 3300048911 | Ga0496108_0688407 | Ga0496108_0688407_61_357 | 78 |
| 429 | 3300048912 | Ga0496109_0040979 | Ga0496109_0040979_1269_1565 | 78 |
| 430 | 3300048912 | Ga0496109_0046803 | Ga0496109_0046803_799_1095 | 78 |
| 431 | 3300048913 | Ga0496110_0012584 | Ga0496110_0012584_5307_5603 | 78 |
| 432 | 3300048915 | Ga0496112_0000842 | Ga0496112_0000842_7755_8051 | 78 |
| 433 | 3300048915 | Ga0496112_0056731 | Ga0496112_0056731_2954_3250 | 78 |
| 434 | 3300048915 | Ga0496112_0823475 | Ga0496112_0823475_496_789 | 78 |
| 435 | 3300048915 | Ga0496112_1033599 | Ga0496112_1033599_264_560 | 78 |
| 436 | 3300048916 | Ga0496113_0016027 | Ga0496113_0016027_3670_3966 | 78 |
| 437 | 3300048916 | Ga0496113_0169607 | Ga0496113_0169607_119_415 | 78 |
| 438 | 3300048917 | Ga0496114_0276440 | Ga0496114_0276440_565_861 | 78 |
| 439 | 3300048918 | Ga0496115_0014894 | Ga0496115_0014894_5349_5645 | 78 |
| 440 | 3300048918 | Ga0496115_1441837 | Ga0496115_1441837_183_479 | 78 |
| 441 | 3300048924 | Ga0496121_0890158 | Ga0496121_0890158_184_480 | 78 |
| 442 | 3300049517 | Ga0501294_028542 | Ga0501294_028542_227_523 | 78 |
| 443 | 3300049661 | Ga0501217_277748 | Ga0501217_277748_204_500 | 78 |
| 444 | 3300050507 | nmdc:mga05p37_310801_c1 | nmdc:mga05p37_310801_c1_1195_1491 | 78 |
| 445 | 3300050511 | nmdc:mga08y16_2045143_c1 | nmdc:mga08y16_2045143_c1_105_401 | 78 |
| 446 | 3300050511 | nmdc:mga08y16_399536_c1 | nmdc:mga08y16_399536_c1_96_392 | 78 |
| 447 | 3300050511 | nmdc:mga08y16_569827_c1 | nmdc:mga08y16_569827_c1_317_613 | 78 |
| 448 | 3300053077 | Ga0495601_0560936 | Ga0495601_0560936_105_401 | 78 |
| 449 | 3300053093 | Ga0500651_0018416 | Ga0500651_0018416_3530_3826 | 78 |
| 450 | 3300053139 | Ga0500568_0005012 | Ga0500568_0005012_3673_3969 | 78 |
| 451 | 3300053153 | Ga0500616_0002597 | Ga0500616_0002597_11457_11750 | 78 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar