F446798

General Info

Members Datasets Scaffolds Average Seq Length
451 226 445 88

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_11012420|Ga0207657_110124201
Length 112
Sequence MPPAARVGDTTGHPGVITGPGVSTVLLGGQPAAVVGDLHTCSFPPPAVHPIVMDTHACPLVDGLKPHVGGVVAVGSTTVLIGGLFAARQGDQVIEAGAPNPIAAGAATVTIG

Samples

Sample ID Description Type Environment
1 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
2 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
3 2904699407
4 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
218 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
226 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.22
Isolates 1.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0.22
Rhizoplane 7.76
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000008 3300002074 Bacteria 191483
2 JGI24749J21850_1000014 3300002076 Bacteria 36092
3 JGI24034J26672_10000002 3300002239 Bacteria 925353
4 JGI24742J22300_10021316 3300002244 Viruses 1106
5 JGI24751J29686_10000028 3300002459 Bacteria 94523
6 rootL2_10237773 3300003322 Viruses 5224
7 Ga0055526_1000001 3300003771 Bacteria 669703
8 Ga0065714_10484319 3300005288 Unclassified 533
9 Ga0065712_10001937 3300005290 Bacteria 5340
10 Ga0065715_10029636 3300005293 Bacteria 1504
11 Ga0065715_10207382 3300005293 Unclassified 1308
12 Ga0070683_100661903 3300005329 Bacteria 1000
13 Ga0070690_100988783 3300005330 Unclassified 662
14 Ga0070670_100000093 3300005331 Bacteria 84800
15 Ga0070670_101293729 3300005331 Bacteria 667
16 Ga0068869_100131846 3300005334 Bacteria 1922
17 Ga0068869_100384236 3300005334 Bacteria 1151
18 Ga0070666_10054491 3300005335 Bacteria 2698
19 Ga0070666_10185506 3300005335 Bacteria 1460
20 Ga0070666_10547734 3300005335 Unclassified 841
21 Ga0070666_10980573 3300005335 Unclassified 626
22 Ga0070680_101563033 3300005336 Unclassified 571
23 Ga0070682_100005456 3300005337 Bacteria 7080
24 Ga0068868_100037865 3300005338 Bacteria 3741
25 Ga0070689_100000841 3300005340 Bacteria 19071
26 Ga0070689_100192971 3300005340 Bacteria 1659
27 Ga0070689_100239051 3300005340 Bacteria 1495
28 Ga0070687_100209543 3300005343 Unclassified 1186
29 Ga0070687_100952416 3300005343 Bacteria 619
30 Ga0070661_101748163 3300005344 Unclassified 527
31 Ga0070692_10002029 3300005345 Bacteria 7690
32 Ga0070692_10361531 3300005345 Bacteria 905
33 Ga0070692_10855921 3300005345 Bacteria 625
34 Ga0070668_100083262 3300005347 Bacteria 2511
35 Ga0070669_100022236 3300005353 Bacteria 4535
36 Ga0070669_100056846 3300005353 Bacteria 2869
37 Ga0070669_100061477 3300005353 Unclassified 2760
38 Ga0070675_100439519 3300005354 Bacteria 1169
39 Ga0070671_100009376 3300005355 Bacteria 7862
40 Ga0070671_100341312 3300005355 Bacteria 1278
41 Ga0070674_102119873 3300005356 Unclassified 513
42 Ga0070673_100011302 3300005364 Bacteria 6087
43 Ga0070673_100243833 3300005364 Unclassified 1564
44 Ga0070673_100581084 3300005364 Bacteria 1020
45 Ga0070688_100095281 3300005365 Bacteria 1953
46 Ga0070688_100977697 3300005365 Bacteria 671
47 Ga0070688_101321359 3300005365 Unclassified 582
48 Ga0070667_100001690 3300005367 Bacteria 19736
49 Ga0070667_100012817 3300005367 Bacteria 6928
50 Ga0070667_100138327 3300005367 Bacteria 2131
51 Ga0070714_101371607 3300005435 Bacteria 690
52 Ga0070714_101453999 3300005435 Viruses 669
53 Ga0070701_10160680 3300005438 Viruses 1301
54 Ga0070701_10760823 3300005438 Bacteria 657
55 Ga0070711_100509373 3300005439 Unclassified 993
56 Ga0070705_100017866 3300005440 Bacteria 3709
57 Ga0070705_100714780 3300005440 Bacteria 788
58 Ga0070705_100800389 3300005440 Bacteria 750
59 Ga0070705_100860877 3300005440 Bacteria 726
60 Ga0070705_101439340 3300005440 Unclassified 575
61 Ga0070700_100005688 3300005441 Bacteria 6615
62 Ga0070700_100045471 3300005441 Bacteria 2708
63 Ga0070700_100631712 3300005441 Bacteria 843
64 Ga0070694_100000051 3300005444 Bacteria 54318
65 Ga0070694_100040746 3300005444 Bacteria 3096
66 Ga0070694_100154224 3300005444 Unclassified 1680
67 Ga0070694_100167811 3300005444 Bacteria 1615
68 Ga0070694_100261739 3300005444 Bacteria 1312
69 Ga0070694_100373480 3300005444 Bacteria 1110
70 Ga0070694_100646877 3300005444 Viruses 855
71 Ga0070708_100057527 3300005445 Viruses 3462
72 Ga0070708_100064542 3300005445 Bacteria 3281
73 Ga0070708_100924999 3300005445 Unclassified 818
74 Ga0070663_100943173 3300005455 Unclassified 748
75 Ga0070678_100053815 3300005456 Bacteria 2929
76 Ga0070678_100270731 3300005456 Unclassified 1432
77 Ga0070678_100364408 3300005456 Bacteria 1246
78 Ga0070681_10006958 3300005458 Bacteria 11006
79 Ga0070681_11092721 3300005458 Bacteria 718
80 Ga0068867_100065592 3300005459 Bacteria 2702
81 Ga0070685_10396014 3300005466 Bacteria 955
82 Ga0070706_100017307 3300005467 Bacteria 6652
83 Ga0070706_100225880 3300005467 Bacteria 1748
84 Ga0070706_100246460 3300005467 Unclassified 1668
85 Ga0070707_100015314 3300005468 Bacteria 7195
86 Ga0070698_100003623 3300005471 Bacteria 16971
87 Ga0070698_100028055 3300005471 Bacteria 5851
88 Ga0070698_100059758 3300005471 Bacteria 3849
89 Ga0070698_100692380 3300005471 Bacteria 961
90 Ga0070698_101792734 3300005471 Bacteria 566
91 Ga0070699_100027943 3300005518 Viruses 4865
92 Ga0070679_101536707 3300005530 Bacteria 613
93 Ga0070697_100109014 3300005536 Viruses 2305
94 Ga0070697_100210248 3300005536 Bacteria 1656
95 Ga0070697_100728199 3300005536 Bacteria 876
96 Ga0068853_100086012 3300005539 Bacteria 2757
97 Ga0068853_101217333 3300005539 Bacteria 727
98 Ga0070672_100030826 3300005543 Bacteria 4033
99 Ga0070672_100042541 3300005543 Bacteria 3498
100 Ga0070672_100635939 3300005543 Bacteria 931
101 Ga0070686_100628317 3300005544 Bacteria 849
102 Ga0070686_101538284 3300005544 Bacteria 561
103 Ga0070695_100000132 3300005545 Bacteria 34051
104 Ga0070695_100041724 3300005545 Bacteria 2909
105 Ga0070695_100214978 3300005545 Bacteria 1382
106 Ga0070695_100295074 3300005545 Bacteria 1196
107 Ga0070695_101394168 3300005545 Viruses 581
108 Ga0070696_100104352 3300005546 Bacteria 2035
109 Ga0070696_100357705 3300005546 Unclassified 1132
110 Ga0070696_101578098 3300005546 Unclassified 563
111 Ga0070693_100008064 3300005547 Bacteria 5171
112 Ga0070693_100495912 3300005547 Bacteria 865
113 Ga0070665_100059058 3300005548 Bacteria 3845
114 Ga0070665_100730226 3300005548 Bacteria 1003
115 Ga0070665_101123202 3300005548 Unclassified 797
116 Ga0070704_100135160 3300005549 Bacteria 1917
117 Ga0070664_100000981 3300005564 Bacteria 22345
118 Ga0070664_100035409 3300005564 Bacteria 4191
119 Ga0070664_100093270 3300005564 Unclassified 2608
120 Ga0070664_100920338 3300005564 Bacteria 820
121 Ga0068857_100001605 3300005577 Bacteria 18138
122 Ga0068854_100542738 3300005578 Bacteria 985
123 Ga0068856_100027841 3300005614 Bacteria 5514
124 Ga0070702_100013341 3300005615 Bacteria 4147
125 Ga0070702_100064184 3300005615 Unclassified 2147
126 Ga0070702_100736886 3300005615 Bacteria 755
127 Ga0068852_100418457 3300005616 Bacteria 1321
128 Ga0068852_100858013 3300005616 Bacteria 924
129 Ga0068859_100000901 3300005617 Bacteria 30305
130 Ga0068859_100001569 3300005617 Bacteria 23304
131 Ga0068859_100205257 3300005617 Unclassified 2056
132 Ga0068859_102959927 3300005617 Unclassified 519
133 Ga0068859_102971794 3300005617 Bacteria 518
134 Ga0068864_100000087 3300005618 Bacteria 98532
135 Ga0068864_100000730 3300005618 Bacteria 27499
136 Ga0068864_100001498 3300005618 Bacteria 19249
137 Ga0068864_100381321 3300005618 Bacteria 1336
138 Ga0068864_100678354 3300005618 Unclassified 1005
139 Ga0068861_100004876 3300005719 Bacteria 9030
140 Ga0068861_100009079 3300005719 Bacteria 6854
141 Ga0068861_100520624 3300005719 Bacteria 1079
142 Ga0068861_101939584 3300005719 Unclassified 586
143 Ga0068851_10068276 3300005834 Bacteria 1835
144 Ga0068870_10052415 3300005840 Bacteria 2163
145 Ga0068863_100001792 3300005841 Bacteria 21314
146 Ga0068863_100012858 3300005841 Bacteria 8072
147 Ga0068863_100081823 3300005841 Bacteria 3059
148 Ga0068863_100117541 3300005841 Bacteria 2534
149 Ga0068863_100176446 3300005841 Bacteria 2051
150 Ga0068858_100000300 3300005842 Bacteria 53038
151 Ga0068858_100000470 3300005842 Bacteria 42012
152 Ga0068858_100009128 3300005842 Bacteria 9481
153 Ga0068858_100209353 3300005842 Unclassified 1845
154 Ga0068858_100223541 3300005842 Bacteria 1784
155 Ga0068860_100911415 3300005843 Bacteria 895
156 Ga0068862_100000534 3300005844 Bacteria 39782
157 Ga0068862_102304953 3300005844 Bacteria 550
158 Ga0075427_10097290 3300006194 Unclassified 545
159 Ga0097621_100004458 3300006237 Bacteria 9752
160 Ga0097621_100438191 3300006237 Viruses 1175
161 Ga0097621_102147434 3300006237 Bacteria 534
162 Ga0097621_102307503 3300006237 Bacteria 515
163 Ga0068871_100080673 3300006358 Bacteria 2694
164 Ga0068871_101003352 3300006358 Bacteria 777
165 Ga0075428_100744928 3300006844 Viruses 1042
166 Ga0075434_100791284 3300006871 Unclassified 965
167 Ga0068865_100693539 3300006881 Unclassified 869
168 Ga0097620_100000901 3300006931 Bacteria 30305
169 Ga0097620_100001569 3300006931 Bacteria 23304
170 Ga0097620_100205259 3300006931 Unclassified 2056
171 Ga0097620_102961334 3300006931 Unclassified 519
172 Ga0097620_102972588 3300006931 Bacteria 518
173 Ga0111539_10001077 3300009094 Bacteria 36044
174 Ga0111539_10067152 3300009094 Bacteria 4235
175 Ga0111539_10105307 3300009094 Bacteria 3309
176 Ga0111539_10440471 3300009094 Bacteria 1517
177 Ga0111539_12542449 3300009094 Bacteria 594
178 Ga0105247_10000001 3300009101 Bacteria 739726
179 Ga0105247_10000273 3300009101 Bacteria 47941
180 Ga0105247_10001576 3300009101 Bacteria 16197
181 Ga0105247_10548949 3300009101 Unclassified 849
182 Ga0114129_10022697 3300009147 Bacteria 8900
183 Ga0114129_11309758 3300009147 Viruses 897
184 Ga0114129_12172434 3300009147 Unclassified 668
185 Ga0105241_10071776 3300009174 Bacteria 2689
186 Ga0105242_10187217 3300009176 Bacteria 1830
187 Ga0105248_10002535 3300009177 Bacteria 20341
188 Ga0105248_10002695 3300009177 Bacteria 19727
189 Ga0105248_10087401 3300009177 Bacteria 3508
190 Ga0105248_10596977 3300009177 Bacteria 1246
191 Ga0105248_11229356 3300009177 Bacteria 847
192 Ga0105248_11834845 3300009177 Unclassified 688
193 Ga0105237_10211067 3300009545 Bacteria 1941
194 Ga0105237_10435341 3300009545 Bacteria 1317
195 Ga0105238_10084423 3300009551 Bacteria 3165
196 Ga0105249_10087514 3300009553 Bacteria 2907
197 Ga0105249_10144230 3300009553 Bacteria 2286
198 Ga0105249_10397604 3300009553 Unclassified 1407
199 Ga0105249_10552339 3300009553 Unclassified 1202
200 Ga0105249_11206248 3300009553 Bacteria 828
201 Ga0105246_10046273 3300011119 Bacteria 2967
202 Ga0105246_10721949 3300011119 Bacteria 876
203 Ga0157371_10085991 3300013102 Unclassified 2227
204 Ga0157369_10007182 3300013105 Bacteria 12834
205 Ga0157369_10425091 3300013105 Unclassified 1377
206 Ga0157374_10617713 3300013296 Bacteria 1094
207 Ga0157374_11424504 3300013296 Unclassified 716
208 Ga0157374_12548641 3300013296 Unclassified 539
209 Ga0157378_10000039 3300013297 Bacteria 115427
210 Ga0157378_10000400 3300013297 Bacteria 42656
211 Ga0157378_10888987 3300013297 Unclassified 921
212 Ga0163162_10008417 3300013306 Bacteria 10059
213 Ga0163162_10049960 3300013306 Bacteria 4193
214 Ga0163162_10058503 3300013306 Bacteria 3883
215 Ga0163162_10200989 3300013306 Bacteria 2122
216 Ga0163162_11714405 3300013306 Unclassified 718
217 Ga0157372_10840092 3300013307 Bacteria 1066
218 Ga0157372_10990741 3300013307 Bacteria 974
219 Ga0157375_10000009 3300013308 Bacteria 366440
220 Ga0157375_10007636 3300013308 Bacteria 9461
221 Ga0157375_10098826 3300013308 Bacteria 2996
222 Ga0157375_11366254 3300013308 Unclassified 834
223 Ga0157375_11845750 3300013308 Bacteria 717
224 Ga0163163_10088563 3300014325 Bacteria 3107
225 Ga0163163_10309413 3300014325 Bacteria 1633
226 Ga0157380_10000155 3300014326 Bacteria 39407
227 Ga0157380_10006572 3300014326 Bacteria 8198
228 Ga0182008_10001611 3300014497 Bacteria 14976
229 Ga0157377_10269792 3300014745 Bacteria 1111
230 Ga0157379_10057488 3300014968 Bacteria 3476
231 Ga0157379_10100823 3300014968 Bacteria 2592
232 Ga0157379_10604507 3300014968 Unclassified 1024
233 Ga0182006_1109507 3300015261 Bacteria 971
234 Ga0182007_10001949 3300015262 Bacteria 10677
235 Ga0163161_10012539 3300017792 Bacteria 5885
236 Ga0209564_1000002 3300025295 Bacteria 1636803
237 Ga0207697_10034066 3300025315 Bacteria 2085
238 Ga0207656_10090065 3300025321 Bacteria 1391
239 Ga0207653_10000144 3300025885 Bacteria 50761
240 Ga0207710_10000267 3300025900 Bacteria 42967
241 Ga0207710_10015464 3300025900 Bacteria 3225
242 Ga0207710_10298743 3300025900 Unclassified 813
243 Ga0207680_10099733 3300025903 Bacteria 1864
244 Ga0207680_10492433 3300025903 Unclassified 873
245 Ga0207645_10126802 3300025907 Bacteria 1659
246 Ga0207643_10160679 3300025908 Bacteria 1352
247 Ga0207643_10392445 3300025908 Bacteria 876
248 Ga0207643_10526469 3300025908 Unclassified 757
249 Ga0207643_11083040 3300025908 Unclassified 517
250 Ga0207705_10087153 3300025909 Bacteria 2282
251 Ga0207684_10010878 3300025910 Bacteria 7983
252 Ga0207654_10021236 3300025911 Bacteria 3450
253 Ga0207654_10778829 3300025911 Bacteria 690
254 Ga0207707_10414768 3300025912 Viruses 1155
255 Ga0207707_10928396 3300025912 Bacteria 718
256 Ga0207707_11246093 3300025912 Bacteria 600
257 Ga0207695_11575526 3300025913 Unclassified 537
258 Ga0207671_10559002 3300025914 Viruses 912
259 Ga0207671_10669268 3300025914 Bacteria 826
260 Ga0207663_10486289 3300025916 Unclassified 957
261 Ga0207660_10011962 3300025917 Bacteria 5665
262 Ga0207657_11012420 3300025919 Bacteria 637
263 Ga0207649_10000859 3300025920 Bacteria 19343
264 Ga0207649_11333137 3300025920 Unclassified 568
265 Ga0207652_10256672 3300025921 Bacteria 1577
266 Ga0207646_10013512 3300025922 Bacteria 7802
267 Ga0207681_10023038 3300025923 Bacteria 3977
268 Ga0207681_10510991 3300025923 Bacteria 985
269 Ga0207681_10554614 3300025923 Unclassified 946
270 Ga0207650_10000004 3300025925 Bacteria 743372
271 Ga0207650_10003683 3300025925 Bacteria 10478
272 Ga0207650_10383987 3300025925 Viruses 1160
273 Ga0207650_10517112 3300025925 Bacteria 999
274 Ga0207687_10002111 3300025927 Bacteria 13587
275 Ga0207700_10875566 3300025928 Bacteria 804
276 Ga0207644_10804157 3300025931 Bacteria 786
277 Ga0207690_10004924 3300025932 Bacteria 7878
278 Ga0207706_10027988 3300025933 Bacteria 5036
279 Ga0207706_10119874 3300025933 Bacteria 2313
280 Ga0207686_10152856 3300025934 Bacteria 1609
281 Ga0207686_10500684 3300025934 Bacteria 942
282 Ga0207686_11248884 3300025934 Bacteria 609
283 Ga0207670_10000860 3300025936 Bacteria 15940
284 Ga0207670_10513907 3300025936 Bacteria 974
285 Ga0207669_11489831 3300025937 Bacteria 577
286 Ga0207691_10008323 3300025940 Bacteria 9961
287 Ga0207691_10056881 3300025940 Bacteria 3562
288 Ga0207691_10754790 3300025940 Bacteria 819
289 Ga0207711_10000973 3300025941 Bacteria 27429
290 Ga0207711_10005552 3300025941 Bacteria 10666
291 Ga0207711_10055006 3300025941 Bacteria 3417
292 Ga0207711_10469216 3300025941 Bacteria 1172
293 Ga0207711_10582869 3300025941 Bacteria 1043
294 Ga0207711_11239554 3300025941 Unclassified 688
295 Ga0207689_10007977 3300025942 Bacteria 9250
296 Ga0207689_10020022 3300025942 Bacteria 5636
297 Ga0207689_10023233 3300025942 Bacteria 5206
298 Ga0207689_10214193 3300025942 Bacteria 1592
299 Ga0207661_10000194 3300025944 Bacteria 39579
300 Ga0207679_10000255 3300025945 Bacteria 40708
301 Ga0207679_10091225 3300025945 Bacteria 2357
302 Ga0207667_10028542 3300025949 Bacteria 6059
303 Ga0207667_10621002 3300025949 Bacteria 1088
304 Ga0207651_10072362 3300025960 Viruses 2447
305 Ga0207651_10576708 3300025960 Unclassified 981
306 Ga0207651_10836943 3300025960 Unclassified 817
307 Ga0207712_10108937 3300025961 Unclassified 2074
308 Ga0207712_10237298 3300025961 Bacteria 1467
309 Ga0207712_10800626 3300025961 Bacteria 828
310 Ga0207668_10078936 3300025972 Bacteria 2379
311 Ga0207668_10249821 3300025972 Bacteria 1440
312 Ga0207640_10288982 3300025981 Bacteria 1292
313 Ga0207640_10326388 3300025981 Bacteria 1224
314 Ga0207640_11817922 3300025981 Unclassified 551
315 Ga0207658_10001122 3300025986 Bacteria 21606
316 Ga0207658_10003901 3300025986 Bacteria 10490
317 Ga0207658_12113122 3300025986 Unclassified 512
318 Ga0207703_10001875 3300026035 Bacteria 18690
319 Ga0207703_10005164 3300026035 Bacteria 10555
320 Ga0207703_10076353 3300026035 Bacteria 2779
321 Ga0207703_10200957 3300026035 Bacteria 1771
322 Ga0207703_11106439 3300026035 Unclassified 761
323 Ga0207703_11336656 3300026035 Bacteria 689
324 Ga0207703_11673273 3300026035 Unclassified 612
325 Ga0207703_12052308 3300026035 Unclassified 548
326 Ga0207639_10748736 3300026041 Bacteria 908
327 Ga0207678_10465586 3300026067 Bacteria 1100
328 Ga0207708_10014852 3300026075 Bacteria 5829
329 Ga0207708_10133055 3300026075 Unclassified 1946
330 Ga0207702_10033060 3300026078 Bacteria 4317
331 Ga0207641_10008505 3300026088 Bacteria 8481
332 Ga0207641_10024821 3300026088 Unclassified 4941
333 Ga0207641_10225352 3300026088 Unclassified 1740
334 Ga0207641_10328691 3300026088 Bacteria 1452
335 Ga0207641_11042623 3300026088 Bacteria 815
336 Ga0207648_10065058 3300026089 Bacteria 3179
337 Ga0207648_10602348 3300026089 Bacteria 1013
338 Ga0207676_10000143 3300026095 Bacteria 62176
339 Ga0207676_10012135 3300026095 Bacteria 6167
340 Ga0207676_10197761 3300026095 Bacteria 1774
341 Ga0207676_10518895 3300026095 Bacteria 1134
342 Ga0207674_10000570 3300026116 Bacteria 48354
343 Ga0207674_10301231 3300026116 Unclassified 1552
344 Ga0207675_100060409 3300026118 Bacteria 3539
345 Ga0207675_100935369 3300026118 Unclassified 884
346 Ga0207683_10001071 3300026121 Bacteria 24964
347 Ga0207683_10213398 3300026121 Bacteria 1757
348 Ga0207683_10954977 3300026121 Bacteria 796
349 Ga0207683_11188262 3300026121 Unclassified 707
350 Ga0207698_10204726 3300026142 Bacteria 1770
351 Ga0207698_10969270 3300026142 Unclassified 860
352 Ga0207428_10001769 3300027907 Bacteria 22136
353 Ga0207428_10666669 3300027907 Unclassified 746
354 Ga0268266_10041093 3300028379 Bacteria 3944
355 Ga0268266_11028852 3300028379 Unclassified 797
356 Ga0268265_10000001 3300028380 Bacteria 1230727
357 Ga0268264_10023412 3300028381 Bacteria 5039
358 Ga0268264_10443802 3300028381 Bacteria 1256
359 Ga0268264_10450449 3300028381 Unclassified 1247
360 Ga0265760_10051947 3300031090 Unclassified 1235
361 Ga0307508_10161662 3300031616 Bacteria 1843
362 Ga0373934_0218515 3300035086 Bacteria 786
363 Ga0373957_0208593 3300035120 Bacteria 816
364 Ga0373961_0122150 3300035241 Unclassified 864
365 Ga0373933_0493417 3300035724 Bacteria 802
366 Ga0373937_0337245 3300036401 Bacteria 1427
367 Ga0439435_0008888 3300042436 Unclassified 2342
368 Ga0453684_0013456 3300044712 Bacteria 13282
369 Ga0495651_0271718 3300046462 Bacteria 1149
370 Ga0495653_0863860 3300046463 Unclassified 541
371 Ga0495580_0021924 3300046472 Bacteria 4709
372 Ga0495584_0027372 3300046491 Unclassified 2889
373 Ga0495606_0012280 3300046507 Bacteria 6889
374 Ga0495608_0589976 3300046511 Bacteria 667
375 Ga0495630_1013181 3300046517 Bacteria 631
376 Ga0495632_0481900 3300046519 Unclassified 536
377 Ga0495643_0000079 3300046522 Bacteria 162735
378 Ga0495643_0477336 3300046522 Unclassified 539
379 Ga0495652_0477611 3300046529 Bacteria 868
380 Ga0495621_0013401 3300046539 Bacteria 2575
381 Ga0495597_0023958 3300046542 Bacteria 2821
382 Ga0495667_0300143 3300046559 Bacteria 1018
383 Ga0495656_0549393 3300046615 Bacteria 615
384 Ga0495611_0191022 3300046648 Bacteria 956
385 Ga0495625_0063658 3300046660 Bacteria 2604
386 Ga0495661_0031301 3300046665 Bacteria 3379
387 Ga0495657_0081093 3300046675 Bacteria 2099
388 Ga0495599_0550862 3300046678 Bacteria 675
389 Ga0495623_0636386 3300046679 Bacteria 551
390 Ga0495624_0532585 3300046690 Unclassified 702
391 Ga0495624_0786338 3300046690 Bacteria 563
392 Ga0495670_0003887 3300046691 Bacteria 7337
393 Ga0495604_0338509 3300047317 Bacteria 1002
394 Ga0495680_0741620 3300047322 Bacteria 646
395 Ga0495683_0018811 3300047323 Bacteria 3568
396 Ga0495687_000187 3300047443 Bacteria 90147
397 Ga0495687_130371 3300047443 Bacteria 891
398 Ga0496100_0136710 3300048903 Bacteria 1732
399 Ga0496100_0414257 3300048903 Unclassified 1028
400 Ga0496101_0248559 3300048904 Bacteria 1385
401 Ga0496102_0004345 3300048905 Bacteria 11980
402 Ga0496102_0355391 3300048905 Bacteria 1379
403 Ga0496102_0563642 3300048905 Bacteria 1062
404 Ga0496103_0162688 3300048906 Bacteria 1432
405 Ga0496103_0580779 3300048906 Unclassified 714
406 Ga0496104_0004448 3300048907 Bacteria 12207
407 Ga0496104_0224055 3300048907 Viruses 1793
408 Ga0496105_0045730 3300048908 Unclassified 3612
409 Ga0496106_0015712 3300048909 Bacteria 5601
410 Ga0496106_0023803 3300048909 Bacteria 4552
411 Ga0496106_0181185 3300048909 Bacteria 1672
412 Ga0496107_0023277 3300048910 Unclassified 4380
413 Ga0496107_0498886 3300048910 Unclassified 903
414 Ga0496108_0002232 3300048911 Bacteria 15524
415 Ga0496108_0006982 3300048911 Bacteria 9139
416 Ga0496108_0688407 3300048911 Unclassified 887
417 Ga0496109_0040979 3300048912 Unclassified 4195
418 Ga0496109_0046803 3300048912 Bacteria 3930
419 Ga0496110_0012584 3300048913 Bacteria 6959
420 Ga0496112_0000842 3300048915 Bacteria 21887
421 Ga0496112_0056731 3300048915 Bacteria 3855
422 Ga0496112_0823475 3300048915 Bacteria 852
423 Ga0496112_1033599 3300048915 Unclassified 741
424 Ga0496113_0016027 3300048916 Bacteria 5171
425 Ga0496113_0169607 3300048916 Bacteria 1728
426 Ga0496114_0276440 3300048917 Bacteria 1480
427 Ga0496114_0319255 3300048917 Bacteria 1372
428 Ga0496114_0705964 3300048917 Unclassified 884
429 Ga0496114_1260907 3300048917 Unclassified 626
430 Ga0496115_0014894 3300048918 Bacteria 5897
431 Ga0496115_0436370 3300048918 Bacteria 1059
432 Ga0496115_1441837 3300048918 Unclassified 507
433 Ga0496121_0890158 3300048924 Unclassified 513
434 Ga0495682_0061526 3300049460 Bacteria 1355
435 Ga0501294_028542 3300049517 Unclassified 640
436 Ga0501217_277748 3300049661 Unclassified 547
437 nmdc:mga05p37_310801_c1 3300050507 Unclassified 1868
438 nmdc:mga08y16_2045143_c1 3300050511 Bacteria 521
439 nmdc:mga08y16_399536_c1 3300050511 Bacteria 1407
440 nmdc:mga08y16_569827_c1 3300050511 Bacteria 1144
441 Ga0495601_0560936 3300053077 Bacteria 734
442 Ga0500651_0018416 3300053093 Unclassified 4323
443 Ga0500568_0003238 3300053139 Bacteria 9207
444 Ga0500568_0005012 3300053139 Bacteria 6943
445 Ga0500616_0002597 3300053153 Bacteria 14817

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100059758 Ga0070698_1000597583 60
2 3300046472 Ga0495580_0021924 Ga0495580_0021924_1119_1415 65
3 3300047323 Ga0495683_0018811 Ga0495683_0018811_1113_1409 65
4 3300047443 Ga0495687_130371 Ga0495687_130371_321_617 65
5 3300049460 Ga0495682_0061526 Ga0495682_0061526_677_973 65
6 iso_pu_bacteria 2861520306 2861523525 65
7 iso_pu_bacteria 8057568493 8057573648 65
8 3300053139 Ga0500568_0003238 Ga0500568_0003238_2360_2656 66
9 3300005340 Ga0070689_100000841 Ga0070689_10000084110 67
10 3300005458 Ga0070681_11092721 Ga0070681_110927212 67
11 3300005842 Ga0068858_100000470 Ga0068858_1000004701 67
12 3300025912 Ga0207707_10928396 Ga0207707_109283962 67
13 3300046522 Ga0495643_0477336 Ga0495643_0477336_81_377 67
14 3300046542 Ga0495597_0023958 Ga0495597_0023958_1312_1608 67
15 3300047443 Ga0495687_000187 Ga0495687_000187_57589_57885 67
16 iso_pu_bacteria 2842134933 2842136647 67
17 3300005471 Ga0070698_100692380 Ga0070698_1006923802 68
18 3300005618 Ga0068864_100678354 Ga0068864_1006783542 68
19 3300025942 Ga0207689_10214193 Ga0207689_102141933 68
20 3300048903 Ga0496100_0414257 Ga0496100_0414257_354_620 68
21 3300048904 Ga0496101_0248559 Ga0496101_0248559_468_734 68
22 3300048905 Ga0496102_0355391 Ga0496102_0355391_805_1071 68
23 3300048906 Ga0496103_0162688 Ga0496103_0162688_325_591 68
24 3300048909 Ga0496106_0181185 Ga0496106_0181185_997_1263 68
25 3300048910 Ga0496107_0498886 Ga0496107_0498886_194_460 68
26 3300048917 Ga0496114_0319255 Ga0496114_0319255_385_651 68
27 3300048918 Ga0496115_0436370 Ga0496115_0436370_250_516 68
28 3300005548 Ga0070665_101123202 Ga0070665_1011232022 69
29 3300025927 Ga0207687_10002111 Ga0207687_100021116 69
30 3300025936 Ga0207670_10000860 Ga0207670_100008601 69
31 3300026035 Ga0207703_10001875 Ga0207703_1000187510 69
32 3300028379 Ga0268266_11028852 Ga0268266_110288522 69
33 3300048917 Ga0496114_0705964 Ga0496114_0705964_477_773 69
34 3300013308 Ga0157375_11845750 Ga0157375_118457502 70
35 3300009094 Ga0111539_10001077 Ga0111539_1000107727 71
36 3300009553 Ga0105249_10397604 Ga0105249_103976042 71
37 3300035724 Ga0373933_0493417 Ga0373933_0493417_466_762 71
38 3300046517 Ga0495630_1013181 Ga0495630_1013181_287_583 71
39 3300046678 Ga0495599_0550862 Ga0495599_0550862_294_590 71
40 3300046690 Ga0495624_0532585 Ga0495624_0532585_381_677 71
41 3300046690 Ga0495624_0786338 Ga0495624_0786338_83_379 71
42 3300048917 Ga0496114_1260907 Ga0496114_1260907_232_528 71
43 iso_pu_bacteria 2904699407 2904708340 74
44 iso_pu_bacteria 3005445848 3005452202 74
45 iso_pu_bacteria 637000159 637078512 74
46 3300025919 Ga0207657_11012420 Ga0207657_110124201 76
47 3300035086 Ga0373934_0218515 Ga0373934_0218515_447_737 76
48 3300035120 Ga0373957_0208593 Ga0373957_0208593_405_695 76
49 3300036401 Ga0373937_0337245 Ga0373937_0337245_946_1236 76
50 3300046511 Ga0495608_0589976 Ga0495608_0589976_107_397 76
51 3300046529 Ga0495652_0477611 Ga0495652_0477611_435_725 76
52 3300046559 Ga0495667_0300143 Ga0495667_0300143_309_599 76
53 3300046675 Ga0495657_0081093 Ga0495657_0081093_1053_1343 76
54 3300046679 Ga0495623_0636386 Ga0495623_0636386_85_375 76
55 3300047322 Ga0495680_0741620 Ga0495680_0741620_247_537 76
56 3300005441 Ga0070700_100005688 Ga0070700_1000056884 77
57 3300005444 Ga0070694_100646877 Ga0070694_1006468772 77
58 3300005445 Ga0070708_100064542 Ga0070708_1000645422 77
59 3300005546 Ga0070696_101578098 Ga0070696_1015780982 77
60 3300005547 Ga0070693_100495912 Ga0070693_1004959122 77
61 3300006871 Ga0075434_100791284 Ga0075434_1007912841 77
62 3300014497 Ga0182008_10001611 Ga0182008_100016118 77
63 3300015261 Ga0182006_1109507 Ga0182006_11095071 77
64 3300015262 Ga0182007_10001949 Ga0182007_1000194912 77
65 3300025885 Ga0207653_10000144 Ga0207653_1000014412 77
66 3300025908 Ga0207643_11083040 Ga0207643_110830401 77
67 3300025925 Ga0207650_10383987 Ga0207650_103839872 77
68 3300025961 Ga0207712_10237298 Ga0207712_102372982 77
69 3300026075 Ga0207708_10014852 Ga0207708_100148524 77
70 3300027907 Ga0207428_10001769 Ga0207428_100017699 77
71 3300031090 Ga0265760_10051947 Ga0265760_100519473 77
72 3300002074 JGI24748J21848_1000008 JGI24748J21848_1000008166 78
73 3300002076 JGI24749J21850_1000014 JGI24749J21850_100001420 78
74 3300002239 JGI24034J26672_10000002 JGI24034J26672_10000002312 78
75 3300002244 JGI24742J22300_10021316 JGI24742J22300_100213163 78
76 3300002459 JGI24751J29686_10000028 JGI24751J29686_1000002853 78
77 3300003322 rootL2_10237773 rootL2_102377734 78
78 3300003771 Ga0055526_1000001 Ga0055526_1000001113 78
79 3300005288 Ga0065714_10484319 Ga0065714_104843192 78
80 3300005290 Ga0065712_10001937 Ga0065712_100019379 78
81 3300005293 Ga0065715_10029636 Ga0065715_100296363 78
82 3300005293 Ga0065715_10207382 Ga0065715_102073822 78
83 3300005329 Ga0070683_100661903 Ga0070683_1006619032 78
84 3300005330 Ga0070690_100988783 Ga0070690_1009887832 78
85 3300005331 Ga0070670_100000093 Ga0070670_10000009373 78
86 3300005331 Ga0070670_101293729 Ga0070670_1012937292 78
87 3300005334 Ga0068869_100131846 Ga0068869_1001318463 78
88 3300005334 Ga0068869_100384236 Ga0068869_1003842363 78
89 3300005335 Ga0070666_10054491 Ga0070666_100544913 78
90 3300005335 Ga0070666_10185506 Ga0070666_101855061 78
91 3300005335 Ga0070666_10547734 Ga0070666_105477342 78
92 3300005335 Ga0070666_10980573 Ga0070666_109805732 78
93 3300005336 Ga0070680_101563033 Ga0070680_1015630332 78
94 3300005337 Ga0070682_100005456 Ga0070682_1000054563 78
95 3300005338 Ga0068868_100037865 Ga0068868_1000378651 78
96 3300005340 Ga0070689_100192971 Ga0070689_1001929713 78
97 3300005340 Ga0070689_100239051 Ga0070689_1002390513 78
98 3300005343 Ga0070687_100209543 Ga0070687_1002095433 78
99 3300005343 Ga0070687_100952416 Ga0070687_1009524161 78
100 3300005344 Ga0070661_101748163 Ga0070661_1017481631 78
101 3300005345 Ga0070692_10002029 Ga0070692_100020294 78
102 3300005345 Ga0070692_10361531 Ga0070692_103615311 78
103 3300005345 Ga0070692_10855921 Ga0070692_108559212 78
104 3300005347 Ga0070668_100083262 Ga0070668_1000832623 78
105 3300005353 Ga0070669_100022236 Ga0070669_1000222363 78
106 3300005353 Ga0070669_100056846 Ga0070669_1000568463 78
107 3300005353 Ga0070669_100061477 Ga0070669_1000614774 78
108 3300005354 Ga0070675_100439519 Ga0070675_1004395192 78
109 3300005355 Ga0070671_100009376 Ga0070671_10000937610 78
110 3300005355 Ga0070671_100341312 Ga0070671_1003413122 78
111 3300005356 Ga0070674_102119873 Ga0070674_1021198732 78
112 3300005364 Ga0070673_100011302 Ga0070673_1000113025 78
113 3300005364 Ga0070673_100243833 Ga0070673_1002438333 78
114 3300005364 Ga0070673_100581084 Ga0070673_1005810842 78
115 3300005365 Ga0070688_100095281 Ga0070688_1000952812 78
116 3300005365 Ga0070688_100977697 Ga0070688_1009776972 78
117 3300005365 Ga0070688_101321359 Ga0070688_1013213591 78
118 3300005367 Ga0070667_100001690 Ga0070667_10000169018 78
119 3300005367 Ga0070667_100012817 Ga0070667_1000128177 78
120 3300005367 Ga0070667_100138327 Ga0070667_1001383272 78
121 3300005435 Ga0070714_101371607 Ga0070714_1013716072 78
122 3300005435 Ga0070714_101453999 Ga0070714_1014539992 78
123 3300005438 Ga0070701_10160680 Ga0070701_101606803 78
124 3300005438 Ga0070701_10760823 Ga0070701_107608232 78
125 3300005439 Ga0070711_100509373 Ga0070711_1005093731 78
126 3300005440 Ga0070705_100017866 Ga0070705_1000178662 78
127 3300005440 Ga0070705_100714780 Ga0070705_1007147802 78
128 3300005440 Ga0070705_100800389 Ga0070705_1008003892 78
129 3300005440 Ga0070705_100860877 Ga0070705_1008608772 78
130 3300005440 Ga0070705_101439340 Ga0070705_1014393402 78
131 3300005441 Ga0070700_100045471 Ga0070700_1000454713 78
132 3300005441 Ga0070700_100631712 Ga0070700_1006317122 78
133 3300005444 Ga0070694_100000051 Ga0070694_10000005127 78
134 3300005444 Ga0070694_100040746 Ga0070694_1000407463 78
135 3300005444 Ga0070694_100154224 Ga0070694_1001542242 78
136 3300005444 Ga0070694_100167811 Ga0070694_1001678113 78
137 3300005444 Ga0070694_100261739 Ga0070694_1002617391 78
138 3300005444 Ga0070694_100373480 Ga0070694_1003734802 78
139 3300005445 Ga0070708_100057527 Ga0070708_1000575275 78
140 3300005445 Ga0070708_100924999 Ga0070708_1009249992 78
141 3300005455 Ga0070663_100943173 Ga0070663_1009431732 78
142 3300005456 Ga0070678_100053815 Ga0070678_1000538152 78
143 3300005456 Ga0070678_100270731 Ga0070678_1002707312 78
144 3300005456 Ga0070678_100364408 Ga0070678_1003644082 78
145 3300005458 Ga0070681_10006958 Ga0070681_100069583 78
146 3300005459 Ga0068867_100065592 Ga0068867_1000655924 78
147 3300005466 Ga0070685_10396014 Ga0070685_103960142 78
148 3300005467 Ga0070706_100017307 Ga0070706_1000173075 78
149 3300005467 Ga0070706_100225880 Ga0070706_1002258801 78
150 3300005467 Ga0070706_100246460 Ga0070706_1002464603 78
151 3300005468 Ga0070707_100015314 Ga0070707_1000153145 78
152 3300005471 Ga0070698_100003623 Ga0070698_1000036232 78
153 3300005471 Ga0070698_100028055 Ga0070698_1000280553 78
154 3300005471 Ga0070698_101792734 Ga0070698_1017927341 78
155 3300005518 Ga0070699_100027943 Ga0070699_1000279433 78
156 3300005530 Ga0070679_101536707 Ga0070679_1015367071 78
157 3300005536 Ga0070697_100109014 Ga0070697_1001090142 78
158 3300005536 Ga0070697_100210248 Ga0070697_1002102483 78
159 3300005536 Ga0070697_100728199 Ga0070697_1007281992 78
160 3300005539 Ga0068853_100086012 Ga0068853_1000860123 78
161 3300005539 Ga0068853_101217333 Ga0068853_1012173332 78
162 3300005543 Ga0070672_100030826 Ga0070672_1000308264 78
163 3300005543 Ga0070672_100042541 Ga0070672_1000425413 78
164 3300005543 Ga0070672_100635939 Ga0070672_1006359392 78
165 3300005544 Ga0070686_100628317 Ga0070686_1006283172 78
166 3300005544 Ga0070686_101538284 Ga0070686_1015382842 78
167 3300005545 Ga0070695_100000132 Ga0070695_10000013217 78
168 3300005545 Ga0070695_100041724 Ga0070695_1000417244 78
169 3300005545 Ga0070695_100214978 Ga0070695_1002149783 78
170 3300005545 Ga0070695_100295074 Ga0070695_1002950741 78
171 3300005545 Ga0070695_101394168 Ga0070695_1013941681 78
172 3300005546 Ga0070696_100104352 Ga0070696_1001043523 78
173 3300005546 Ga0070696_100357705 Ga0070696_1003577052 78
174 3300005547 Ga0070693_100008064 Ga0070693_1000080643 78
175 3300005548 Ga0070665_100059058 Ga0070665_1000590583 78
176 3300005548 Ga0070665_100730226 Ga0070665_1007302261 78
177 3300005549 Ga0070704_100135160 Ga0070704_1001351603 78
178 3300005564 Ga0070664_100000981 Ga0070664_1000009815 78
179 3300005564 Ga0070664_100035409 Ga0070664_1000354093 78
180 3300005564 Ga0070664_100093270 Ga0070664_1000932703 78
181 3300005564 Ga0070664_100920338 Ga0070664_1009203382 78
182 3300005577 Ga0068857_100001605 Ga0068857_1000016058 78
183 3300005578 Ga0068854_100542738 Ga0068854_1005427382 78
184 3300005614 Ga0068856_100027841 Ga0068856_1000278413 78
185 3300005615 Ga0070702_100013341 Ga0070702_1000133415 78
186 3300005615 Ga0070702_100064184 Ga0070702_1000641843 78
187 3300005615 Ga0070702_100736886 Ga0070702_1007368861 78
188 3300005616 Ga0068852_100418457 Ga0068852_1004184572 78
189 3300005616 Ga0068852_100858013 Ga0068852_1008580131 78
190 3300005617 Ga0068859_100000901 Ga0068859_1000009018 78
191 3300005617 Ga0068859_100001569 Ga0068859_10000156919 78
192 3300005617 Ga0068859_100205257 Ga0068859_1002052571 78
193 3300005617 Ga0068859_102959927 Ga0068859_1029599272 78
194 3300005617 Ga0068859_102971794 Ga0068859_1029717942 78
195 3300005618 Ga0068864_100000087 Ga0068864_10000008774 78
196 3300005618 Ga0068864_100000730 Ga0068864_1000007305 78
197 3300005618 Ga0068864_100001498 Ga0068864_1000014988 78
198 3300005618 Ga0068864_100381321 Ga0068864_1003813213 78
199 3300005719 Ga0068861_100004876 Ga0068861_10000487612 78
200 3300005719 Ga0068861_100009079 Ga0068861_1000090793 78
201 3300005719 Ga0068861_100520624 Ga0068861_1005206242 78
202 3300005719 Ga0068861_101939584 Ga0068861_1019395841 78
203 3300005834 Ga0068851_10068276 Ga0068851_100682761 78
204 3300005840 Ga0068870_10052415 Ga0068870_100524153 78
205 3300005841 Ga0068863_100001792 Ga0068863_10000179216 78
206 3300005841 Ga0068863_100012858 Ga0068863_1000128583 78
207 3300005841 Ga0068863_100081823 Ga0068863_1000818233 78
208 3300005841 Ga0068863_100117541 Ga0068863_1001175413 78
209 3300005841 Ga0068863_100176446 Ga0068863_1001764462 78
210 3300005842 Ga0068858_100000300 Ga0068858_10000030034 78
211 3300005842 Ga0068858_100009128 Ga0068858_1000091285 78
212 3300005842 Ga0068858_100209353 Ga0068858_1002093531 78
213 3300005842 Ga0068858_100223541 Ga0068858_1002235412 78
214 3300005843 Ga0068860_100911415 Ga0068860_1009114152 78
215 3300005844 Ga0068862_100000534 Ga0068862_10000053412 78
216 3300005844 Ga0068862_102304953 Ga0068862_1023049531 78
217 3300006194 Ga0075427_10097290 Ga0075427_100972901 78
218 3300006237 Ga0097621_100004458 Ga0097621_1000044585 78
219 3300006237 Ga0097621_100438191 Ga0097621_1004381912 78
220 3300006237 Ga0097621_102147434 Ga0097621_1021474341 78
221 3300006237 Ga0097621_102307503 Ga0097621_1023075032 78
222 3300006358 Ga0068871_100080673 Ga0068871_1000806733 78
223 3300006358 Ga0068871_101003352 Ga0068871_1010033522 78
224 3300006844 Ga0075428_100744928 Ga0075428_1007449281 78
225 3300006881 Ga0068865_100693539 Ga0068865_1006935392 78
226 3300006931 Ga0097620_100000901 Ga0097620_1000009018 78
227 3300006931 Ga0097620_100001569 Ga0097620_10000156919 78
228 3300006931 Ga0097620_100205259 Ga0097620_1002052591 78
229 3300006931 Ga0097620_102961334 Ga0097620_1029613342 78
230 3300006931 Ga0097620_102972588 Ga0097620_1029725882 78
231 3300009094 Ga0111539_10067152 Ga0111539_100671522 78
232 3300009094 Ga0111539_10105307 Ga0111539_101053073 78
233 3300009094 Ga0111539_10440471 Ga0111539_104404713 78
234 3300009094 Ga0111539_12542449 Ga0111539_125424492 78
235 3300009101 Ga0105247_10000001 Ga0105247_10000001333 78
236 3300009101 Ga0105247_10000273 Ga0105247_1000027321 78
237 3300009101 Ga0105247_10001576 Ga0105247_100015765 78
238 3300009101 Ga0105247_10548949 Ga0105247_105489492 78
239 3300009147 Ga0114129_10022697 Ga0114129_100226974 78
240 3300009147 Ga0114129_11309758 Ga0114129_113097582 78
241 3300009147 Ga0114129_12172434 Ga0114129_121724342 78
242 3300009174 Ga0105241_10071776 Ga0105241_100717762 78
243 3300009176 Ga0105242_10187217 Ga0105242_101872173 78
244 3300009177 Ga0105248_10002535 Ga0105248_100025354 78
245 3300009177 Ga0105248_10002695 Ga0105248_1000269511 78
246 3300009177 Ga0105248_10087401 Ga0105248_100874013 78
247 3300009177 Ga0105248_10596977 Ga0105248_105969772 78
248 3300009177 Ga0105248_11229356 Ga0105248_112293561 78
249 3300009177 Ga0105248_11834845 Ga0105248_118348452 78
250 3300009545 Ga0105237_10211067 Ga0105237_102110673 78
251 3300009545 Ga0105237_10435341 Ga0105237_104353412 78
252 3300009551 Ga0105238_10084423 Ga0105238_100844234 78
253 3300009553 Ga0105249_10087514 Ga0105249_100875143 78
254 3300009553 Ga0105249_10144230 Ga0105249_101442304 78
255 3300009553 Ga0105249_10552339 Ga0105249_105523392 78
256 3300009553 Ga0105249_11206248 Ga0105249_112062482 78
257 3300011119 Ga0105246_10046273 Ga0105246_100462732 78
258 3300011119 Ga0105246_10721949 Ga0105246_107219492 78
259 3300013102 Ga0157371_10085991 Ga0157371_100859913 78
260 3300013105 Ga0157369_10007182 Ga0157369_100071823 78
261 3300013105 Ga0157369_10425091 Ga0157369_104250912 78
262 3300013296 Ga0157374_10617713 Ga0157374_106177132 78
263 3300013296 Ga0157374_11424504 Ga0157374_114245042 78
264 3300013296 Ga0157374_12548641 Ga0157374_125486412 78
265 3300013297 Ga0157378_10000039 Ga0157378_1000003973 78
266 3300013297 Ga0157378_10000400 Ga0157378_1000040025 78
267 3300013297 Ga0157378_10888987 Ga0157378_108889872 78
268 3300013306 Ga0163162_10008417 Ga0163162_100084179 78
269 3300013306 Ga0163162_10049960 Ga0163162_100499603 78
270 3300013306 Ga0163162_10058503 Ga0163162_100585033 78
271 3300013306 Ga0163162_10200989 Ga0163162_102009893 78
272 3300013306 Ga0163162_11714405 Ga0163162_117144052 78
273 3300013307 Ga0157372_10840092 Ga0157372_108400922 78
274 3300013307 Ga0157372_10990741 Ga0157372_109907412 78
275 3300013308 Ga0157375_10000009 Ga0157375_10000009224 78
276 3300013308 Ga0157375_10007636 Ga0157375_1000763610 78
277 3300013308 Ga0157375_10098826 Ga0157375_100988263 78
278 3300013308 Ga0157375_11366254 Ga0157375_113662541 78
279 3300014325 Ga0163163_10088563 Ga0163163_100885633 78
280 3300014325 Ga0163163_10309413 Ga0163163_103094133 78
281 3300014326 Ga0157380_10000155 Ga0157380_1000015522 78
282 3300014326 Ga0157380_10006572 Ga0157380_100065729 78
283 3300014745 Ga0157377_10269792 Ga0157377_102697921 78
284 3300014968 Ga0157379_10057488 Ga0157379_100574882 78
285 3300014968 Ga0157379_10100823 Ga0157379_101008232 78
286 3300014968 Ga0157379_10604507 Ga0157379_106045072 78
287 3300017792 Ga0163161_10012539 Ga0163161_100125399 78
288 3300025295 Ga0209564_1000002 Ga0209564_1000002452 78
289 3300025315 Ga0207697_10034066 Ga0207697_100340662 78
290 3300025321 Ga0207656_10090065 Ga0207656_100900652 78
291 3300025900 Ga0207710_10000267 Ga0207710_1000026721 78
292 3300025900 Ga0207710_10015464 Ga0207710_100154645 78
293 3300025900 Ga0207710_10298743 Ga0207710_102987432 78
294 3300025903 Ga0207680_10099733 Ga0207680_100997332 78
295 3300025903 Ga0207680_10492433 Ga0207680_104924332 78
296 3300025907 Ga0207645_10126802 Ga0207645_101268022 78
297 3300025908 Ga0207643_10160679 Ga0207643_101606793 78
298 3300025908 Ga0207643_10392445 Ga0207643_103924452 78
299 3300025908 Ga0207643_10526469 Ga0207643_105264692 78
300 3300025909 Ga0207705_10087153 Ga0207705_100871533 78
301 3300025910 Ga0207684_10010878 Ga0207684_100108785 78
302 3300025911 Ga0207654_10021236 Ga0207654_100212363 78
303 3300025911 Ga0207654_10778829 Ga0207654_107788291 78
304 3300025912 Ga0207707_10414768 Ga0207707_104147683 78
305 3300025912 Ga0207707_11246093 Ga0207707_112460932 78
306 3300025913 Ga0207695_11575526 Ga0207695_115755262 78
307 3300025914 Ga0207671_10559002 Ga0207671_105590021 78
308 3300025914 Ga0207671_10669268 Ga0207671_106692682 78
309 3300025916 Ga0207663_10486289 Ga0207663_104862892 78
310 3300025917 Ga0207660_10011962 Ga0207660_100119623 78
311 3300025920 Ga0207649_10000859 Ga0207649_100008592 78
312 3300025920 Ga0207649_11333137 Ga0207649_113331372 78
313 3300025921 Ga0207652_10256672 Ga0207652_102566723 78
314 3300025922 Ga0207646_10013512 Ga0207646_100135123 78
315 3300025923 Ga0207681_10023038 Ga0207681_100230383 78
316 3300025923 Ga0207681_10510991 Ga0207681_105109913 78
317 3300025923 Ga0207681_10554614 Ga0207681_105546141 78
318 3300025925 Ga0207650_10000004 Ga0207650_10000004730 78
319 3300025925 Ga0207650_10003683 Ga0207650_100036836 78
320 3300025925 Ga0207650_10517112 Ga0207650_105171122 78
321 3300025928 Ga0207700_10875566 Ga0207700_108755662 78
322 3300025931 Ga0207644_10804157 Ga0207644_108041572 78
323 3300025932 Ga0207690_10004924 Ga0207690_100049243 78
324 3300025933 Ga0207706_10027988 Ga0207706_100279882 78
325 3300025933 Ga0207706_10119874 Ga0207706_101198742 78
326 3300025934 Ga0207686_10152856 Ga0207686_101528562 78
327 3300025934 Ga0207686_10500684 Ga0207686_105006841 78
328 3300025934 Ga0207686_11248884 Ga0207686_112488841 78
329 3300025936 Ga0207670_10513907 Ga0207670_105139072 78
330 3300025937 Ga0207669_11489831 Ga0207669_114898312 78
331 3300025940 Ga0207691_10008323 Ga0207691_100083238 78
332 3300025940 Ga0207691_10056881 Ga0207691_100568815 78
333 3300025940 Ga0207691_10754790 Ga0207691_107547902 78
334 3300025941 Ga0207711_10000973 Ga0207711_1000097322 78
335 3300025941 Ga0207711_10005552 Ga0207711_100055524 78
336 3300025941 Ga0207711_10055006 Ga0207711_100550063 78
337 3300025941 Ga0207711_10469216 Ga0207711_104692162 78
338 3300025941 Ga0207711_10582869 Ga0207711_105828691 78
339 3300025941 Ga0207711_11239554 Ga0207711_112395542 78
340 3300025942 Ga0207689_10007977 Ga0207689_100079774 78
341 3300025942 Ga0207689_10020022 Ga0207689_100200222 78
342 3300025942 Ga0207689_10023233 Ga0207689_100232334 78
343 3300025944 Ga0207661_10000194 Ga0207661_1000019411 78
344 3300025945 Ga0207679_10000255 Ga0207679_1000025518 78
345 3300025945 Ga0207679_10091225 Ga0207679_100912251 78
346 3300025949 Ga0207667_10028542 Ga0207667_100285423 78
347 3300025949 Ga0207667_10621002 Ga0207667_106210022 78
348 3300025960 Ga0207651_10072362 Ga0207651_100723623 78
349 3300025960 Ga0207651_10576708 Ga0207651_105767081 78
350 3300025960 Ga0207651_10836943 Ga0207651_108369432 78
351 3300025961 Ga0207712_10108937 Ga0207712_101089373 78
352 3300025961 Ga0207712_10800626 Ga0207712_108006262 78
353 3300025972 Ga0207668_10078936 Ga0207668_100789363 78
354 3300025972 Ga0207668_10249821 Ga0207668_102498212 78
355 3300025981 Ga0207640_10288982 Ga0207640_102889823 78
356 3300025981 Ga0207640_10326388 Ga0207640_103263882 78
357 3300025981 Ga0207640_11817922 Ga0207640_118179221 78
358 3300025986 Ga0207658_10001122 Ga0207658_100011223 78
359 3300025986 Ga0207658_10003901 Ga0207658_100039014 78
360 3300025986 Ga0207658_12113122 Ga0207658_121131222 78
361 3300026035 Ga0207703_10005164 Ga0207703_100051644 78
362 3300026035 Ga0207703_10076353 Ga0207703_100763532 78
363 3300026035 Ga0207703_10200957 Ga0207703_102009572 78
364 3300026035 Ga0207703_11106439 Ga0207703_111064392 78
365 3300026035 Ga0207703_11336656 Ga0207703_113366562 78
366 3300026035 Ga0207703_11673273 Ga0207703_116732732 78
367 3300026035 Ga0207703_12052308 Ga0207703_120523081 78
368 3300026041 Ga0207639_10748736 Ga0207639_107487362 78
369 3300026067 Ga0207678_10465586 Ga0207678_104655862 78
370 3300026075 Ga0207708_10133055 Ga0207708_101330554 78
371 3300026078 Ga0207702_10033060 Ga0207702_100330605 78
372 3300026088 Ga0207641_10008505 Ga0207641_100085053 78
373 3300026088 Ga0207641_10024821 Ga0207641_100248213 78
374 3300026088 Ga0207641_10225352 Ga0207641_102253523 78
375 3300026088 Ga0207641_10328691 Ga0207641_103286912 78
376 3300026088 Ga0207641_11042623 Ga0207641_110426232 78
377 3300026089 Ga0207648_10065058 Ga0207648_100650585 78
378 3300026089 Ga0207648_10602348 Ga0207648_106023482 78
379 3300026095 Ga0207676_10000143 Ga0207676_1000014319 78
380 3300026095 Ga0207676_10012135 Ga0207676_100121353 78
381 3300026095 Ga0207676_10197761 Ga0207676_101977612 78
382 3300026095 Ga0207676_10518895 Ga0207676_105188951 78
383 3300026116 Ga0207674_10000570 Ga0207674_1000057020 78
384 3300026116 Ga0207674_10301231 Ga0207674_103012311 78
385 3300026118 Ga0207675_100060409 Ga0207675_1000604093 78
386 3300026118 Ga0207675_100935369 Ga0207675_1009353692 78
387 3300026121 Ga0207683_10001071 Ga0207683_1000107115 78
388 3300026121 Ga0207683_10213398 Ga0207683_102133982 78
389 3300026121 Ga0207683_10954977 Ga0207683_109549771 78
390 3300026121 Ga0207683_11188262 Ga0207683_111882622 78
391 3300026142 Ga0207698_10204726 Ga0207698_102047263 78
392 3300026142 Ga0207698_10969270 Ga0207698_109692702 78
393 3300027907 Ga0207428_10666669 Ga0207428_106666691 78
394 3300028379 Ga0268266_10041093 Ga0268266_100410934 78
395 3300028380 Ga0268265_10000001 Ga0268265_100000011191 78
396 3300028381 Ga0268264_10023412 Ga0268264_100234122 78
397 3300028381 Ga0268264_10443802 Ga0268264_104438022 78
398 3300028381 Ga0268264_10450449 Ga0268264_104504492 78
399 3300031616 Ga0307508_10161662 Ga0307508_101616623 78
400 3300035241 Ga0373961_0122150 Ga0373961_0122150_103_399 78
401 3300042436 Ga0439435_0008888 Ga0439435_0008888_1408_1701 78
402 3300044712 Ga0453684_0013456 Ga0453684_0013456_9604_9915 78
403 3300046462 Ga0495651_0271718 Ga0495651_0271718_392_688 78
404 3300046463 Ga0495653_0863860 Ga0495653_0863860_51_347 78
405 3300046491 Ga0495584_0027372 Ga0495584_0027372_2321_2617 78
406 3300046507 Ga0495606_0012280 Ga0495606_0012280_4933_5229 78
407 3300046519 Ga0495632_0481900 Ga0495632_0481900_81_377 78
408 3300046522 Ga0495643_0000079 Ga0495643_0000079_119564_119860 78
409 3300046539 Ga0495621_0013401 Ga0495621_0013401_1754_2047 78
410 3300046615 Ga0495656_0549393 Ga0495656_0549393_291_587 78
411 3300046648 Ga0495611_0191022 Ga0495611_0191022_537_833 78
412 3300046660 Ga0495625_0063658 Ga0495625_0063658_136_432 78
413 3300046665 Ga0495661_0031301 Ga0495661_0031301_1569_1865 78
414 3300046691 Ga0495670_0003887 Ga0495670_0003887_3784_4080 78
415 3300047317 Ga0495604_0338509 Ga0495604_0338509_30_326 78
416 3300048903 Ga0496100_0136710 Ga0496100_0136710_1405_1701 78
417 3300048905 Ga0496102_0004345 Ga0496102_0004345_9695_9991 78
418 3300048905 Ga0496102_0563642 Ga0496102_0563642_543_839 78
419 3300048906 Ga0496103_0580779 Ga0496103_0580779_379_675 78
420 3300048907 Ga0496104_0004448 Ga0496104_0004448_10678_10974 78
421 3300048907 Ga0496104_0224055 Ga0496104_0224055_724_1020 78
422 3300048908 Ga0496105_0045730 Ga0496105_0045730_1319_1615 78
423 3300048909 Ga0496106_0015712 Ga0496106_0015712_1153_1449 78
424 3300048909 Ga0496106_0023803 Ga0496106_0023803_405_701 78
425 3300048910 Ga0496107_0023277 Ga0496107_0023277_2010_2306 78
426 3300048911 Ga0496108_0002232 Ga0496108_0002232_13841_14137 78
427 3300048911 Ga0496108_0006982 Ga0496108_0006982_5915_6211 78
428 3300048911 Ga0496108_0688407 Ga0496108_0688407_61_357 78
429 3300048912 Ga0496109_0040979 Ga0496109_0040979_1269_1565 78
430 3300048912 Ga0496109_0046803 Ga0496109_0046803_799_1095 78
431 3300048913 Ga0496110_0012584 Ga0496110_0012584_5307_5603 78
432 3300048915 Ga0496112_0000842 Ga0496112_0000842_7755_8051 78
433 3300048915 Ga0496112_0056731 Ga0496112_0056731_2954_3250 78
434 3300048915 Ga0496112_0823475 Ga0496112_0823475_496_789 78
435 3300048915 Ga0496112_1033599 Ga0496112_1033599_264_560 78
436 3300048916 Ga0496113_0016027 Ga0496113_0016027_3670_3966 78
437 3300048916 Ga0496113_0169607 Ga0496113_0169607_119_415 78
438 3300048917 Ga0496114_0276440 Ga0496114_0276440_565_861 78
439 3300048918 Ga0496115_0014894 Ga0496115_0014894_5349_5645 78
440 3300048918 Ga0496115_1441837 Ga0496115_1441837_183_479 78
441 3300048924 Ga0496121_0890158 Ga0496121_0890158_184_480 78
442 3300049517 Ga0501294_028542 Ga0501294_028542_227_523 78
443 3300049661 Ga0501217_277748 Ga0501217_277748_204_500 78
444 3300050507 nmdc:mga05p37_310801_c1 nmdc:mga05p37_310801_c1_1195_1491 78
445 3300050511 nmdc:mga08y16_2045143_c1 nmdc:mga08y16_2045143_c1_105_401 78
446 3300050511 nmdc:mga08y16_399536_c1 nmdc:mga08y16_399536_c1_96_392 78
447 3300050511 nmdc:mga08y16_569827_c1 nmdc:mga08y16_569827_c1_317_613 78
448 3300053077 Ga0495601_0560936 Ga0495601_0560936_105_401 78
449 3300053093 Ga0500651_0018416 Ga0500651_0018416_3530_3826 78
450 3300053139 Ga0500568_0005012 Ga0500568_0005012_3673_3969 78
451 3300053153 Ga0500616_0002597 Ga0500616_0002597_11457_11750 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05488

PAAR_motif

PAAR motif

62

112

0.92

PF05488

PAAR_motif

PAAR motif

7

64

0.82

Feature Viewer

pLDDT pTM Quality
46.35 0.32 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map