F446825
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 451 | 235 | 442 | 546 |
Family's Representative Sequence
| Representative Sequence | 3300039062|Ga0400483_240381|Ga0400483_240381_5154_7004 |
| Length | 616 |
| Sequence | LRFIRYPLWFRKLTLIVEIRTNIGSIHFATGPAAETTLGRAEQPVSSVIVYWLTTTGRLGYLAAHKGSAMKIALVQFNPVIGDFKHQCRRIVALAEKAKTRGCDLAVFPEMAVCGYPPKDLLDRTSFVEANRRTLDYLVNTVGGIGILLGYVAENPDPSGKPLLNGAVLFEDGHLLHQVHKQLLPTYDVFDERRHFEPGRPDLPYLYKGHRLGVTICEDVWNDKDVFANRLYDVDPIDYLAKNGMDVLINIAASPFHIGKVDFRDHMLSTIAAKHQLPVLFVNQVGGNDQLLFDGASTVFSADGRVLARAEDFVEDLIVFDTQRMHGDMHHLTENRHDSVFKALVMGTRDYVTKCGFKTAVIGLSGGIDSALTACIAAEALGAENVSTVFMPSAYTSQENFEDTRQLARNLGLGYTIIPIDDIFGQFLHLLVPQADGADPGLTEQNIQARIRGTLLMGISNRDGCLVLSTGNKSELAVGYCTLYGDMNGGLAVISDVPKTMVYHLCRRINRKKEVIPQRIIDKPPSAELKPDQTDQDDLPPYEIIDPILEGYVEKSQSVHTLVDAGFDPTVVKEVIRRVDQNEYKRHQAAPGLKVTPKAFGEGRRYPLAKRFRPIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 2 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 3 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 4 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 5 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 6 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 7 | 2913912277 | Desmonostoc muscorum LEGE 12446 | Isolate | Unclassified |
| 8 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 134 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 137 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 140 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 141 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 142 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 143 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 145 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 149 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 162 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 163 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 164 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 165 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 166 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 167 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 168 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 169 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 172 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 194 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 195 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 196 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 216 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 231 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 232 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 233 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98 |
| Metatranscriptomes | 0 |
| Isolates | 2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.67 |
| Nodule | 0 |
| Rhizoplane | 0.89 |
| Rhizosphere | 92.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10006010 | 3300005290 | Bacteria | 3641 |
| 2 | Ga0070676_10010608 | 3300005328 | Bacteria | 4999 |
| 3 | Ga0070683_100000041 | 3300005329 | Bacteria | 116748 |
| 4 | Ga0070683_100003485 | 3300005329 | Bacteria | 12789 |
| 5 | Ga0070683_100064949 | 3300005329 | Bacteria | 3398 |
| 6 | Ga0070690_100002754 | 3300005330 | Bacteria | 9491 |
| 7 | Ga0070690_100014702 | 3300005330 | Bacteria | 4648 |
| 8 | Ga0070670_100050461 | 3300005331 | Bacteria | 3575 |
| 9 | Ga0070680_100011166 | 3300005336 | Bacteria | 6948 |
| 10 | Ga0070660_100027507 | 3300005339 | Bacteria | 4245 |
| 11 | Ga0070660_100066140 | 3300005339 | Bacteria | 2813 |
| 12 | Ga0070689_100081662 | 3300005340 | Bacteria | 2538 |
| 13 | Ga0070661_100046557 | 3300005344 | Bacteria | 3173 |
| 14 | Ga0070668_100038865 | 3300005347 | Bacteria | 3639 |
| 15 | Ga0070669_100003153 | 3300005353 | Bacteria | 11853 |
| 16 | Ga0070675_100000453 | 3300005354 | Bacteria | 28021 |
| 17 | Ga0070671_100012531 | 3300005355 | Bacteria | 6827 |
| 18 | Ga0070674_100024593 | 3300005356 | Bacteria | 3911 |
| 19 | Ga0070688_100003250 | 3300005365 | Bacteria | 8327 |
| 20 | Ga0070667_100004658 | 3300005367 | Bacteria | 11508 |
| 21 | Ga0070667_100032926 | 3300005367 | Bacteria | 4326 |
| 22 | Ga0070714_100037396 | 3300005435 | Unclassified | 4079 |
| 23 | Ga0070713_100015825 | 3300005436 | Bacteria | 5653 |
| 24 | Ga0070713_100035749 | 3300005436 | Bacteria | 4002 |
| 25 | Ga0070713_100042071 | 3300005436 | Bacteria | 3726 |
| 26 | Ga0070713_100060280 | 3300005436 | Bacteria | 3172 |
| 27 | Ga0070711_100010558 | 3300005439 | Bacteria | 5718 |
| 28 | Ga0070705_100003696 | 3300005440 | Bacteria | 7492 |
| 29 | Ga0070700_100099182 | 3300005441 | Bacteria | 1916 |
| 30 | Ga0070708_100002693 | 3300005445 | Bacteria | 13771 |
| 31 | Ga0070678_100119484 | 3300005456 | Bacteria | 2076 |
| 32 | Ga0070681_10001296 | 3300005458 | Bacteria | 21812 |
| 33 | Ga0068867_100033147 | 3300005459 | Bacteria | 3738 |
| 34 | Ga0070706_100003186 | 3300005467 | Bacteria | 16199 |
| 35 | Ga0070706_100031277 | 3300005467 | Bacteria | 4908 |
| 36 | Ga0070707_100000129 | 3300005468 | Bacteria | 70911 |
| 37 | Ga0070707_100000947 | 3300005468 | Bacteria | 28788 |
| 38 | Ga0070707_100005109 | 3300005468 | Bacteria | 12306 |
| 39 | Ga0070707_100042689 | 3300005468 | Unclassified | 4342 |
| 40 | Ga0070698_100055851 | 3300005471 | Bacteria | 4002 |
| 41 | Ga0070698_100064735 | 3300005471 | Bacteria | 3682 |
| 42 | Ga0070698_100092790 | 3300005471 | Bacteria | 3000 |
| 43 | Ga0070698_100105004 | 3300005471 | Bacteria | 2795 |
| 44 | Ga0070699_100004292 | 3300005518 | Bacteria | 12598 |
| 45 | Ga0070699_100154284 | 3300005518 | Bacteria | 2032 |
| 46 | Ga0070699_100181526 | 3300005518 | Unclassified | 1868 |
| 47 | Ga0070679_100004541 | 3300005530 | Bacteria | 12816 |
| 48 | Ga0070684_100000029 | 3300005535 | Bacteria | 116370 |
| 49 | Ga0070684_100090846 | 3300005535 | Bacteria | 2716 |
| 50 | Ga0070697_100000215 | 3300005536 | Bacteria | 47439 |
| 51 | Ga0068853_100017153 | 3300005539 | Bacteria | 5975 |
| 52 | Ga0070672_100138898 | 3300005543 | Bacteria | 2003 |
| 53 | Ga0070686_100001994 | 3300005544 | Bacteria | 11324 |
| 54 | Ga0070695_100006421 | 3300005545 | Bacteria | 6952 |
| 55 | Ga0070696_100044569 | 3300005546 | Bacteria | 3071 |
| 56 | Ga0070665_100232555 | 3300005548 | Bacteria | 1843 |
| 57 | Ga0070704_100027336 | 3300005549 | Bacteria | 3782 |
| 58 | Ga0068855_100009306 | 3300005563 | Bacteria | 11862 |
| 59 | Ga0068855_100081652 | 3300005563 | Bacteria | 3747 |
| 60 | Ga0068857_100000258 | 3300005577 | Bacteria | 35751 |
| 61 | Ga0068854_100001865 | 3300005578 | Bacteria | 12844 |
| 62 | Ga0068856_100026067 | 3300005614 | Bacteria | 5700 |
| 63 | Ga0070702_100026023 | 3300005615 | Bacteria | 3140 |
| 64 | Ga0068852_100020317 | 3300005616 | Bacteria | 5280 |
| 65 | Ga0068859_100049794 | 3300005617 | Bacteria | 4208 |
| 66 | Ga0068866_10017338 | 3300005718 | Bacteria | 3238 |
| 67 | Ga0068861_100016441 | 3300005719 | Bacteria | 5236 |
| 68 | Ga0068858_100001969 | 3300005842 | Bacteria | 20982 |
| 69 | Ga0068858_100034578 | 3300005842 | Bacteria | 4688 |
| 70 | Ga0068858_100068726 | 3300005842 | Bacteria | 3283 |
| 71 | Ga0068858_100144165 | 3300005842 | Bacteria | 2237 |
| 72 | Ga0068860_100079364 | 3300005843 | Bacteria | 3121 |
| 73 | Ga0068862_100082995 | 3300005844 | Bacteria | 2782 |
| 74 | Ga0081539_10002859 | 3300005985 | Bacteria | 22960 |
| 75 | Ga0070717_10000622 | 3300006028 | Bacteria | 22798 |
| 76 | Ga0070717_10041065 | 3300006028 | Bacteria | 3770 |
| 77 | Ga0070712_100073980 | 3300006175 | Bacteria | 2446 |
| 78 | Ga0097621_100012115 | 3300006237 | Bacteria | 6380 |
| 79 | Ga0097621_100020407 | 3300006237 | Bacteria | 5105 |
| 80 | Ga0097621_100057030 | 3300006237 | Bacteria | 3192 |
| 81 | Ga0097621_100093101 | 3300006237 | Bacteria | 2525 |
| 82 | Ga0068871_100001883 | 3300006358 | Bacteria | 14191 |
| 83 | Ga0075433_10000310 | 3300006852 | Bacteria | 29590 |
| 84 | Ga0075433_10060373 | 3300006852 | Bacteria | 3319 |
| 85 | Ga0075434_100000326 | 3300006871 | Bacteria | 34180 |
| 86 | Ga0075434_100000966 | 3300006871 | Bacteria | 23172 |
| 87 | Ga0075434_100006572 | 3300006871 | Bacteria | 10663 |
| 88 | Ga0075434_100072350 | 3300006871 | Bacteria | 3440 |
| 89 | Ga0075436_100002847 | 3300006914 | Bacteria | 11849 |
| 90 | Ga0075436_100003971 | 3300006914 | Bacteria | 10138 |
| 91 | Ga0075436_100029174 | 3300006914 | Bacteria | 3794 |
| 92 | Ga0097620_100049797 | 3300006931 | Bacteria | 4208 |
| 93 | Ga0075435_100000020 | 3300007076 | Bacteria | 91240 |
| 94 | Ga0075435_100001632 | 3300007076 | Bacteria | 14522 |
| 95 | Ga0075435_100006343 | 3300007076 | Bacteria | 8356 |
| 96 | Ga0075435_100025399 | 3300007076 | Bacteria | 4612 |
| 97 | Ga0075435_100089695 | 3300007076 | Bacteria | 2535 |
| 98 | Ga0105240_10004037 | 3300009093 | Bacteria | 22586 |
| 99 | Ga0105240_10010414 | 3300009093 | Bacteria | 13068 |
| 100 | Ga0105240_10013598 | 3300009093 | Bacteria | 11167 |
| 101 | Ga0105240_10016014 | 3300009093 | Bacteria | 10165 |
| 102 | Ga0105240_10018794 | 3300009093 | Bacteria | 9259 |
| 103 | Ga0105240_10051569 | 3300009093 | Bacteria | 5175 |
| 104 | Ga0105240_10107795 | 3300009093 | Bacteria | 3377 |
| 105 | Ga0105245_10000754 | 3300009098 | Bacteria | 29261 |
| 106 | Ga0105245_10001068 | 3300009098 | Bacteria | 24840 |
| 107 | Ga0105245_10016565 | 3300009098 | Bacteria | 6431 |
| 108 | Ga0114129_10012769 | 3300009147 | Bacteria | 11955 |
| 109 | Ga0114129_10013906 | 3300009147 | Bacteria | 11466 |
| 110 | Ga0114129_10020263 | 3300009147 | Bacteria | 9463 |
| 111 | Ga0114129_10023072 | 3300009147 | Bacteria | 8828 |
| 112 | Ga0114129_10023484 | 3300009147 | Bacteria | 8742 |
| 113 | Ga0114129_10025400 | 3300009147 | Bacteria | 8394 |
| 114 | Ga0114129_10025859 | 3300009147 | Bacteria | 8313 |
| 115 | Ga0114129_10156529 | 3300009147 | Bacteria | 3115 |
| 116 | Ga0105243_10034082 | 3300009148 | Bacteria | 3939 |
| 117 | Ga0105243_10145511 | 3300009148 | Bacteria | 2027 |
| 118 | Ga0105241_10004476 | 3300009174 | Bacteria | 10334 |
| 119 | Ga0105242_10001588 | 3300009176 | Bacteria | 17868 |
| 120 | Ga0105242_10109190 | 3300009176 | Bacteria | 2355 |
| 121 | Ga0105248_10003926 | 3300009177 | Bacteria | 16437 |
| 122 | Ga0105248_10007502 | 3300009177 | Bacteria | 11965 |
| 123 | Ga0105248_10035321 | 3300009177 | Bacteria | 5591 |
| 124 | Ga0105248_10036629 | 3300009177 | Bacteria | 5487 |
| 125 | Ga0105248_10064650 | 3300009177 | Bacteria | 4107 |
| 126 | Ga0105237_10005980 | 3300009545 | Bacteria | 13633 |
| 127 | Ga0105237_10010302 | 3300009545 | Bacteria | 9959 |
| 128 | Ga0105237_10098974 | 3300009545 | Bacteria | 2908 |
| 129 | Ga0105237_10189082 | 3300009545 | Bacteria | 2059 |
| 130 | Ga0105238_10000501 | 3300009551 | Bacteria | 41211 |
| 131 | Ga0105238_10007557 | 3300009551 | Bacteria | 10888 |
| 132 | Ga0105238_10014073 | 3300009551 | Bacteria | 8088 |
| 133 | Ga0105238_10015567 | 3300009551 | Bacteria | 7700 |
| 134 | Ga0105238_10016962 | 3300009551 | Bacteria | 7390 |
| 135 | Ga0105238_10019109 | 3300009551 | Bacteria | 6981 |
| 136 | Ga0105238_10024586 | 3300009551 | Bacteria | 6140 |
| 137 | Ga0105249_10003665 | 3300009553 | Bacteria | 13245 |
| 138 | Ga0105239_10002493 | 3300010375 | Bacteria | 23445 |
| 139 | Ga0105239_10020834 | 3300010375 | Bacteria | 7233 |
| 140 | Ga0105239_10060157 | 3300010375 | Bacteria | 4169 |
| 141 | Ga0105246_10008582 | 3300011119 | Bacteria | 6282 |
| 142 | Ga0105246_10009440 | 3300011119 | Bacteria | 6011 |
| 143 | Ga0157370_10007929 | 3300013104 | Bacteria | 11499 |
| 144 | Ga0157370_10009793 | 3300013104 | Bacteria | 10163 |
| 145 | Ga0157370_10111571 | 3300013104 | Bacteria | 2556 |
| 146 | Ga0157369_10005007 | 3300013105 | Bacteria | 15517 |
| 147 | Ga0157369_10013273 | 3300013105 | Bacteria | 9322 |
| 148 | Ga0157369_10020027 | 3300013105 | Bacteria | 7483 |
| 149 | Ga0157369_10023126 | 3300013105 | Bacteria | 6925 |
| 150 | Ga0157369_10098931 | 3300013105 | Bacteria | 3110 |
| 151 | Ga0157374_10043802 | 3300013296 | Bacteria | 4135 |
| 152 | Ga0157374_10074965 | 3300013296 | Bacteria | 3197 |
| 153 | Ga0157374_10126985 | 3300013296 | Bacteria | 2465 |
| 154 | Ga0157372_10001007 | 3300013307 | Bacteria | 30798 |
| 155 | Ga0157375_10147477 | 3300013308 | Bacteria | 2485 |
| 156 | Ga0163163_10004379 | 3300014325 | Bacteria | 12032 |
| 157 | Ga0163163_10009916 | 3300014325 | Bacteria | 8540 |
| 158 | Ga0163163_10035080 | 3300014325 | Bacteria | 4864 |
| 159 | Ga0163163_10078769 | 3300014325 | Bacteria | 3293 |
| 160 | Ga0157380_10014366 | 3300014326 | Bacteria | 5792 |
| 161 | Ga0157377_10032374 | 3300014745 | Bacteria | 2847 |
| 162 | Ga0157379_10019180 | 3300014968 | Bacteria | 6039 |
| 163 | Ga0157376_10042491 | 3300014969 | Bacteria | 3725 |
| 164 | Ga0157376_10132899 | 3300014969 | Bacteria | 2223 |
| 165 | Ga0213875_10027126 | 3300021388 | Bacteria | 2725 |
| 166 | Ga0207645_10003184 | 3300025907 | Bacteria | 12557 |
| 167 | Ga0207684_10026953 | 3300025910 | Bacteria | 4900 |
| 168 | Ga0207684_10051837 | 3300025910 | Bacteria | 3481 |
| 169 | Ga0207707_10000919 | 3300025912 | Bacteria | 28619 |
| 170 | Ga0207707_10021120 | 3300025912 | Bacteria | 5689 |
| 171 | Ga0207695_10001615 | 3300025913 | Bacteria | 36561 |
| 172 | Ga0207695_10007350 | 3300025913 | Bacteria | 14059 |
| 173 | Ga0207695_10011965 | 3300025913 | Bacteria | 10445 |
| 174 | Ga0207695_10047847 | 3300025913 | Bacteria | 4521 |
| 175 | Ga0207695_10081330 | 3300025913 | Bacteria | 3278 |
| 176 | Ga0207671_10005560 | 3300025914 | Bacteria | 11577 |
| 177 | Ga0207671_10066673 | 3300025914 | Bacteria | 2680 |
| 178 | Ga0207663_10028581 | 3300025916 | Bacteria | 3265 |
| 179 | Ga0207663_10038601 | 3300025916 | Bacteria | 2888 |
| 180 | Ga0207660_10007720 | 3300025917 | Bacteria | 6963 |
| 181 | Ga0207660_10151673 | 3300025917 | Bacteria | 1781 |
| 182 | Ga0207657_10021904 | 3300025919 | Bacteria | 6001 |
| 183 | Ga0207657_10053005 | 3300025919 | Bacteria | 3517 |
| 184 | Ga0207652_10003735 | 3300025921 | Bacteria | 12493 |
| 185 | Ga0207646_10000012 | 3300025922 | Bacteria | 367049 |
| 186 | Ga0207646_10000046 | 3300025922 | Bacteria | 177239 |
| 187 | Ga0207646_10078582 | 3300025922 | Unclassified | 2949 |
| 188 | Ga0207681_10053578 | 3300025923 | Bacteria | 2739 |
| 189 | Ga0207694_10001532 | 3300025924 | Bacteria | 19669 |
| 190 | Ga0207694_10006159 | 3300025924 | Bacteria | 9166 |
| 191 | Ga0207694_10106192 | 3300025924 | Bacteria | 2230 |
| 192 | Ga0207659_10000106 | 3300025926 | Bacteria | 49900 |
| 193 | Ga0207687_10000849 | 3300025927 | Bacteria | 20665 |
| 194 | Ga0207687_10003798 | 3300025927 | Bacteria | 10152 |
| 195 | Ga0207687_10006990 | 3300025927 | Bacteria | 7435 |
| 196 | Ga0207700_10047690 | 3300025928 | Bacteria | 3177 |
| 197 | Ga0207664_10061534 | 3300025929 | Bacteria | 2995 |
| 198 | Ga0207644_10034834 | 3300025931 | Bacteria | 3524 |
| 199 | Ga0207686_10046700 | 3300025934 | Bacteria | 2673 |
| 200 | Ga0207709_10040555 | 3300025935 | Bacteria | 2788 |
| 201 | Ga0207670_10099535 | 3300025936 | Bacteria | 2074 |
| 202 | Ga0207669_10014742 | 3300025937 | Bacteria | 3924 |
| 203 | Ga0207704_10001950 | 3300025938 | Bacteria | 9242 |
| 204 | Ga0207665_10015170 | 3300025939 | Bacteria | 5061 |
| 205 | Ga0207711_10003941 | 3300025941 | Bacteria | 12768 |
| 206 | Ga0207711_10035967 | 3300025941 | Bacteria | 4200 |
| 207 | Ga0207711_10074096 | 3300025941 | Bacteria | 2960 |
| 208 | Ga0207711_10079558 | 3300025941 | Bacteria | 2862 |
| 209 | Ga0207661_10000040 | 3300025944 | Bacteria | 126775 |
| 210 | Ga0207661_10020775 | 3300025944 | Bacteria | 4913 |
| 211 | Ga0207661_10051405 | 3300025944 | Unclassified | 3288 |
| 212 | Ga0207661_10111089 | 3300025944 | Bacteria | 2318 |
| 213 | Ga0207667_10003475 | 3300025949 | Bacteria | 19447 |
| 214 | Ga0207667_10022451 | 3300025949 | Bacteria | 6970 |
| 215 | Ga0207667_10032728 | 3300025949 | Bacteria | 5597 |
| 216 | Ga0207640_10021448 | 3300025981 | Bacteria | 3850 |
| 217 | Ga0207658_10028715 | 3300025986 | Bacteria | 3921 |
| 218 | Ga0207703_10049222 | 3300026035 | Bacteria | 3406 |
| 219 | Ga0207703_10084451 | 3300026035 | Bacteria | 2655 |
| 220 | Ga0207708_10011209 | 3300026075 | Bacteria | 6672 |
| 221 | Ga0207702_10029858 | 3300026078 | Bacteria | 4539 |
| 222 | Ga0207702_10119295 | 3300026078 | Bacteria | 2358 |
| 223 | Ga0207641_10000875 | 3300026088 | Bacteria | 31527 |
| 224 | Ga0207648_10012617 | 3300026089 | Bacteria | 7904 |
| 225 | Ga0207648_10039599 | 3300026089 | Bacteria | 4144 |
| 226 | Ga0207648_10073615 | 3300026089 | Bacteria | 2977 |
| 227 | Ga0207674_10000035 | 3300026116 | Bacteria | 136262 |
| 228 | Ga0207674_10001346 | 3300026116 | Bacteria | 31774 |
| 229 | Ga0207675_100015864 | 3300026118 | Bacteria | 7026 |
| 230 | Ga0207675_100026946 | 3300026118 | Bacteria | 5350 |
| 231 | Ga0207698_10004118 | 3300026142 | Bacteria | 8833 |
| 232 | Ga0207698_10031916 | 3300026142 | Bacteria | 3809 |
| 233 | Ga0207428_10004967 | 3300027907 | Bacteria | 12518 |
| 234 | Ga0268266_10010036 | 3300028379 | Bacteria | 8308 |
| 235 | Ga0268264_10041437 | 3300028381 | Bacteria | 3809 |
| 236 | Ga0268264_10059144 | 3300028381 | Bacteria | 3210 |
| 237 | Ga0265338_10002394 | 3300028800 | Bacteria | 28230 |
| 238 | Ga0265338_10016701 | 3300028800 | Bacteria | 7955 |
| 239 | Ga0265325_10046997 | 3300031241 | Bacteria | 2236 |
| 240 | Ga0265329_10008667 | 3300031242 | Bacteria | 3841 |
| 241 | Ga0265316_10008312 | 3300031344 | Bacteria | 9635 |
| 242 | Ga0265316_10011238 | 3300031344 | Bacteria | 8095 |
| 243 | Ga0265316_10024360 | 3300031344 | Bacteria | 5073 |
| 244 | Ga0316579_10019636 | 3300031691 | Bacteria | 2988 |
| 245 | Ga0265314_10001766 | 3300031711 | Bacteria | 23337 |
| 246 | Ga0265314_10002451 | 3300031711 | Bacteria | 18978 |
| 247 | Ga0265342_10067695 | 3300031712 | Bacteria | 2089 |
| 248 | Ga0316576_10068544 | 3300031727 | Bacteria | 2614 |
| 249 | Ga0316578_10004118 | 3300031728 | Bacteria | 6807 |
| 250 | Ga0316577_10000636 | 3300031733 | Bacteria | 14588 |
| 251 | Ga0316577_10041306 | 3300031733 | Bacteria | 2580 |
| 252 | Ga0316577_10045363 | 3300031733 | Bacteria | 2457 |
| 253 | Ga0316577_10060556 | 3300031733 | Bacteria | 2113 |
| 254 | Ga0373930_0001110 | 3300034816 | Bacteria | 3908 |
| 255 | Ga0373948_0001264 | 3300034817 | Bacteria | 3456 |
| 256 | Ga0373929_0000371 | 3300035085 | Bacteria | 8435 |
| 257 | Ga0373934_0001281 | 3300035086 | Bacteria | 9142 |
| 258 | Ga0373949_0000394 | 3300035090 | Bacteria | 15275 |
| 259 | Ga0373951_0004663 | 3300035091 | Bacteria | 3243 |
| 260 | Ga0373952_0000554 | 3300035092 | Bacteria | 6577 |
| 261 | Ga0373932_0005619 | 3300035112 | Bacteria | 2949 |
| 262 | Ga0373941_0001988 | 3300035115 | Bacteria | 4425 |
| 263 | Ga0373953_0008813 | 3300035117 | Bacteria | 3441 |
| 264 | Ga0373954_0003669 | 3300035118 | Bacteria | 6539 |
| 265 | Ga0373943_0040884 | 3300035170 | Bacteria | 2240 |
| 266 | Ga0373955_0036930 | 3300035172 | Bacteria | 2596 |
| 267 | Ga0373955_0057901 | 3300035172 | Unclassified | 2130 |
| 268 | Ga0373942_0000347 | 3300035207 | Bacteria | 12673 |
| 269 | Ga0373961_0001167 | 3300035241 | Bacteria | 8204 |
| 270 | Ga0373927_0047855 | 3300035695 | Bacteria | 2766 |
| 271 | Ga0373937_0012516 | 3300036401 | Bacteria | 7466 |
| 272 | Ga0373937_0111782 | 3300036401 | Bacteria | 2541 |
| 273 | Ga0316584_0000596 | 3300036712 | Bacteria | 19602 |
| 274 | Ga0316584_0049638 | 3300036712 | Bacteria | 3137 |
| 275 | Ga0436364_0231727 | 3300037853 | Bacteria | 7968 |
| 276 | Ga0436364_0304215 | 3300037853 | Bacteria | 4299 |
| 277 | Ga0400490_06663 | 3300038726 | Bacteria | 42094 |
| 278 | Ga0400490_07766 | 3300038726 | Bacteria | 2956 |
| 279 | Ga0400490_08242 | 3300038726 | Bacteria | 2647 |
| 280 | Ga0400485_07095 | 3300038735 | Bacteria | 2499 |
| 281 | Ga0400488_01912 | 3300038741 | Bacteria | 6324 |
| 282 | Ga0400488_38307 | 3300038741 | Bacteria | 10070 |
| 283 | Ga0400486_16635 | 3300038742 | Bacteria | 11856 |
| 284 | Ga0400486_20766 | 3300038742 | Bacteria | 91783 |
| 285 | Ga0400486_27056 | 3300038742 | Bacteria | 9105 |
| 286 | Ga0400483_043696 | 3300039062 | Bacteria | 7381 |
| 287 | Ga0400483_145628 | 3300039062 | Bacteria | 7144 |
| 288 | Ga0400483_240381 | 3300039062 | Bacteria | 35578 |
| 289 | Ga0400489_14732 | 3300039093 | Bacteria | 38869 |
| 290 | Ga0400489_32976 | 3300039093 | Bacteria | 10440 |
| 291 | Ga0400487_03922 | 3300039110 | Bacteria | 2356 |
| 292 | Ga0400487_59477 | 3300039110 | Bacteria | 4973 |
| 293 | Ga0451577_0000157 | 3300042876 | Bacteria | 151953 |
| 294 | Ga0451577_0000313 | 3300042876 | Bacteria | 92642 |
| 295 | Ga0453683_0008191 | 3300044673 | Bacteria | 7032 |
| 296 | Ga0453683_0025102 | 3300044673 | Bacteria | 3788 |
| 297 | Ga0453684_0000205 | 3300044712 | Bacteria | 257921 |
| 298 | Ga0453684_0000324 | 3300044712 | Bacteria | 201431 |
| 299 | Ga0453684_0000992 | 3300044712 | Bacteria | 92625 |
| 300 | Ga0453684_0003182 | 3300044712 | Bacteria | 37655 |
| 301 | Ga0453684_0027381 | 3300044712 | Bacteria | 8177 |
| 302 | Ga0453684_0032355 | 3300044712 | Bacteria | 7323 |
| 303 | Ga0453684_0041169 | 3300044712 | Bacteria | 6255 |
| 304 | Ga0453684_0337897 | 3300044712 | Bacteria | 1701 |
| 305 | Ga0451576_0003464 | 3300045051 | Bacteria | 21627 |
| 306 | Ga0451576_0009194 | 3300045051 | Bacteria | 11481 |
| 307 | Ga0451576_0021291 | 3300045051 | Bacteria | 7048 |
| 308 | Ga0451576_0033374 | 3300045051 | Bacteria | 5471 |
| 309 | Ga0451576_0037517 | 3300045051 | Bacteria | 5132 |
| 310 | Ga0451576_0126756 | 3300045051 | Bacteria | 2660 |
| 311 | Ga0451576_0241324 | 3300045051 | Bacteria | 1888 |
| 312 | Ga0495592_0047298 | 3300046454 | Bacteria | 3204 |
| 313 | Ga0495592_0095772 | 3300046454 | Bacteria | 2122 |
| 314 | Ga0495603_0053257 | 3300046455 | Bacteria | 2401 |
| 315 | Ga0495651_0028553 | 3300046462 | Bacteria | 4346 |
| 316 | Ga0495651_0107820 | 3300046462 | Unclassified | 2063 |
| 317 | Ga0495580_0000349 | 3300046472 | Bacteria | 37675 |
| 318 | Ga0495580_0000506 | 3300046472 | Bacteria | 32778 |
| 319 | Ga0495580_0002637 | 3300046472 | Bacteria | 15580 |
| 320 | Ga0495580_0039051 | 3300046472 | Bacteria | 3397 |
| 321 | Ga0495580_0051791 | 3300046472 | Unclassified | 2901 |
| 322 | Ga0495594_0065897 | 3300046499 | Bacteria | 2009 |
| 323 | Ga0495628_0057151 | 3300046516 | Bacteria | 3070 |
| 324 | Ga0495630_0006972 | 3300046517 | Bacteria | 8057 |
| 325 | Ga0495630_0010930 | 3300046517 | Bacteria | 6558 |
| 326 | Ga0495587_0004248 | 3300046536 | Bacteria | 9471 |
| 327 | Ga0495587_0028863 | 3300046536 | Bacteria | 3370 |
| 328 | Ga0495587_0081448 | 3300046536 | Bacteria | 1876 |
| 329 | Ga0495645_0030120 | 3300046543 | Bacteria | 3952 |
| 330 | Ga0495667_0018866 | 3300046559 | Bacteria | 4658 |
| 331 | Ga0495634_0031435 | 3300046642 | Bacteria | 3657 |
| 332 | Ga0495588_0071044 | 3300046674 | Bacteria | 1810 |
| 333 | Ga0495599_0002284 | 3300046678 | Bacteria | 11157 |
| 334 | Ga0495599_0003107 | 3300046678 | Bacteria | 9674 |
| 335 | Ga0495646_0106128 | 3300046680 | Bacteria | 1604 |
| 336 | Ga0495669_0002783 | 3300046684 | Bacteria | 7167 |
| 337 | Ga0495613_0000186 | 3300046689 | Bacteria | 60855 |
| 338 | Ga0495613_0118409 | 3300046689 | Bacteria | 1904 |
| 339 | Ga0495624_0072257 | 3300046690 | Bacteria | 2146 |
| 340 | Ga0495604_0008852 | 3300047317 | Bacteria | 7955 |
| 341 | Ga0495674_0100850 | 3300047319 | Bacteria | 2456 |
| 342 | Ga0495674_0203234 | 3300047319 | Bacteria | 1643 |
| 343 | Ga0495684_0000099 | 3300047471 | Bacteria | 60765 |
| 344 | Ga0495684_0017345 | 3300047471 | Bacteria | 5541 |
| 345 | Ga0495684_0062730 | 3300047471 | Unclassified | 2826 |
| 346 | Ga0495602_0003694 | 3300048088 | Bacteria | 15877 |
| 347 | Ga0495602_0109987 | 3300048088 | Bacteria | 2241 |
| 348 | Ga0496110_0101850 | 3300048913 | Bacteria | 2575 |
| 349 | Ga0496112_0067306 | 3300048915 | Bacteria | 3535 |
| 350 | Ga0496112_0091837 | 3300048915 | Bacteria | 3005 |
| 351 | Ga0496115_0080650 | 3300048918 | Bacteria | 2650 |
| 352 | Ga0501032_0008415 | 3300049569 | Bacteria | 7525 |
| 353 | Ga0501032_0013706 | 3300049569 | Bacteria | 5756 |
| 354 | Ga0501032_0024886 | 3300049569 | Bacteria | 4130 |
| 355 | Ga0501033_0002456 | 3300049570 | Bacteria | 15747 |
| 356 | Ga0501033_0003979 | 3300049570 | Bacteria | 11974 |
| 357 | Ga0501033_0021247 | 3300049570 | Bacteria | 4896 |
| 358 | Ga0501034_0005216 | 3300049571 | Bacteria | 14256 |
| 359 | Ga0501034_0030202 | 3300049571 | Bacteria | 5508 |
| 360 | Ga0501034_0038968 | 3300049571 | Bacteria | 4813 |
| 361 | Ga0501036_0002351 | 3300049572 | Bacteria | 14792 |
| 362 | Ga0501036_0006207 | 3300049572 | Bacteria | 9696 |
| 363 | Ga0501036_0022833 | 3300049572 | Bacteria | 5267 |
| 364 | Ga0501036_0067667 | 3300049572 | Bacteria | 3022 |
| 365 | Ga0501037_0001676 | 3300049573 | Bacteria | 16112 |
| 366 | Ga0501037_0006021 | 3300049573 | Bacteria | 8850 |
| 367 | Ga0501038_0010776 | 3300049574 | Bacteria | 8356 |
| 368 | Ga0501038_0065146 | 3300049574 | Bacteria | 3105 |
| 369 | Ga0501038_0113746 | 3300049574 | Bacteria | 2239 |
| 370 | Ga0501039_0004195 | 3300049575 | Bacteria | 10850 |
| 371 | Ga0501039_0041404 | 3300049575 | Bacteria | 3558 |
| 372 | Ga0501042_0024787 | 3300049578 | Bacteria | 4210 |
| 373 | Ga0501043_0002980 | 3300049579 | Bacteria | 14101 |
| 374 | Ga0501043_0024628 | 3300049579 | Bacteria | 4721 |
| 375 | Ga0501043_0049088 | 3300049579 | Bacteria | 3317 |
| 376 | Ga0501046_0001842 | 3300049580 | Bacteria | 20196 |
| 377 | Ga0501046_0002495 | 3300049580 | Bacteria | 17229 |
| 378 | Ga0501046_0013593 | 3300049580 | Bacteria | 6886 |
| 379 | Ga0501047_0001243 | 3300049581 | Bacteria | 25247 |
| 380 | Ga0501047_0029953 | 3300049581 | Bacteria | 5246 |
| 381 | Ga0501047_0059876 | 3300049581 | Bacteria | 3676 |
| 382 | Ga0501047_0062673 | 3300049581 | Bacteria | 3586 |
| 383 | Ga0501048_0018920 | 3300049582 | Bacteria | 5061 |
| 384 | Ga0501067_0050387 | 3300049583 | Bacteria | 2307 |
| 385 | Ga0501068_0001579 | 3300049584 | Bacteria | 12112 |
| 386 | Ga0501068_0003583 | 3300049584 | Bacteria | 8388 |
| 387 | Ga0501069_0000718 | 3300049585 | Bacteria | 15422 |
| 388 | Ga0501069_0002944 | 3300049585 | Bacteria | 8749 |
| 389 | Ga0501069_0014465 | 3300049585 | Bacteria | 4220 |
| 390 | Ga0501070_0003319 | 3300049586 | Bacteria | 13973 |
| 391 | Ga0501072_0074765 | 3300049588 | Bacteria | 2679 |
| 392 | Ga0501072_0236174 | 3300049588 | Bacteria | 1456 |
| 393 | Ga0501073_0011305 | 3300049589 | Bacteria | 6531 |
| 394 | Ga0501073_0017403 | 3300049589 | Bacteria | 5206 |
| 395 | Ga0501073_0045216 | 3300049589 | Bacteria | 3101 |
| 396 | Ga0501073_0047194 | 3300049589 | Bacteria | 3027 |
| 397 | Ga0501074_0002287 | 3300049590 | Bacteria | 13328 |
| 398 | Ga0501074_0009003 | 3300049590 | Bacteria | 7247 |
| 399 | Ga0501261_002301 | 3300049690 | Bacteria | 2343 |
| 400 | Ga0501079_0007353 | 3300049741 | Bacteria | 8326 |
| 401 | Ga0501080_0004813 | 3300049742 | Bacteria | 12037 |
| 402 | Ga0501080_0117203 | 3300049742 | Bacteria | 2468 |
| 403 | Ga0501083_0000834 | 3300049744 | Bacteria | 20259 |
| 404 | Ga0501083_0010683 | 3300049744 | Bacteria | 6459 |
| 405 | Ga0501083_0021220 | 3300049744 | Bacteria | 4514 |
| 406 | Ga0501035_0002423 | 3300049822 | Bacteria | 18234 |
| 407 | Ga0501035_0052854 | 3300049822 | Bacteria | 3634 |
| 408 | Ga0501044_0022206 | 3300049823 | Bacteria | 6762 |
| 409 | Ga0501044_0028166 | 3300049823 | Bacteria | 5930 |
| 410 | Ga0501044_0063178 | 3300049823 | Bacteria | 3784 |
| 411 | Ga0501044_0085715 | 3300049823 | Bacteria | 3182 |
| 412 | Ga0501045_0011006 | 3300049824 | Bacteria | 6340 |
| 413 | nmdc:mga05p37_114780_c1 | 3300050507 | Bacteria | 3311 |
| 414 | nmdc:mga05p37_32975_c1 | 3300050507 | Bacteria | 6341 |
| 415 | nmdc:mga05p37_87908_c1 | 3300050507 | Bacteria | 3831 |
| 416 | nmdc:mga09592_229460_c1 | 3300050508 | Bacteria | 1608 |
| 417 | nmdc:mga08y16_20523_c1 | 3300050511 | Bacteria | 6974 |
| 418 | nmdc:mga0n895_38672_c1 | 3300050512 | Bacteria | 4624 |
| 419 | nmdc:mga0n895_40821_c1 | 3300050512 | Bacteria | 4509 |
| 420 | nmdc:mga0n895_5873_c1 | 3300050512 | Bacteria | 10316 |
| 421 | nmdc:mga0n895_80_c1 | 3300050512 | Bacteria | 54788 |
| 422 | nmdc:mga0rr50_11329_c1 | 3300050513 | Bacteria | 5704 |
| 423 | nmdc:mga0rr50_2469_c1 | 3300050513 | Bacteria | 10443 |
| 424 | nmdc:mga0rr50_35_c1 | 3300050513 | Bacteria | 91254 |
| 425 | nmdc:mga0rr50_53951_c1 | 3300050513 | Bacteria | 2992 |
| 426 | nmdc:mga08x19_3873_c1 | 3300050514 | Bacteria | 8905 |
| 427 | nmdc:mga08x19_64_c1 | 3300050514 | Bacteria | 24706 |
| 428 | nmdc:mga08x19_798_c1 | 3300050514 | Bacteria | 20114 |
| 429 | nmdc:mga0a205_520_c1 | 3300050515 | Bacteria | 30274 |
| 430 | nmdc:mga0a205_8057_c1 | 3300050515 | Bacteria | 7677 |
| 431 | nmdc:mga0a205_88144_c1 | 3300050515 | Bacteria | 2999 |
| 432 | Ga0495619_0001935 | 3300053085 | Bacteria | 13808 |
| 433 | Ga0495619_0094236 | 3300053085 | Bacteria | 2031 |
| 434 | Ga0500555_002401 | 3300053103 | Bacteria | 5443 |
| 435 | Ga0500616_0000787 | 3300053153 | Bacteria | 36341 |
| 436 | Ga0500645_000802 | 3300053730 | Bacteria | 18860 |
| 437 | Ga0501084_0007873 | 3300054114 | Bacteria | 8772 |
| 438 | Ga0501084_0035692 | 3300054114 | Bacteria | 4156 |
| 439 | Ga0501082_0000020 | 3300060353 | Bacteria | 109889 |
| 440 | Ga0501082_0001859 | 3300060353 | Bacteria | 18564 |
| 441 | Ga0501082_0011056 | 3300060353 | Bacteria | 7761 |
| 442 | Ga0501082_0065531 | 3300060353 | Bacteria | 3128 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0059876 | Ga0501047_0059876_2309_3652 | 437 |
| 2 | 3300049588 | Ga0501072_0236174 | Ga0501072_0236174_92_1435 | 437 |
| 3 | 3300049823 | Ga0501044_0085715 | Ga0501044_0085715_25_1368 | 437 |
| 4 | 3300046536 | Ga0495587_0081448 | Ga0495587_0081448_20_1351 | 441 |
| 5 | 3300014325 | Ga0163163_10004379 | Ga0163163_100043798 | 448 |
| 6 | 3300050508 | nmdc:mga09592_229460_c1 | nmdc:mga09592_229460_c1_100_1590 | 495 |
| 7 | 3300005617 | Ga0068859_100049794 | Ga0068859_1000497944 | 498 |
| 8 | 3300006931 | Ga0097620_100049797 | Ga0097620_1000497973 | 498 |
| 9 | 3300028381 | Ga0268264_10041437 | Ga0268264_100414372 | 498 |
| 10 | 3300046680 | Ga0495646_0106128 | Ga0495646_0106128_64_1566 | 498 |
| 11 | 3300025916 | Ga0207663_10028581 | Ga0207663_100285812 | 499 |
| 12 | 3300025916 | Ga0207663_10038601 | Ga0207663_100386012 | 505 |
| 13 | 3300005436 | Ga0070713_100035749 | Ga0070713_1000357492 | 506 |
| 14 | 3300005439 | Ga0070711_100010558 | Ga0070711_1000105583 | 506 |
| 15 | 3300028800 | Ga0265338_10016701 | Ga0265338_100167016 | 506 |
| 16 | 3300047319 | Ga0495674_0203234 | Ga0495674_0203234_26_1552 | 506 |
| 17 | 3300006237 | Ga0097621_100093101 | Ga0097621_1000931012 | 507 |
| 18 | 3300013296 | Ga0157374_10074965 | Ga0157374_100749653 | 509 |
| 19 | 3300006175 | Ga0070712_100073980 | Ga0070712_1000739802 | 516 |
| 20 | 3300009176 | Ga0105242_10109190 | Ga0105242_101091902 | 516 |
| 21 | 3300025934 | Ga0207686_10046700 | Ga0207686_100467002 | 516 |
| 22 | 3300005445 | Ga0070708_100002693 | Ga0070708_1000026935 | 517 |
| 23 | 3300005467 | Ga0070706_100003186 | Ga0070706_1000031868 | 517 |
| 24 | 3300005536 | Ga0070697_100000215 | Ga0070697_10000021527 | 517 |
| 25 | 3300009551 | Ga0105238_10000501 | Ga0105238_1000050116 | 517 |
| 26 | 3300010375 | Ga0105239_10002493 | Ga0105239_1000249316 | 517 |
| 27 | 3300031711 | Ga0265314_10002451 | Ga0265314_100024513 | 517 |
| 28 | 3300046472 | Ga0495580_0051791 | Ga0495580_0051791_1305_2882 | 517 |
| 29 | 3300046499 | Ga0495594_0065897 | Ga0495594_0065897_142_1701 | 517 |
| 30 | 3300046642 | Ga0495634_0031435 | Ga0495634_0031435_2034_3593 | 517 |
| 31 | 3300046674 | Ga0495588_0071044 | Ga0495588_0071044_163_1722 | 517 |
| 32 | 3300037853 | Ga0436364_0304215 | Ga0436364_0304215_12_1586 | 522 |
| 33 | 3300053085 | Ga0495619_0094236 | Ga0495619_0094236_12_1610 | 522 |
| 34 | 3300005436 | Ga0070713_100060280 | Ga0070713_1000602801 | 524 |
| 35 | 3300025928 | Ga0207700_10047690 | Ga0207700_100476901 | 524 |
| 36 | 3300031728 | Ga0316578_10004118 | Ga0316578_100041183 | 526 |
| 37 | 3300044712 | Ga0453684_0041169 | Ga0453684_0041169_1417_3045 | 526 |
| 38 | 3300006914 | Ga0075436_100029174 | Ga0075436_1000291742 | 528 |
| 39 | 3300009093 | Ga0105240_10013598 | Ga0105240_100135984 | 528 |
| 40 | 3300009098 | Ga0105245_10000754 | Ga0105245_100007542 | 528 |
| 41 | 3300009148 | Ga0105243_10145511 | Ga0105243_101455112 | 528 |
| 42 | 3300009174 | Ga0105241_10004476 | Ga0105241_100044765 | 528 |
| 43 | 3300009177 | Ga0105248_10003926 | Ga0105248_1000392615 | 528 |
| 44 | 3300009551 | Ga0105238_10007557 | Ga0105238_100075577 | 528 |
| 45 | 3300009551 | Ga0105238_10014073 | Ga0105238_100140732 | 528 |
| 46 | 3300009551 | Ga0105238_10016962 | Ga0105238_100169625 | 528 |
| 47 | 3300011119 | Ga0105246_10008582 | Ga0105246_100085826 | 528 |
| 48 | 3300026116 | Ga0207674_10001346 | Ga0207674_1000134623 | 528 |
| 49 | 3300050514 | nmdc:mga08x19_798_c1 | nmdc:mga08x19_798_c1_17285_18919 | 528 |
| 50 | 3300060353 | Ga0501082_0000020 | Ga0501082_0000020_21164_22756 | 528 |
| 51 | 3300009147 | Ga0114129_10023072 | Ga0114129_100230726 | 532 |
| 52 | 3300028800 | Ga0265338_10002394 | Ga0265338_1000239413 | 532 |
| 53 | 3300049569 | Ga0501032_0024886 | Ga0501032_0024886_1232_2929 | 532 |
| 54 | 3300049571 | Ga0501034_0038968 | Ga0501034_0038968_3098_4795 | 532 |
| 55 | 3300049575 | Ga0501039_0004195 | Ga0501039_0004195_774_2471 | 532 |
| 56 | 3300049580 | Ga0501046_0013593 | Ga0501046_0013593_3221_4918 | 532 |
| 57 | 3300049581 | Ga0501047_0029953 | Ga0501047_0029953_873_2570 | 532 |
| 58 | 3300049584 | Ga0501068_0003583 | Ga0501068_0003583_840_2537 | 532 |
| 59 | 3300049585 | Ga0501069_0014465 | Ga0501069_0014465_1355_3052 | 532 |
| 60 | 3300049823 | Ga0501044_0063178 | Ga0501044_0063178_39_1736 | 532 |
| 61 | 3300005331 | Ga0070670_100050461 | Ga0070670_1000504612 | 534 |
| 62 | 3300005340 | Ga0070689_100081662 | Ga0070689_1000816621 | 535 |
| 63 | 3300009147 | Ga0114129_10013906 | Ga0114129_100139065 | 535 |
| 64 | 3300009545 | Ga0105237_10098974 | Ga0105237_100989743 | 535 |
| 65 | 3300025936 | Ga0207670_10099535 | Ga0207670_100995352 | 535 |
| 66 | 3300037853 | Ga0436364_0231727 | Ga0436364_0231727_4601_6214 | 535 |
| 67 | 3300046517 | Ga0495630_0006972 | Ga0495630_0006972_116_1729 | 535 |
| 68 | 3300047471 | Ga0495684_0017345 | Ga0495684_0017345_891_2504 | 535 |
| 69 | 3300050511 | nmdc:mga08y16_20523_c1 | nmdc:mga08y16_20523_c1_2805_4451 | 535 |
| 70 | iso_pu_bacteria | 2617270889 | 2617914711 | 535 |
| 71 | iso_pu_bacteria | 2831426010 | 2831428320 | 535 |
| 72 | iso_pu_bacteria | 2848694841 | 2848698482 | 535 |
| 73 | iso_pu_bacteria | 2849660919 | 2849664261 | 535 |
| 74 | iso_pu_bacteria | 2886627955 | 2886629030 | 535 |
| 75 | iso_pu_bacteria | 2913912277 | 2913914623 | 535 |
| 76 | iso_pu_bacteria | 642555144 | 642604632 | 535 |
| 77 | 3300007076 | Ga0075435_100006343 | Ga0075435_1000063433 | 536 |
| 78 | 3300044712 | Ga0453684_0027381 | Ga0453684_0027381_2348_4090 | 536 |
| 79 | 3300049572 | Ga0501036_0067667 | Ga0501036_0067667_523_2220 | 536 |
| 80 | 3300050512 | nmdc:mga0n895_40821_c1 | nmdc:mga0n895_40821_c1_2332_3972 | 536 |
| 81 | 3300050513 | nmdc:mga0rr50_11329_c1 | nmdc:mga0rr50_11329_c1_1455_3095 | 536 |
| 82 | 3300050515 | nmdc:mga0a205_88144_c1 | nmdc:mga0a205_88144_c1_237_1877 | 536 |
| 83 | 3300005467 | Ga0070706_100031277 | Ga0070706_1000312774 | 537 |
| 84 | 3300005468 | Ga0070707_100000129 | Ga0070707_10000012929 | 537 |
| 85 | 3300005468 | Ga0070707_100000947 | Ga0070707_1000009478 | 537 |
| 86 | 3300005471 | Ga0070698_100055851 | Ga0070698_1000558514 | 537 |
| 87 | 3300005471 | Ga0070698_100064735 | Ga0070698_1000647354 | 537 |
| 88 | 3300005548 | Ga0070665_100232555 | Ga0070665_1002325552 | 537 |
| 89 | 3300009093 | Ga0105240_10051569 | Ga0105240_100515692 | 537 |
| 90 | 3300010375 | Ga0105239_10020834 | Ga0105239_100208344 | 537 |
| 91 | 3300025910 | Ga0207684_10051837 | Ga0207684_100518374 | 537 |
| 92 | 3300025913 | Ga0207695_10047847 | Ga0207695_100478473 | 537 |
| 93 | 3300025922 | Ga0207646_10000012 | Ga0207646_10000012206 | 537 |
| 94 | 3300025922 | Ga0207646_10000046 | Ga0207646_10000046123 | 537 |
| 95 | 3300028379 | Ga0268266_10010036 | Ga0268266_100100364 | 537 |
| 96 | 3300031242 | Ga0265329_10008667 | Ga0265329_100086673 | 537 |
| 97 | 3300031691 | Ga0316579_10019636 | Ga0316579_100196363 | 537 |
| 98 | 3300044673 | Ga0453683_0008191 | Ga0453683_0008191_487_2124 | 537 |
| 99 | 3300044712 | Ga0453684_0000205 | Ga0453684_0000205_228054_229706 | 537 |
| 100 | 3300044712 | Ga0453684_0032355 | Ga0453684_0032355_2031_3668 | 537 |
| 101 | 3300044712 | Ga0453684_0337897 | Ga0453684_0337897_19_1656 | 537 |
| 102 | 3300045051 | Ga0451576_0241324 | Ga0451576_0241324_89_1726 | 537 |
| 103 | 3300049823 | Ga0501044_0028166 | Ga0501044_0028166_3034_4731 | 537 |
| 104 | 3300005435 | Ga0070714_100037396 | Ga0070714_1000373963 | 538 |
| 105 | 3300005436 | Ga0070713_100042071 | Ga0070713_1000420712 | 538 |
| 106 | 3300005468 | Ga0070707_100005109 | Ga0070707_1000051099 | 538 |
| 107 | 3300005468 | Ga0070707_100042689 | Ga0070707_1000426892 | 538 |
| 108 | 3300006028 | Ga0070717_10000622 | Ga0070717_100006223 | 538 |
| 109 | 3300006852 | Ga0075433_10000310 | Ga0075433_1000031019 | 538 |
| 110 | 3300006871 | Ga0075434_100000966 | Ga0075434_10000096619 | 538 |
| 111 | 3300025910 | Ga0207684_10026953 | Ga0207684_100269531 | 538 |
| 112 | 3300025922 | Ga0207646_10078582 | Ga0207646_100785822 | 538 |
| 113 | 3300025939 | Ga0207665_10015170 | Ga0207665_100151704 | 538 |
| 114 | 3300031727 | Ga0316576_10068544 | Ga0316576_100685442 | 538 |
| 115 | 3300031733 | Ga0316577_10041306 | Ga0316577_100413062 | 538 |
| 116 | 3300031733 | Ga0316577_10045363 | Ga0316577_100453631 | 538 |
| 117 | 3300031733 | Ga0316577_10060556 | Ga0316577_100605561 | 538 |
| 118 | 3300036712 | Ga0316584_0049638 | Ga0316584_0049638_1051_2793 | 538 |
| 119 | 3300038726 | Ga0400490_06663 | Ga0400490_06663_31465_33117 | 538 |
| 120 | 3300038726 | Ga0400490_07766 | Ga0400490_07766_700_2343 | 538 |
| 121 | 3300038726 | Ga0400490_08242 | Ga0400490_08242_801_2450 | 538 |
| 122 | 3300038735 | Ga0400485_07095 | Ga0400485_07095_778_2421 | 538 |
| 123 | 3300038741 | Ga0400488_01912 | Ga0400488_01912_2950_4599 | 538 |
| 124 | 3300038741 | Ga0400488_38307 | Ga0400488_38307_2101_3747 | 538 |
| 125 | 3300038742 | Ga0400486_16635 | Ga0400486_16635_2712_4355 | 538 |
| 126 | 3300038742 | Ga0400486_20766 | Ga0400486_20766_28239_29888 | 538 |
| 127 | 3300038742 | Ga0400486_27056 | Ga0400486_27056_6787_8430 | 538 |
| 128 | 3300039062 | Ga0400483_043696 | Ga0400483_043696_1984_3624 | 538 |
| 129 | 3300039062 | Ga0400483_145628 | Ga0400483_145628_5454_7103 | 538 |
| 130 | 3300039062 | Ga0400483_240381 | Ga0400483_240381_5154_7004 | 538 |
| 131 | 3300039093 | Ga0400489_14732 | Ga0400489_14732_34227_36005 | 538 |
| 132 | 3300039093 | Ga0400489_32976 | Ga0400489_32976_1428_3071 | 538 |
| 133 | 3300039110 | Ga0400487_03922 | Ga0400487_03922_230_1876 | 538 |
| 134 | 3300039110 | Ga0400487_59477 | Ga0400487_59477_509_2158 | 538 |
| 135 | 3300042876 | Ga0451577_0000157 | Ga0451577_0000157_140862_142502 | 538 |
| 136 | 3300044673 | Ga0453683_0025102 | Ga0453683_0025102_172_1836 | 538 |
| 137 | 3300044712 | Ga0453684_0000324 | Ga0453684_0000324_164544_166184 | 538 |
| 138 | 3300045051 | Ga0451576_0003464 | Ga0451576_0003464_2695_4413 | 538 |
| 139 | 3300045051 | Ga0451576_0021291 | Ga0451576_0021291_1178_2818 | 538 |
| 140 | 3300045051 | Ga0451576_0033374 | Ga0451576_0033374_194_1858 | 538 |
| 141 | 3300046472 | Ga0495580_0000349 | Ga0495580_0000349_11579_13219 | 538 |
| 142 | 3300048915 | Ga0496112_0067306 | Ga0496112_0067306_1765_3420 | 538 |
| 143 | 3300050512 | nmdc:mga0n895_5873_c1 | nmdc:mga0n895_5873_c1_3185_4825 | 538 |
| 144 | 3300050513 | nmdc:mga0rr50_2469_c1 | nmdc:mga0rr50_2469_c1_5491_7131 | 538 |
| 145 | 3300050515 | nmdc:mga0a205_520_c1 | nmdc:mga0a205_520_c1_25485_27125 | 538 |
| 146 | 3300006028 | Ga0070717_10041065 | Ga0070717_100410654 | 539 |
| 147 | iso_pu_bacteria | 2913844669 | 2913851421 | 539 |
| 148 | iso_pu_bacteria | 2913939268 | 2913945195 | 539 |
| 149 | 3300031711 | Ga0265314_10001766 | Ga0265314_1000176613 | 540 |
| 150 | 3300031733 | Ga0316577_10000636 | Ga0316577_100006365 | 540 |
| 151 | 3300036712 | Ga0316584_0000596 | Ga0316584_0000596_16692_18356 | 540 |
| 152 | 3300042876 | Ga0451577_0000313 | Ga0451577_0000313_52172_53836 | 540 |
| 153 | 3300044712 | Ga0453684_0000992 | Ga0453684_0000992_38790_40454 | 540 |
| 154 | 3300046690 | Ga0495624_0072257 | Ga0495624_0072257_27_1685 | 541 |
| 155 | 3300049569 | Ga0501032_0008415 | Ga0501032_0008415_2798_4495 | 541 |
| 156 | 3300049571 | Ga0501034_0005216 | Ga0501034_0005216_10250_11947 | 541 |
| 157 | 3300049574 | Ga0501038_0113746 | Ga0501038_0113746_436_2133 | 541 |
| 158 | 3300049575 | Ga0501039_0041404 | Ga0501039_0041404_862_2559 | 541 |
| 159 | 3300049580 | Ga0501046_0002495 | Ga0501046_0002495_527_2224 | 541 |
| 160 | 3300049589 | Ga0501073_0047194 | Ga0501073_0047194_25_1722 | 541 |
| 161 | 3300049742 | Ga0501080_0004813 | Ga0501080_0004813_7901_9598 | 541 |
| 162 | 3300060353 | Ga0501082_0065531 | Ga0501082_0065531_1305_3002 | 541 |
| 163 | 3300005329 | Ga0070683_100000041 | Ga0070683_10000004145 | 542 |
| 164 | 3300005329 | Ga0070683_100003485 | Ga0070683_1000034854 | 542 |
| 165 | 3300005330 | Ga0070690_100002754 | Ga0070690_1000027548 | 542 |
| 166 | 3300005336 | Ga0070680_100011166 | Ga0070680_1000111664 | 542 |
| 167 | 3300005339 | Ga0070660_100066140 | Ga0070660_1000661402 | 542 |
| 168 | 3300005344 | Ga0070661_100046557 | Ga0070661_1000465572 | 542 |
| 169 | 3300005458 | Ga0070681_10001296 | Ga0070681_1000129618 | 542 |
| 170 | 3300005530 | Ga0070679_100004541 | Ga0070679_1000045414 | 542 |
| 171 | 3300005535 | Ga0070684_100000029 | Ga0070684_10000002960 | 542 |
| 172 | 3300005535 | Ga0070684_100090846 | Ga0070684_1000908462 | 542 |
| 173 | 3300005539 | Ga0068853_100017153 | Ga0068853_1000171534 | 542 |
| 174 | 3300005563 | Ga0068855_100009306 | Ga0068855_1000093065 | 542 |
| 175 | 3300005563 | Ga0068855_100081652 | Ga0068855_1000816523 | 542 |
| 176 | 3300005577 | Ga0068857_100000258 | Ga0068857_10000025827 | 542 |
| 177 | 3300005614 | Ga0068856_100026067 | Ga0068856_1000260674 | 542 |
| 178 | 3300005616 | Ga0068852_100020317 | Ga0068852_1000203173 | 542 |
| 179 | 3300005842 | Ga0068858_100034578 | Ga0068858_1000345782 | 542 |
| 180 | 3300005842 | Ga0068858_100068726 | Ga0068858_1000687262 | 542 |
| 181 | 3300006237 | Ga0097621_100057030 | Ga0097621_1000570302 | 542 |
| 182 | 3300009093 | Ga0105240_10010414 | Ga0105240_100104148 | 542 |
| 183 | 3300009093 | Ga0105240_10016014 | Ga0105240_100160147 | 542 |
| 184 | 3300009093 | Ga0105240_10018794 | Ga0105240_100187942 | 542 |
| 185 | 3300009098 | Ga0105245_10001068 | Ga0105245_1000106820 | 542 |
| 186 | 3300009098 | Ga0105245_10016565 | Ga0105245_100165652 | 542 |
| 187 | 3300009177 | Ga0105248_10007502 | Ga0105248_100075025 | 542 |
| 188 | 3300009545 | Ga0105237_10010302 | Ga0105237_100103028 | 542 |
| 189 | 3300009545 | Ga0105237_10189082 | Ga0105237_101890822 | 542 |
| 190 | 3300009551 | Ga0105238_10015567 | Ga0105238_100155672 | 542 |
| 191 | 3300009551 | Ga0105238_10019109 | Ga0105238_100191093 | 542 |
| 192 | 3300009553 | Ga0105249_10003665 | Ga0105249_100036657 | 542 |
| 193 | 3300011119 | Ga0105246_10009440 | Ga0105246_100094404 | 542 |
| 194 | 3300013104 | Ga0157370_10007929 | Ga0157370_100079296 | 542 |
| 195 | 3300013104 | Ga0157370_10009793 | Ga0157370_100097933 | 542 |
| 196 | 3300013104 | Ga0157370_10111571 | Ga0157370_101115712 | 542 |
| 197 | 3300013105 | Ga0157369_10005007 | Ga0157369_1000500713 | 542 |
| 198 | 3300013105 | Ga0157369_10013273 | Ga0157369_100132731 | 542 |
| 199 | 3300013105 | Ga0157369_10020027 | Ga0157369_100200275 | 542 |
| 200 | 3300013105 | Ga0157369_10023126 | Ga0157369_100231262 | 542 |
| 201 | 3300013105 | Ga0157369_10098931 | Ga0157369_100989312 | 542 |
| 202 | 3300013307 | Ga0157372_10001007 | Ga0157372_1000100719 | 542 |
| 203 | 3300013308 | Ga0157375_10147477 | Ga0157375_101474772 | 542 |
| 204 | 3300014325 | Ga0163163_10009916 | Ga0163163_100099166 | 542 |
| 205 | 3300014325 | Ga0163163_10035080 | Ga0163163_100350803 | 542 |
| 206 | 3300021388 | Ga0213875_10027126 | Ga0213875_100271262 | 542 |
| 207 | 3300025912 | Ga0207707_10000919 | Ga0207707_1000091918 | 542 |
| 208 | 3300025913 | Ga0207695_10001615 | Ga0207695_1000161517 | 542 |
| 209 | 3300025913 | Ga0207695_10007350 | Ga0207695_1000735010 | 542 |
| 210 | 3300025913 | Ga0207695_10011965 | Ga0207695_100119654 | 542 |
| 211 | 3300025914 | Ga0207671_10066673 | Ga0207671_100666732 | 542 |
| 212 | 3300025917 | Ga0207660_10007720 | Ga0207660_100077204 | 542 |
| 213 | 3300025919 | Ga0207657_10021904 | Ga0207657_100219042 | 542 |
| 214 | 3300025921 | Ga0207652_10003735 | Ga0207652_100037354 | 542 |
| 215 | 3300025924 | Ga0207694_10001532 | Ga0207694_1000153217 | 542 |
| 216 | 3300025924 | Ga0207694_10006159 | Ga0207694_100061597 | 542 |
| 217 | 3300025924 | Ga0207694_10106192 | Ga0207694_101061922 | 542 |
| 218 | 3300025927 | Ga0207687_10000849 | Ga0207687_100008496 | 542 |
| 219 | 3300025927 | Ga0207687_10003798 | Ga0207687_100037984 | 542 |
| 220 | 3300025927 | Ga0207687_10006990 | Ga0207687_100069905 | 542 |
| 221 | 3300025929 | Ga0207664_10061534 | Ga0207664_100615342 | 542 |
| 222 | 3300025941 | Ga0207711_10003941 | Ga0207711_100039415 | 542 |
| 223 | 3300025944 | Ga0207661_10000040 | Ga0207661_1000004045 | 542 |
| 224 | 3300025944 | Ga0207661_10020775 | Ga0207661_100207752 | 542 |
| 225 | 3300025944 | Ga0207661_10051405 | Ga0207661_100514052 | 542 |
| 226 | 3300025944 | Ga0207661_10111089 | Ga0207661_101110891 | 542 |
| 227 | 3300025949 | Ga0207667_10003475 | Ga0207667_1000347517 | 542 |
| 228 | 3300025949 | Ga0207667_10022451 | Ga0207667_100224513 | 542 |
| 229 | 3300025949 | Ga0207667_10032728 | Ga0207667_100327282 | 542 |
| 230 | 3300026035 | Ga0207703_10049222 | Ga0207703_100492223 | 542 |
| 231 | 3300026035 | Ga0207703_10084451 | Ga0207703_100844512 | 542 |
| 232 | 3300026078 | Ga0207702_10119295 | Ga0207702_101192952 | 542 |
| 233 | 3300026116 | Ga0207674_10000035 | Ga0207674_1000003563 | 542 |
| 234 | 3300026142 | Ga0207698_10004118 | Ga0207698_100041184 | 542 |
| 235 | 3300026142 | Ga0207698_10031916 | Ga0207698_100319163 | 542 |
| 236 | 3300031241 | Ga0265325_10046997 | Ga0265325_100469972 | 542 |
| 237 | 3300031344 | Ga0265316_10008312 | Ga0265316_100083123 | 542 |
| 238 | 3300031344 | Ga0265316_10011238 | Ga0265316_100112383 | 542 |
| 239 | 3300031344 | Ga0265316_10024360 | Ga0265316_100243602 | 542 |
| 240 | 3300031712 | Ga0265342_10067695 | Ga0265342_100676952 | 542 |
| 241 | 3300035086 | Ga0373934_0001281 | Ga0373934_0001281_929_2563 | 542 |
| 242 | 3300035117 | Ga0373953_0008813 | Ga0373953_0008813_871_2505 | 542 |
| 243 | 3300035118 | Ga0373954_0003669 | Ga0373954_0003669_3326_4960 | 542 |
| 244 | 3300035172 | Ga0373955_0036930 | Ga0373955_0036930_259_1893 | 542 |
| 245 | 3300035172 | Ga0373955_0057901 | Ga0373955_0057901_268_1902 | 542 |
| 246 | 3300035695 | Ga0373927_0047855 | Ga0373927_0047855_1084_2718 | 542 |
| 247 | 3300036401 | Ga0373937_0012516 | Ga0373937_0012516_542_2176 | 542 |
| 248 | 3300036401 | Ga0373937_0111782 | Ga0373937_0111782_192_1826 | 542 |
| 249 | 3300045051 | Ga0451576_0126756 | Ga0451576_0126756_53_1687 | 542 |
| 250 | 3300046454 | Ga0495592_0047298 | Ga0495592_0047298_1539_3173 | 542 |
| 251 | 3300046454 | Ga0495592_0095772 | Ga0495592_0095772_94_1728 | 542 |
| 252 | 3300046462 | Ga0495651_0028553 | Ga0495651_0028553_1349_2983 | 542 |
| 253 | 3300046462 | Ga0495651_0107820 | Ga0495651_0107820_172_1806 | 542 |
| 254 | 3300046472 | Ga0495580_0000506 | Ga0495580_0000506_10859_12493 | 542 |
| 255 | 3300046472 | Ga0495580_0002637 | Ga0495580_0002637_1741_3375 | 542 |
| 256 | 3300046516 | Ga0495628_0057151 | Ga0495628_0057151_815_2473 | 542 |
| 257 | 3300046536 | Ga0495587_0004248 | Ga0495587_0004248_5138_6772 | 542 |
| 258 | 3300046559 | Ga0495667_0018866 | Ga0495667_0018866_179_1813 | 542 |
| 259 | 3300046678 | Ga0495599_0003107 | Ga0495599_0003107_3342_4976 | 542 |
| 260 | 3300046689 | Ga0495613_0118409 | Ga0495613_0118409_207_1841 | 542 |
| 261 | 3300047317 | Ga0495604_0008852 | Ga0495604_0008852_4270_5904 | 542 |
| 262 | 3300047319 | Ga0495674_0100850 | Ga0495674_0100850_62_1696 | 542 |
| 263 | 3300047471 | Ga0495684_0062730 | Ga0495684_0062730_205_1839 | 542 |
| 264 | 3300048088 | Ga0495602_0003694 | Ga0495602_0003694_3860_5494 | 542 |
| 265 | 3300048088 | Ga0495602_0109987 | Ga0495602_0109987_487_2121 | 542 |
| 266 | 3300048918 | Ga0496115_0080650 | Ga0496115_0080650_967_2601 | 542 |
| 267 | 3300049569 | Ga0501032_0013706 | Ga0501032_0013706_1244_2905 | 542 |
| 268 | 3300049570 | Ga0501033_0021247 | Ga0501033_0021247_2980_4641 | 542 |
| 269 | 3300049571 | Ga0501034_0030202 | Ga0501034_0030202_3171_4832 | 542 |
| 270 | 3300049572 | Ga0501036_0006207 | Ga0501036_0006207_3864_5525 | 542 |
| 271 | 3300049573 | Ga0501037_0001676 | Ga0501037_0001676_4801_6462 | 542 |
| 272 | 3300049578 | Ga0501042_0024787 | Ga0501042_0024787_859_2520 | 542 |
| 273 | 3300049579 | Ga0501043_0024628 | Ga0501043_0024628_1781_3442 | 542 |
| 274 | 3300049580 | Ga0501046_0001842 | Ga0501046_0001842_4831_6492 | 542 |
| 275 | 3300049581 | Ga0501047_0062673 | Ga0501047_0062673_1542_3203 | 542 |
| 276 | 3300049584 | Ga0501068_0001579 | Ga0501068_0001579_6303_7964 | 542 |
| 277 | 3300049585 | Ga0501069_0000718 | Ga0501069_0000718_12371_14032 | 542 |
| 278 | 3300049589 | Ga0501073_0011305 | Ga0501073_0011305_4168_5829 | 542 |
| 279 | 3300049590 | Ga0501074_0009003 | Ga0501074_0009003_993_2654 | 542 |
| 280 | 3300049741 | Ga0501079_0007353 | Ga0501079_0007353_4826_6487 | 542 |
| 281 | 3300049822 | Ga0501035_0052854 | Ga0501035_0052854_878_2539 | 542 |
| 282 | 3300049823 | Ga0501044_0022206 | Ga0501044_0022206_1414_3075 | 542 |
| 283 | 3300049824 | Ga0501045_0011006 | Ga0501045_0011006_432_2093 | 542 |
| 284 | 3300060353 | Ga0501082_0011056 | Ga0501082_0011056_921_2582 | 542 |
| 285 | 3300005456 | Ga0070678_100119484 | Ga0070678_1001194842 | 543 |
| 286 | 3300045051 | Ga0451576_0037517 | Ga0451576_0037517_818_2536 | 543 |
| 287 | 3300046472 | Ga0495580_0039051 | Ga0495580_0039051_1038_2675 | 543 |
| 288 | 3300046678 | Ga0495599_0002284 | Ga0495599_0002284_1739_3376 | 543 |
| 289 | 3300049570 | Ga0501033_0002456 | Ga0501033_0002456_11853_13514 | 543 |
| 290 | 3300049570 | Ga0501033_0003979 | Ga0501033_0003979_8982_10643 | 543 |
| 291 | 3300049572 | Ga0501036_0002351 | Ga0501036_0002351_4603_6264 | 543 |
| 292 | 3300049573 | Ga0501037_0006021 | Ga0501037_0006021_4517_6178 | 543 |
| 293 | 3300049574 | Ga0501038_0010776 | Ga0501038_0010776_5639_7300 | 543 |
| 294 | 3300049579 | Ga0501043_0049088 | Ga0501043_0049088_593_2254 | 543 |
| 295 | 3300049582 | Ga0501048_0018920 | Ga0501048_0018920_2063_3724 | 543 |
| 296 | 3300049583 | Ga0501067_0050387 | Ga0501067_0050387_480_2141 | 543 |
| 297 | 3300049585 | Ga0501069_0002944 | Ga0501069_0002944_1114_2775 | 543 |
| 298 | 3300049586 | Ga0501070_0003319 | Ga0501070_0003319_5168_6829 | 543 |
| 299 | 3300049589 | Ga0501073_0017403 | Ga0501073_0017403_3285_4946 | 543 |
| 300 | 3300049589 | Ga0501073_0045216 | Ga0501073_0045216_1364_3025 | 543 |
| 301 | 3300049590 | Ga0501074_0002287 | Ga0501074_0002287_7285_8946 | 543 |
| 302 | 3300049742 | Ga0501080_0117203 | Ga0501080_0117203_372_2033 | 543 |
| 303 | 3300049744 | Ga0501083_0021220 | Ga0501083_0021220_400_2061 | 543 |
| 304 | 3300049822 | Ga0501035_0002423 | Ga0501035_0002423_4190_5851 | 543 |
| 305 | 3300054114 | Ga0501084_0007873 | Ga0501084_0007873_4901_6562 | 543 |
| 306 | 3300060353 | Ga0501082_0001859 | Ga0501082_0001859_4485_6146 | 543 |
| 307 | 3300005329 | Ga0070683_100064949 | Ga0070683_1000649492 | 544 |
| 308 | 3300005436 | Ga0070713_100015825 | Ga0070713_1000158256 | 544 |
| 309 | 3300005518 | Ga0070699_100181526 | Ga0070699_1001815261 | 544 |
| 310 | 3300009093 | Ga0105240_10004037 | Ga0105240_1000403725 | 544 |
| 311 | 3300009177 | Ga0105248_10035321 | Ga0105248_100353211 | 544 |
| 312 | 3300009545 | Ga0105237_10005980 | Ga0105237_100059809 | 544 |
| 313 | 3300010375 | Ga0105239_10060157 | Ga0105239_100601572 | 544 |
| 314 | 3300013296 | Ga0157374_10126985 | Ga0157374_101269852 | 544 |
| 315 | 3300025914 | Ga0207671_10005560 | Ga0207671_100055602 | 544 |
| 316 | 3300025941 | Ga0207711_10035967 | Ga0207711_100359674 | 544 |
| 317 | 3300046684 | Ga0495669_0002783 | Ga0495669_0002783_1850_3502 | 544 |
| 318 | 3300049572 | Ga0501036_0022833 | Ga0501036_0022833_3449_5134 | 544 |
| 319 | 3300053103 | Ga0500555_002401 | Ga0500555_002401_3659_5338 | 544 |
| 320 | 3300053153 | Ga0500616_0000787 | Ga0500616_0000787_3666_5345 | 544 |
| 321 | 3300053730 | Ga0500645_000802 | Ga0500645_000802_13212_14891 | 544 |
| 322 | 3300005354 | Ga0070675_100000453 | Ga0070675_1000004539 | 545 |
| 323 | 3300005367 | Ga0070667_100032926 | Ga0070667_1000329266 | 545 |
| 324 | 3300005471 | Ga0070698_100105004 | Ga0070698_1001050042 | 545 |
| 325 | 3300005842 | Ga0068858_100144165 | Ga0068858_1001441652 | 545 |
| 326 | 3300009147 | Ga0114129_10012769 | Ga0114129_100127699 | 545 |
| 327 | 3300014745 | Ga0157377_10032374 | Ga0157377_100323741 | 545 |
| 328 | 3300025926 | Ga0207659_10000106 | Ga0207659_100001061 | 545 |
| 329 | 3300049579 | Ga0501043_0002980 | Ga0501043_0002980_1785_3476 | 545 |
| 330 | 3300049581 | Ga0501047_0001243 | Ga0501047_0001243_12889_14580 | 545 |
| 331 | 3300049588 | Ga0501072_0074765 | Ga0501072_0074765_614_2305 | 545 |
| 332 | 3300049744 | Ga0501083_0000834 | Ga0501083_0000834_14589_16280 | 545 |
| 333 | 3300049744 | Ga0501083_0010683 | Ga0501083_0010683_1808_3499 | 545 |
| 334 | 3300054114 | Ga0501084_0035692 | Ga0501084_0035692_603_2294 | 545 |
| 335 | 3300044712 | Ga0453684_0003182 | Ga0453684_0003182_30282_31949 | 546 |
| 336 | 3300046517 | Ga0495630_0010930 | Ga0495630_0010930_149_1816 | 546 |
| 337 | 3300046536 | Ga0495587_0028863 | Ga0495587_0028863_849_2516 | 546 |
| 338 | 3300046543 | Ga0495645_0030120 | Ga0495645_0030120_69_1736 | 546 |
| 339 | 3300046689 | Ga0495613_0000186 | Ga0495613_0000186_26450_28117 | 546 |
| 340 | 3300047471 | Ga0495684_0000099 | Ga0495684_0000099_47526_49193 | 546 |
| 341 | 3300049574 | Ga0501038_0065146 | Ga0501038_0065146_470_2167 | 546 |
| 342 | 3300053085 | Ga0495619_0001935 | Ga0495619_0001935_6816_8483 | 546 |
| 343 | 3300005328 | Ga0070676_10010608 | Ga0070676_100106084 | 547 |
| 344 | 3300005330 | Ga0070690_100014702 | Ga0070690_1000147024 | 547 |
| 345 | 3300005347 | Ga0070668_100038865 | Ga0070668_1000388652 | 547 |
| 346 | 3300005353 | Ga0070669_100003153 | Ga0070669_1000031539 | 547 |
| 347 | 3300005356 | Ga0070674_100024593 | Ga0070674_1000245933 | 547 |
| 348 | 3300005440 | Ga0070705_100003696 | Ga0070705_1000036964 | 547 |
| 349 | 3300005459 | Ga0068867_100033147 | Ga0068867_1000331474 | 547 |
| 350 | 3300005471 | Ga0070698_100092790 | Ga0070698_1000927903 | 547 |
| 351 | 3300005518 | Ga0070699_100154284 | Ga0070699_1001542842 | 547 |
| 352 | 3300005544 | Ga0070686_100001994 | Ga0070686_1000019943 | 547 |
| 353 | 3300005545 | Ga0070695_100006421 | Ga0070695_1000064216 | 547 |
| 354 | 3300005546 | Ga0070696_100044569 | Ga0070696_1000445692 | 547 |
| 355 | 3300005549 | Ga0070704_100027336 | Ga0070704_1000273362 | 547 |
| 356 | 3300005578 | Ga0068854_100001865 | Ga0068854_1000018656 | 547 |
| 357 | 3300005615 | Ga0070702_100026023 | Ga0070702_1000260233 | 547 |
| 358 | 3300005718 | Ga0068866_10017338 | Ga0068866_100173383 | 547 |
| 359 | 3300005719 | Ga0068861_100016441 | Ga0068861_1000164412 | 547 |
| 360 | 3300005844 | Ga0068862_100082995 | Ga0068862_1000829952 | 547 |
| 361 | 3300005985 | Ga0081539_10002859 | Ga0081539_100028597 | 547 |
| 362 | 3300006237 | Ga0097621_100020407 | Ga0097621_1000204072 | 547 |
| 363 | 3300006871 | Ga0075434_100000326 | Ga0075434_10000032635 | 547 |
| 364 | 3300006871 | Ga0075434_100006572 | Ga0075434_1000065724 | 547 |
| 365 | 3300006871 | Ga0075434_100072350 | Ga0075434_1000723503 | 547 |
| 366 | 3300006914 | Ga0075436_100002847 | Ga0075436_1000028478 | 547 |
| 367 | 3300007076 | Ga0075435_100000020 | Ga0075435_10000002053 | 547 |
| 368 | 3300007076 | Ga0075435_100001632 | Ga0075435_1000016327 | 547 |
| 369 | 3300007076 | Ga0075435_100089695 | Ga0075435_1000896952 | 547 |
| 370 | 3300009093 | Ga0105240_10107795 | Ga0105240_101077952 | 547 |
| 371 | 3300009147 | Ga0114129_10156529 | Ga0114129_101565292 | 547 |
| 372 | 3300009148 | Ga0105243_10034082 | Ga0105243_100340822 | 547 |
| 373 | 3300009176 | Ga0105242_10001588 | Ga0105242_1000158813 | 547 |
| 374 | 3300009177 | Ga0105248_10036629 | Ga0105248_100366294 | 547 |
| 375 | 3300014325 | Ga0163163_10078769 | Ga0163163_100787692 | 547 |
| 376 | 3300014326 | Ga0157380_10014366 | Ga0157380_100143666 | 547 |
| 377 | 3300014969 | Ga0157376_10042491 | Ga0157376_100424912 | 547 |
| 378 | 3300025907 | Ga0207645_10003184 | Ga0207645_1000318410 | 547 |
| 379 | 3300025913 | Ga0207695_10081330 | Ga0207695_100813303 | 547 |
| 380 | 3300025935 | Ga0207709_10040555 | Ga0207709_100405552 | 547 |
| 381 | 3300025937 | Ga0207669_10014742 | Ga0207669_100147422 | 547 |
| 382 | 3300025938 | Ga0207704_10001950 | Ga0207704_100019505 | 547 |
| 383 | 3300025941 | Ga0207711_10074096 | Ga0207711_100740963 | 547 |
| 384 | 3300025941 | Ga0207711_10079558 | Ga0207711_100795583 | 547 |
| 385 | 3300025981 | Ga0207640_10021448 | Ga0207640_100214482 | 547 |
| 386 | 3300026075 | Ga0207708_10011209 | Ga0207708_100112092 | 547 |
| 387 | 3300026078 | Ga0207702_10029858 | Ga0207702_100298584 | 547 |
| 388 | 3300026089 | Ga0207648_10012617 | Ga0207648_100126176 | 547 |
| 389 | 3300026089 | Ga0207648_10039599 | Ga0207648_100395994 | 547 |
| 390 | 3300026118 | Ga0207675_100015864 | Ga0207675_1000158649 | 547 |
| 391 | 3300026118 | Ga0207675_100026946 | Ga0207675_1000269462 | 547 |
| 392 | 3300027907 | Ga0207428_10004967 | Ga0207428_100049679 | 547 |
| 393 | 3300034816 | Ga0373930_0001110 | Ga0373930_0001110_1421_3064 | 547 |
| 394 | 3300034817 | Ga0373948_0001264 | Ga0373948_0001264_1309_2952 | 547 |
| 395 | 3300035085 | Ga0373929_0000371 | Ga0373929_0000371_3970_5613 | 547 |
| 396 | 3300035090 | Ga0373949_0000394 | Ga0373949_0000394_10301_11944 | 547 |
| 397 | 3300035091 | Ga0373951_0004663 | Ga0373951_0004663_1014_2657 | 547 |
| 398 | 3300035092 | Ga0373952_0000554 | Ga0373952_0000554_532_2175 | 547 |
| 399 | 3300035112 | Ga0373932_0005619 | Ga0373932_0005619_1156_2799 | 547 |
| 400 | 3300035115 | Ga0373941_0001988 | Ga0373941_0001988_1756_3399 | 547 |
| 401 | 3300035170 | Ga0373943_0040884 | Ga0373943_0040884_587_2230 | 547 |
| 402 | 3300035207 | Ga0373942_0000347 | Ga0373942_0000347_4864_6507 | 547 |
| 403 | 3300035241 | Ga0373961_0001167 | Ga0373961_0001167_4909_6552 | 547 |
| 404 | 3300045051 | Ga0451576_0009194 | Ga0451576_0009194_7335_8978 | 547 |
| 405 | 3300046455 | Ga0495603_0053257 | Ga0495603_0053257_630_2273 | 547 |
| 406 | 3300049690 | Ga0501261_002301 | Ga0501261_002301_168_1898 | 547 |
| 407 | 3300050512 | nmdc:mga0n895_38672_c1 | nmdc:mga0n895_38672_c1_2204_3847 | 547 |
| 408 | 3300050512 | nmdc:mga0n895_80_c1 | nmdc:mga0n895_80_c1_27225_28868 | 547 |
| 409 | 3300050513 | nmdc:mga0rr50_35_c1 | nmdc:mga0rr50_35_c1_35536_37179 | 547 |
| 410 | 3300050514 | nmdc:mga08x19_64_c1 | nmdc:mga08x19_64_c1_21179_22822 | 547 |
| 411 | 3300005290 | Ga0065712_10006010 | Ga0065712_100060102 | 548 |
| 412 | 3300005339 | Ga0070660_100027507 | Ga0070660_1000275072 | 548 |
| 413 | 3300005355 | Ga0070671_100012531 | Ga0070671_1000125313 | 548 |
| 414 | 3300005365 | Ga0070688_100003250 | Ga0070688_1000032505 | 548 |
| 415 | 3300005367 | Ga0070667_100004658 | Ga0070667_1000046589 | 548 |
| 416 | 3300005441 | Ga0070700_100099182 | Ga0070700_1000991822 | 548 |
| 417 | 3300005518 | Ga0070699_100004292 | Ga0070699_1000042925 | 548 |
| 418 | 3300005543 | Ga0070672_100138898 | Ga0070672_1001388982 | 548 |
| 419 | 3300005842 | Ga0068858_100001969 | Ga0068858_1000019695 | 548 |
| 420 | 3300005843 | Ga0068860_100079364 | Ga0068860_1000793642 | 548 |
| 421 | 3300006237 | Ga0097621_100012115 | Ga0097621_1000121155 | 548 |
| 422 | 3300006358 | Ga0068871_100001883 | Ga0068871_10000188315 | 548 |
| 423 | 3300006852 | Ga0075433_10060373 | Ga0075433_100603732 | 548 |
| 424 | 3300006914 | Ga0075436_100003971 | Ga0075436_1000039712 | 548 |
| 425 | 3300007076 | Ga0075435_100025399 | Ga0075435_1000253993 | 548 |
| 426 | 3300009147 | Ga0114129_10020263 | Ga0114129_100202637 | 548 |
| 427 | 3300009147 | Ga0114129_10023484 | Ga0114129_100234843 | 548 |
| 428 | 3300009147 | Ga0114129_10025400 | Ga0114129_100254006 | 548 |
| 429 | 3300009147 | Ga0114129_10025859 | Ga0114129_100258592 | 548 |
| 430 | 3300009177 | Ga0105248_10064650 | Ga0105248_100646504 | 548 |
| 431 | 3300009551 | Ga0105238_10024586 | Ga0105238_100245864 | 548 |
| 432 | 3300013296 | Ga0157374_10043802 | Ga0157374_100438024 | 548 |
| 433 | 3300014968 | Ga0157379_10019180 | Ga0157379_100191805 | 548 |
| 434 | 3300014969 | Ga0157376_10132899 | Ga0157376_101328991 | 548 |
| 435 | 3300025912 | Ga0207707_10021120 | Ga0207707_100211205 | 548 |
| 436 | 3300025917 | Ga0207660_10151673 | Ga0207660_101516731 | 548 |
| 437 | 3300025919 | Ga0207657_10053005 | Ga0207657_100530053 | 548 |
| 438 | 3300025923 | Ga0207681_10053578 | Ga0207681_100535782 | 548 |
| 439 | 3300025931 | Ga0207644_10034834 | Ga0207644_100348342 | 548 |
| 440 | 3300025986 | Ga0207658_10028715 | Ga0207658_100287153 | 548 |
| 441 | 3300026088 | Ga0207641_10000875 | Ga0207641_1000087523 | 548 |
| 442 | 3300026089 | Ga0207648_10073615 | Ga0207648_100736152 | 548 |
| 443 | 3300028381 | Ga0268264_10059144 | Ga0268264_100591442 | 548 |
| 444 | 3300048913 | Ga0496110_0101850 | Ga0496110_0101850_795_2441 | 548 |
| 445 | 3300048915 | Ga0496112_0091837 | Ga0496112_0091837_89_1762 | 548 |
| 446 | 3300050507 | nmdc:mga05p37_114780_c1 | nmdc:mga05p37_114780_c1_1411_3057 | 548 |
| 447 | 3300050507 | nmdc:mga05p37_32975_c1 | nmdc:mga05p37_32975_c1_3629_5275 | 548 |
| 448 | 3300050507 | nmdc:mga05p37_87908_c1 | nmdc:mga05p37_87908_c1_453_2099 | 548 |
| 449 | 3300050513 | nmdc:mga0rr50_53951_c1 | nmdc:mga0rr50_53951_c1_582_2228 | 548 |
| 450 | 3300050514 | nmdc:mga08x19_3873_c1 | nmdc:mga08x19_3873_c1_4485_6137 | 548 |
| 451 | 3300050515 | nmdc:mga0a205_8057_c1 | nmdc:mga0a205_8057_c1_1194_2840 | 548 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fiu-assembly2.cif.gz_D | structure of nmn synthetase from francisella tularensis | 0.9122 | 269 | 520 |
| 3p52-assembly1.cif.gz_A | nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion | 0.8972 | 269 | 519 |
| 3p52-assembly1.cif.gz_B | nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion | 0.8923 | 269 | 519 |
| 5ny2-assembly1.cif.gz_A | a c145a mutant of nesterenkonia an1 amidase from the nitrilase superfamily | 0.8866 | 1 | 254 |
| 2e18-assembly1.cif.gz_B | crystal structure of project ph0182 from pyrococcus horikoshii ot3 | 0.8849 | 260 | 520 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3n05B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9301 | 268 | 457 | 3.40.50.620 |
| 3n05B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9203 | 268 | 457 | 3.40.50.620 |
| 3n05B03 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9136 | 475 | 546 | 1.10.10.1510 |
| 3fiuC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9103 | 269 | 520 | 3.40.50.620 |
| af_Q58747_4_258_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8965 | 267 | 520 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534NNB0-F1-model_v4 | NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) | 0.9833 | 271 | 405 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-Q02BE0-F1-model_v4 | Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) | 0.9767 | 1 | 546 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-A0A2I0P0F2-F1-model_v4 | Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) | 0.9758 | 1 | 548 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
| AF-A0A842KDF8-F1-model_v4 | deleted | 0.9751 | 1 | 546 |
|
| AF-Q02BE0-F1-model_v4 | Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) | 0.9749 | 1 | 546 |
GO:0003952
GO:0004359 GO:0005524 GO:0005737 GO:0008795 GO:0009435 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar