F446825

General Info

Members Datasets Scaffolds Average Seq Length
451 235 442 546

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_240381|Ga0400483_240381_5154_7004
Length 616
Sequence LRFIRYPLWFRKLTLIVEIRTNIGSIHFATGPAAETTLGRAEQPVSSVIVYWLTTTGRLGYLAAHKGSAMKIALVQFNPVIGDFKHQCRRIVALAEKAKTRGCDLAVFPEMAVCGYPPKDLLDRTSFVEANRRTLDYLVNTVGGIGILLGYVAENPDPSGKPLLNGAVLFEDGHLLHQVHKQLLPTYDVFDERRHFEPGRPDLPYLYKGHRLGVTICEDVWNDKDVFANRLYDVDPIDYLAKNGMDVLINIAASPFHIGKVDFRDHMLSTIAAKHQLPVLFVNQVGGNDQLLFDGASTVFSADGRVLARAEDFVEDLIVFDTQRMHGDMHHLTENRHDSVFKALVMGTRDYVTKCGFKTAVIGLSGGIDSALTACIAAEALGAENVSTVFMPSAYTSQENFEDTRQLARNLGLGYTIIPIDDIFGQFLHLLVPQADGADPGLTEQNIQARIRGTLLMGISNRDGCLVLSTGNKSELAVGYCTLYGDMNGGLAVISDVPKTMVYHLCRRINRKKEVIPQRIIDKPPSAELKPDQTDQDDLPPYEIIDPILEGYVEKSQSVHTLVDAGFDPTVVKEVIRRVDQNEYKRHQAAPGLKVTPKAFGEGRRYPLAKRFRPIS

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 2831426010 Nostoc sp. 106C Isolate Unclassified
3 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
4 2849660919 Nostoc sp. T09 Isolate Unclassified
5 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
6 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
7 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
8 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
144 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
162 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
163 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
164 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
165 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
166 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
167 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 0
Isolates 2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 0.89
Rhizosphere 92.24
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10006010 3300005290 Bacteria 3641
2 Ga0070676_10010608 3300005328 Bacteria 4999
3 Ga0070683_100000041 3300005329 Bacteria 116748
4 Ga0070683_100003485 3300005329 Bacteria 12789
5 Ga0070683_100064949 3300005329 Bacteria 3398
6 Ga0070690_100002754 3300005330 Bacteria 9491
7 Ga0070690_100014702 3300005330 Bacteria 4648
8 Ga0070670_100050461 3300005331 Bacteria 3575
9 Ga0070680_100011166 3300005336 Bacteria 6948
10 Ga0070660_100027507 3300005339 Bacteria 4245
11 Ga0070660_100066140 3300005339 Bacteria 2813
12 Ga0070689_100081662 3300005340 Bacteria 2538
13 Ga0070661_100046557 3300005344 Bacteria 3173
14 Ga0070668_100038865 3300005347 Bacteria 3639
15 Ga0070669_100003153 3300005353 Bacteria 11853
16 Ga0070675_100000453 3300005354 Bacteria 28021
17 Ga0070671_100012531 3300005355 Bacteria 6827
18 Ga0070674_100024593 3300005356 Bacteria 3911
19 Ga0070688_100003250 3300005365 Bacteria 8327
20 Ga0070667_100004658 3300005367 Bacteria 11508
21 Ga0070667_100032926 3300005367 Bacteria 4326
22 Ga0070714_100037396 3300005435 Unclassified 4079
23 Ga0070713_100015825 3300005436 Bacteria 5653
24 Ga0070713_100035749 3300005436 Bacteria 4002
25 Ga0070713_100042071 3300005436 Bacteria 3726
26 Ga0070713_100060280 3300005436 Bacteria 3172
27 Ga0070711_100010558 3300005439 Bacteria 5718
28 Ga0070705_100003696 3300005440 Bacteria 7492
29 Ga0070700_100099182 3300005441 Bacteria 1916
30 Ga0070708_100002693 3300005445 Bacteria 13771
31 Ga0070678_100119484 3300005456 Bacteria 2076
32 Ga0070681_10001296 3300005458 Bacteria 21812
33 Ga0068867_100033147 3300005459 Bacteria 3738
34 Ga0070706_100003186 3300005467 Bacteria 16199
35 Ga0070706_100031277 3300005467 Bacteria 4908
36 Ga0070707_100000129 3300005468 Bacteria 70911
37 Ga0070707_100000947 3300005468 Bacteria 28788
38 Ga0070707_100005109 3300005468 Bacteria 12306
39 Ga0070707_100042689 3300005468 Unclassified 4342
40 Ga0070698_100055851 3300005471 Bacteria 4002
41 Ga0070698_100064735 3300005471 Bacteria 3682
42 Ga0070698_100092790 3300005471 Bacteria 3000
43 Ga0070698_100105004 3300005471 Bacteria 2795
44 Ga0070699_100004292 3300005518 Bacteria 12598
45 Ga0070699_100154284 3300005518 Bacteria 2032
46 Ga0070699_100181526 3300005518 Unclassified 1868
47 Ga0070679_100004541 3300005530 Bacteria 12816
48 Ga0070684_100000029 3300005535 Bacteria 116370
49 Ga0070684_100090846 3300005535 Bacteria 2716
50 Ga0070697_100000215 3300005536 Bacteria 47439
51 Ga0068853_100017153 3300005539 Bacteria 5975
52 Ga0070672_100138898 3300005543 Bacteria 2003
53 Ga0070686_100001994 3300005544 Bacteria 11324
54 Ga0070695_100006421 3300005545 Bacteria 6952
55 Ga0070696_100044569 3300005546 Bacteria 3071
56 Ga0070665_100232555 3300005548 Bacteria 1843
57 Ga0070704_100027336 3300005549 Bacteria 3782
58 Ga0068855_100009306 3300005563 Bacteria 11862
59 Ga0068855_100081652 3300005563 Bacteria 3747
60 Ga0068857_100000258 3300005577 Bacteria 35751
61 Ga0068854_100001865 3300005578 Bacteria 12844
62 Ga0068856_100026067 3300005614 Bacteria 5700
63 Ga0070702_100026023 3300005615 Bacteria 3140
64 Ga0068852_100020317 3300005616 Bacteria 5280
65 Ga0068859_100049794 3300005617 Bacteria 4208
66 Ga0068866_10017338 3300005718 Bacteria 3238
67 Ga0068861_100016441 3300005719 Bacteria 5236
68 Ga0068858_100001969 3300005842 Bacteria 20982
69 Ga0068858_100034578 3300005842 Bacteria 4688
70 Ga0068858_100068726 3300005842 Bacteria 3283
71 Ga0068858_100144165 3300005842 Bacteria 2237
72 Ga0068860_100079364 3300005843 Bacteria 3121
73 Ga0068862_100082995 3300005844 Bacteria 2782
74 Ga0081539_10002859 3300005985 Bacteria 22960
75 Ga0070717_10000622 3300006028 Bacteria 22798
76 Ga0070717_10041065 3300006028 Bacteria 3770
77 Ga0070712_100073980 3300006175 Bacteria 2446
78 Ga0097621_100012115 3300006237 Bacteria 6380
79 Ga0097621_100020407 3300006237 Bacteria 5105
80 Ga0097621_100057030 3300006237 Bacteria 3192
81 Ga0097621_100093101 3300006237 Bacteria 2525
82 Ga0068871_100001883 3300006358 Bacteria 14191
83 Ga0075433_10000310 3300006852 Bacteria 29590
84 Ga0075433_10060373 3300006852 Bacteria 3319
85 Ga0075434_100000326 3300006871 Bacteria 34180
86 Ga0075434_100000966 3300006871 Bacteria 23172
87 Ga0075434_100006572 3300006871 Bacteria 10663
88 Ga0075434_100072350 3300006871 Bacteria 3440
89 Ga0075436_100002847 3300006914 Bacteria 11849
90 Ga0075436_100003971 3300006914 Bacteria 10138
91 Ga0075436_100029174 3300006914 Bacteria 3794
92 Ga0097620_100049797 3300006931 Bacteria 4208
93 Ga0075435_100000020 3300007076 Bacteria 91240
94 Ga0075435_100001632 3300007076 Bacteria 14522
95 Ga0075435_100006343 3300007076 Bacteria 8356
96 Ga0075435_100025399 3300007076 Bacteria 4612
97 Ga0075435_100089695 3300007076 Bacteria 2535
98 Ga0105240_10004037 3300009093 Bacteria 22586
99 Ga0105240_10010414 3300009093 Bacteria 13068
100 Ga0105240_10013598 3300009093 Bacteria 11167
101 Ga0105240_10016014 3300009093 Bacteria 10165
102 Ga0105240_10018794 3300009093 Bacteria 9259
103 Ga0105240_10051569 3300009093 Bacteria 5175
104 Ga0105240_10107795 3300009093 Bacteria 3377
105 Ga0105245_10000754 3300009098 Bacteria 29261
106 Ga0105245_10001068 3300009098 Bacteria 24840
107 Ga0105245_10016565 3300009098 Bacteria 6431
108 Ga0114129_10012769 3300009147 Bacteria 11955
109 Ga0114129_10013906 3300009147 Bacteria 11466
110 Ga0114129_10020263 3300009147 Bacteria 9463
111 Ga0114129_10023072 3300009147 Bacteria 8828
112 Ga0114129_10023484 3300009147 Bacteria 8742
113 Ga0114129_10025400 3300009147 Bacteria 8394
114 Ga0114129_10025859 3300009147 Bacteria 8313
115 Ga0114129_10156529 3300009147 Bacteria 3115
116 Ga0105243_10034082 3300009148 Bacteria 3939
117 Ga0105243_10145511 3300009148 Bacteria 2027
118 Ga0105241_10004476 3300009174 Bacteria 10334
119 Ga0105242_10001588 3300009176 Bacteria 17868
120 Ga0105242_10109190 3300009176 Bacteria 2355
121 Ga0105248_10003926 3300009177 Bacteria 16437
122 Ga0105248_10007502 3300009177 Bacteria 11965
123 Ga0105248_10035321 3300009177 Bacteria 5591
124 Ga0105248_10036629 3300009177 Bacteria 5487
125 Ga0105248_10064650 3300009177 Bacteria 4107
126 Ga0105237_10005980 3300009545 Bacteria 13633
127 Ga0105237_10010302 3300009545 Bacteria 9959
128 Ga0105237_10098974 3300009545 Bacteria 2908
129 Ga0105237_10189082 3300009545 Bacteria 2059
130 Ga0105238_10000501 3300009551 Bacteria 41211
131 Ga0105238_10007557 3300009551 Bacteria 10888
132 Ga0105238_10014073 3300009551 Bacteria 8088
133 Ga0105238_10015567 3300009551 Bacteria 7700
134 Ga0105238_10016962 3300009551 Bacteria 7390
135 Ga0105238_10019109 3300009551 Bacteria 6981
136 Ga0105238_10024586 3300009551 Bacteria 6140
137 Ga0105249_10003665 3300009553 Bacteria 13245
138 Ga0105239_10002493 3300010375 Bacteria 23445
139 Ga0105239_10020834 3300010375 Bacteria 7233
140 Ga0105239_10060157 3300010375 Bacteria 4169
141 Ga0105246_10008582 3300011119 Bacteria 6282
142 Ga0105246_10009440 3300011119 Bacteria 6011
143 Ga0157370_10007929 3300013104 Bacteria 11499
144 Ga0157370_10009793 3300013104 Bacteria 10163
145 Ga0157370_10111571 3300013104 Bacteria 2556
146 Ga0157369_10005007 3300013105 Bacteria 15517
147 Ga0157369_10013273 3300013105 Bacteria 9322
148 Ga0157369_10020027 3300013105 Bacteria 7483
149 Ga0157369_10023126 3300013105 Bacteria 6925
150 Ga0157369_10098931 3300013105 Bacteria 3110
151 Ga0157374_10043802 3300013296 Bacteria 4135
152 Ga0157374_10074965 3300013296 Bacteria 3197
153 Ga0157374_10126985 3300013296 Bacteria 2465
154 Ga0157372_10001007 3300013307 Bacteria 30798
155 Ga0157375_10147477 3300013308 Bacteria 2485
156 Ga0163163_10004379 3300014325 Bacteria 12032
157 Ga0163163_10009916 3300014325 Bacteria 8540
158 Ga0163163_10035080 3300014325 Bacteria 4864
159 Ga0163163_10078769 3300014325 Bacteria 3293
160 Ga0157380_10014366 3300014326 Bacteria 5792
161 Ga0157377_10032374 3300014745 Bacteria 2847
162 Ga0157379_10019180 3300014968 Bacteria 6039
163 Ga0157376_10042491 3300014969 Bacteria 3725
164 Ga0157376_10132899 3300014969 Bacteria 2223
165 Ga0213875_10027126 3300021388 Bacteria 2725
166 Ga0207645_10003184 3300025907 Bacteria 12557
167 Ga0207684_10026953 3300025910 Bacteria 4900
168 Ga0207684_10051837 3300025910 Bacteria 3481
169 Ga0207707_10000919 3300025912 Bacteria 28619
170 Ga0207707_10021120 3300025912 Bacteria 5689
171 Ga0207695_10001615 3300025913 Bacteria 36561
172 Ga0207695_10007350 3300025913 Bacteria 14059
173 Ga0207695_10011965 3300025913 Bacteria 10445
174 Ga0207695_10047847 3300025913 Bacteria 4521
175 Ga0207695_10081330 3300025913 Bacteria 3278
176 Ga0207671_10005560 3300025914 Bacteria 11577
177 Ga0207671_10066673 3300025914 Bacteria 2680
178 Ga0207663_10028581 3300025916 Bacteria 3265
179 Ga0207663_10038601 3300025916 Bacteria 2888
180 Ga0207660_10007720 3300025917 Bacteria 6963
181 Ga0207660_10151673 3300025917 Bacteria 1781
182 Ga0207657_10021904 3300025919 Bacteria 6001
183 Ga0207657_10053005 3300025919 Bacteria 3517
184 Ga0207652_10003735 3300025921 Bacteria 12493
185 Ga0207646_10000012 3300025922 Bacteria 367049
186 Ga0207646_10000046 3300025922 Bacteria 177239
187 Ga0207646_10078582 3300025922 Unclassified 2949
188 Ga0207681_10053578 3300025923 Bacteria 2739
189 Ga0207694_10001532 3300025924 Bacteria 19669
190 Ga0207694_10006159 3300025924 Bacteria 9166
191 Ga0207694_10106192 3300025924 Bacteria 2230
192 Ga0207659_10000106 3300025926 Bacteria 49900
193 Ga0207687_10000849 3300025927 Bacteria 20665
194 Ga0207687_10003798 3300025927 Bacteria 10152
195 Ga0207687_10006990 3300025927 Bacteria 7435
196 Ga0207700_10047690 3300025928 Bacteria 3177
197 Ga0207664_10061534 3300025929 Bacteria 2995
198 Ga0207644_10034834 3300025931 Bacteria 3524
199 Ga0207686_10046700 3300025934 Bacteria 2673
200 Ga0207709_10040555 3300025935 Bacteria 2788
201 Ga0207670_10099535 3300025936 Bacteria 2074
202 Ga0207669_10014742 3300025937 Bacteria 3924
203 Ga0207704_10001950 3300025938 Bacteria 9242
204 Ga0207665_10015170 3300025939 Bacteria 5061
205 Ga0207711_10003941 3300025941 Bacteria 12768
206 Ga0207711_10035967 3300025941 Bacteria 4200
207 Ga0207711_10074096 3300025941 Bacteria 2960
208 Ga0207711_10079558 3300025941 Bacteria 2862
209 Ga0207661_10000040 3300025944 Bacteria 126775
210 Ga0207661_10020775 3300025944 Bacteria 4913
211 Ga0207661_10051405 3300025944 Unclassified 3288
212 Ga0207661_10111089 3300025944 Bacteria 2318
213 Ga0207667_10003475 3300025949 Bacteria 19447
214 Ga0207667_10022451 3300025949 Bacteria 6970
215 Ga0207667_10032728 3300025949 Bacteria 5597
216 Ga0207640_10021448 3300025981 Bacteria 3850
217 Ga0207658_10028715 3300025986 Bacteria 3921
218 Ga0207703_10049222 3300026035 Bacteria 3406
219 Ga0207703_10084451 3300026035 Bacteria 2655
220 Ga0207708_10011209 3300026075 Bacteria 6672
221 Ga0207702_10029858 3300026078 Bacteria 4539
222 Ga0207702_10119295 3300026078 Bacteria 2358
223 Ga0207641_10000875 3300026088 Bacteria 31527
224 Ga0207648_10012617 3300026089 Bacteria 7904
225 Ga0207648_10039599 3300026089 Bacteria 4144
226 Ga0207648_10073615 3300026089 Bacteria 2977
227 Ga0207674_10000035 3300026116 Bacteria 136262
228 Ga0207674_10001346 3300026116 Bacteria 31774
229 Ga0207675_100015864 3300026118 Bacteria 7026
230 Ga0207675_100026946 3300026118 Bacteria 5350
231 Ga0207698_10004118 3300026142 Bacteria 8833
232 Ga0207698_10031916 3300026142 Bacteria 3809
233 Ga0207428_10004967 3300027907 Bacteria 12518
234 Ga0268266_10010036 3300028379 Bacteria 8308
235 Ga0268264_10041437 3300028381 Bacteria 3809
236 Ga0268264_10059144 3300028381 Bacteria 3210
237 Ga0265338_10002394 3300028800 Bacteria 28230
238 Ga0265338_10016701 3300028800 Bacteria 7955
239 Ga0265325_10046997 3300031241 Bacteria 2236
240 Ga0265329_10008667 3300031242 Bacteria 3841
241 Ga0265316_10008312 3300031344 Bacteria 9635
242 Ga0265316_10011238 3300031344 Bacteria 8095
243 Ga0265316_10024360 3300031344 Bacteria 5073
244 Ga0316579_10019636 3300031691 Bacteria 2988
245 Ga0265314_10001766 3300031711 Bacteria 23337
246 Ga0265314_10002451 3300031711 Bacteria 18978
247 Ga0265342_10067695 3300031712 Bacteria 2089
248 Ga0316576_10068544 3300031727 Bacteria 2614
249 Ga0316578_10004118 3300031728 Bacteria 6807
250 Ga0316577_10000636 3300031733 Bacteria 14588
251 Ga0316577_10041306 3300031733 Bacteria 2580
252 Ga0316577_10045363 3300031733 Bacteria 2457
253 Ga0316577_10060556 3300031733 Bacteria 2113
254 Ga0373930_0001110 3300034816 Bacteria 3908
255 Ga0373948_0001264 3300034817 Bacteria 3456
256 Ga0373929_0000371 3300035085 Bacteria 8435
257 Ga0373934_0001281 3300035086 Bacteria 9142
258 Ga0373949_0000394 3300035090 Bacteria 15275
259 Ga0373951_0004663 3300035091 Bacteria 3243
260 Ga0373952_0000554 3300035092 Bacteria 6577
261 Ga0373932_0005619 3300035112 Bacteria 2949
262 Ga0373941_0001988 3300035115 Bacteria 4425
263 Ga0373953_0008813 3300035117 Bacteria 3441
264 Ga0373954_0003669 3300035118 Bacteria 6539
265 Ga0373943_0040884 3300035170 Bacteria 2240
266 Ga0373955_0036930 3300035172 Bacteria 2596
267 Ga0373955_0057901 3300035172 Unclassified 2130
268 Ga0373942_0000347 3300035207 Bacteria 12673
269 Ga0373961_0001167 3300035241 Bacteria 8204
270 Ga0373927_0047855 3300035695 Bacteria 2766
271 Ga0373937_0012516 3300036401 Bacteria 7466
272 Ga0373937_0111782 3300036401 Bacteria 2541
273 Ga0316584_0000596 3300036712 Bacteria 19602
274 Ga0316584_0049638 3300036712 Bacteria 3137
275 Ga0436364_0231727 3300037853 Bacteria 7968
276 Ga0436364_0304215 3300037853 Bacteria 4299
277 Ga0400490_06663 3300038726 Bacteria 42094
278 Ga0400490_07766 3300038726 Bacteria 2956
279 Ga0400490_08242 3300038726 Bacteria 2647
280 Ga0400485_07095 3300038735 Bacteria 2499
281 Ga0400488_01912 3300038741 Bacteria 6324
282 Ga0400488_38307 3300038741 Bacteria 10070
283 Ga0400486_16635 3300038742 Bacteria 11856
284 Ga0400486_20766 3300038742 Bacteria 91783
285 Ga0400486_27056 3300038742 Bacteria 9105
286 Ga0400483_043696 3300039062 Bacteria 7381
287 Ga0400483_145628 3300039062 Bacteria 7144
288 Ga0400483_240381 3300039062 Bacteria 35578
289 Ga0400489_14732 3300039093 Bacteria 38869
290 Ga0400489_32976 3300039093 Bacteria 10440
291 Ga0400487_03922 3300039110 Bacteria 2356
292 Ga0400487_59477 3300039110 Bacteria 4973
293 Ga0451577_0000157 3300042876 Bacteria 151953
294 Ga0451577_0000313 3300042876 Bacteria 92642
295 Ga0453683_0008191 3300044673 Bacteria 7032
296 Ga0453683_0025102 3300044673 Bacteria 3788
297 Ga0453684_0000205 3300044712 Bacteria 257921
298 Ga0453684_0000324 3300044712 Bacteria 201431
299 Ga0453684_0000992 3300044712 Bacteria 92625
300 Ga0453684_0003182 3300044712 Bacteria 37655
301 Ga0453684_0027381 3300044712 Bacteria 8177
302 Ga0453684_0032355 3300044712 Bacteria 7323
303 Ga0453684_0041169 3300044712 Bacteria 6255
304 Ga0453684_0337897 3300044712 Bacteria 1701
305 Ga0451576_0003464 3300045051 Bacteria 21627
306 Ga0451576_0009194 3300045051 Bacteria 11481
307 Ga0451576_0021291 3300045051 Bacteria 7048
308 Ga0451576_0033374 3300045051 Bacteria 5471
309 Ga0451576_0037517 3300045051 Bacteria 5132
310 Ga0451576_0126756 3300045051 Bacteria 2660
311 Ga0451576_0241324 3300045051 Bacteria 1888
312 Ga0495592_0047298 3300046454 Bacteria 3204
313 Ga0495592_0095772 3300046454 Bacteria 2122
314 Ga0495603_0053257 3300046455 Bacteria 2401
315 Ga0495651_0028553 3300046462 Bacteria 4346
316 Ga0495651_0107820 3300046462 Unclassified 2063
317 Ga0495580_0000349 3300046472 Bacteria 37675
318 Ga0495580_0000506 3300046472 Bacteria 32778
319 Ga0495580_0002637 3300046472 Bacteria 15580
320 Ga0495580_0039051 3300046472 Bacteria 3397
321 Ga0495580_0051791 3300046472 Unclassified 2901
322 Ga0495594_0065897 3300046499 Bacteria 2009
323 Ga0495628_0057151 3300046516 Bacteria 3070
324 Ga0495630_0006972 3300046517 Bacteria 8057
325 Ga0495630_0010930 3300046517 Bacteria 6558
326 Ga0495587_0004248 3300046536 Bacteria 9471
327 Ga0495587_0028863 3300046536 Bacteria 3370
328 Ga0495587_0081448 3300046536 Bacteria 1876
329 Ga0495645_0030120 3300046543 Bacteria 3952
330 Ga0495667_0018866 3300046559 Bacteria 4658
331 Ga0495634_0031435 3300046642 Bacteria 3657
332 Ga0495588_0071044 3300046674 Bacteria 1810
333 Ga0495599_0002284 3300046678 Bacteria 11157
334 Ga0495599_0003107 3300046678 Bacteria 9674
335 Ga0495646_0106128 3300046680 Bacteria 1604
336 Ga0495669_0002783 3300046684 Bacteria 7167
337 Ga0495613_0000186 3300046689 Bacteria 60855
338 Ga0495613_0118409 3300046689 Bacteria 1904
339 Ga0495624_0072257 3300046690 Bacteria 2146
340 Ga0495604_0008852 3300047317 Bacteria 7955
341 Ga0495674_0100850 3300047319 Bacteria 2456
342 Ga0495674_0203234 3300047319 Bacteria 1643
343 Ga0495684_0000099 3300047471 Bacteria 60765
344 Ga0495684_0017345 3300047471 Bacteria 5541
345 Ga0495684_0062730 3300047471 Unclassified 2826
346 Ga0495602_0003694 3300048088 Bacteria 15877
347 Ga0495602_0109987 3300048088 Bacteria 2241
348 Ga0496110_0101850 3300048913 Bacteria 2575
349 Ga0496112_0067306 3300048915 Bacteria 3535
350 Ga0496112_0091837 3300048915 Bacteria 3005
351 Ga0496115_0080650 3300048918 Bacteria 2650
352 Ga0501032_0008415 3300049569 Bacteria 7525
353 Ga0501032_0013706 3300049569 Bacteria 5756
354 Ga0501032_0024886 3300049569 Bacteria 4130
355 Ga0501033_0002456 3300049570 Bacteria 15747
356 Ga0501033_0003979 3300049570 Bacteria 11974
357 Ga0501033_0021247 3300049570 Bacteria 4896
358 Ga0501034_0005216 3300049571 Bacteria 14256
359 Ga0501034_0030202 3300049571 Bacteria 5508
360 Ga0501034_0038968 3300049571 Bacteria 4813
361 Ga0501036_0002351 3300049572 Bacteria 14792
362 Ga0501036_0006207 3300049572 Bacteria 9696
363 Ga0501036_0022833 3300049572 Bacteria 5267
364 Ga0501036_0067667 3300049572 Bacteria 3022
365 Ga0501037_0001676 3300049573 Bacteria 16112
366 Ga0501037_0006021 3300049573 Bacteria 8850
367 Ga0501038_0010776 3300049574 Bacteria 8356
368 Ga0501038_0065146 3300049574 Bacteria 3105
369 Ga0501038_0113746 3300049574 Bacteria 2239
370 Ga0501039_0004195 3300049575 Bacteria 10850
371 Ga0501039_0041404 3300049575 Bacteria 3558
372 Ga0501042_0024787 3300049578 Bacteria 4210
373 Ga0501043_0002980 3300049579 Bacteria 14101
374 Ga0501043_0024628 3300049579 Bacteria 4721
375 Ga0501043_0049088 3300049579 Bacteria 3317
376 Ga0501046_0001842 3300049580 Bacteria 20196
377 Ga0501046_0002495 3300049580 Bacteria 17229
378 Ga0501046_0013593 3300049580 Bacteria 6886
379 Ga0501047_0001243 3300049581 Bacteria 25247
380 Ga0501047_0029953 3300049581 Bacteria 5246
381 Ga0501047_0059876 3300049581 Bacteria 3676
382 Ga0501047_0062673 3300049581 Bacteria 3586
383 Ga0501048_0018920 3300049582 Bacteria 5061
384 Ga0501067_0050387 3300049583 Bacteria 2307
385 Ga0501068_0001579 3300049584 Bacteria 12112
386 Ga0501068_0003583 3300049584 Bacteria 8388
387 Ga0501069_0000718 3300049585 Bacteria 15422
388 Ga0501069_0002944 3300049585 Bacteria 8749
389 Ga0501069_0014465 3300049585 Bacteria 4220
390 Ga0501070_0003319 3300049586 Bacteria 13973
391 Ga0501072_0074765 3300049588 Bacteria 2679
392 Ga0501072_0236174 3300049588 Bacteria 1456
393 Ga0501073_0011305 3300049589 Bacteria 6531
394 Ga0501073_0017403 3300049589 Bacteria 5206
395 Ga0501073_0045216 3300049589 Bacteria 3101
396 Ga0501073_0047194 3300049589 Bacteria 3027
397 Ga0501074_0002287 3300049590 Bacteria 13328
398 Ga0501074_0009003 3300049590 Bacteria 7247
399 Ga0501261_002301 3300049690 Bacteria 2343
400 Ga0501079_0007353 3300049741 Bacteria 8326
401 Ga0501080_0004813 3300049742 Bacteria 12037
402 Ga0501080_0117203 3300049742 Bacteria 2468
403 Ga0501083_0000834 3300049744 Bacteria 20259
404 Ga0501083_0010683 3300049744 Bacteria 6459
405 Ga0501083_0021220 3300049744 Bacteria 4514
406 Ga0501035_0002423 3300049822 Bacteria 18234
407 Ga0501035_0052854 3300049822 Bacteria 3634
408 Ga0501044_0022206 3300049823 Bacteria 6762
409 Ga0501044_0028166 3300049823 Bacteria 5930
410 Ga0501044_0063178 3300049823 Bacteria 3784
411 Ga0501044_0085715 3300049823 Bacteria 3182
412 Ga0501045_0011006 3300049824 Bacteria 6340
413 nmdc:mga05p37_114780_c1 3300050507 Bacteria 3311
414 nmdc:mga05p37_32975_c1 3300050507 Bacteria 6341
415 nmdc:mga05p37_87908_c1 3300050507 Bacteria 3831
416 nmdc:mga09592_229460_c1 3300050508 Bacteria 1608
417 nmdc:mga08y16_20523_c1 3300050511 Bacteria 6974
418 nmdc:mga0n895_38672_c1 3300050512 Bacteria 4624
419 nmdc:mga0n895_40821_c1 3300050512 Bacteria 4509
420 nmdc:mga0n895_5873_c1 3300050512 Bacteria 10316
421 nmdc:mga0n895_80_c1 3300050512 Bacteria 54788
422 nmdc:mga0rr50_11329_c1 3300050513 Bacteria 5704
423 nmdc:mga0rr50_2469_c1 3300050513 Bacteria 10443
424 nmdc:mga0rr50_35_c1 3300050513 Bacteria 91254
425 nmdc:mga0rr50_53951_c1 3300050513 Bacteria 2992
426 nmdc:mga08x19_3873_c1 3300050514 Bacteria 8905
427 nmdc:mga08x19_64_c1 3300050514 Bacteria 24706
428 nmdc:mga08x19_798_c1 3300050514 Bacteria 20114
429 nmdc:mga0a205_520_c1 3300050515 Bacteria 30274
430 nmdc:mga0a205_8057_c1 3300050515 Bacteria 7677
431 nmdc:mga0a205_88144_c1 3300050515 Bacteria 2999
432 Ga0495619_0001935 3300053085 Bacteria 13808
433 Ga0495619_0094236 3300053085 Bacteria 2031
434 Ga0500555_002401 3300053103 Bacteria 5443
435 Ga0500616_0000787 3300053153 Bacteria 36341
436 Ga0500645_000802 3300053730 Bacteria 18860
437 Ga0501084_0007873 3300054114 Bacteria 8772
438 Ga0501084_0035692 3300054114 Bacteria 4156
439 Ga0501082_0000020 3300060353 Bacteria 109889
440 Ga0501082_0001859 3300060353 Bacteria 18564
441 Ga0501082_0011056 3300060353 Bacteria 7761
442 Ga0501082_0065531 3300060353 Bacteria 3128

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0059876 Ga0501047_0059876_2309_3652 437
2 3300049588 Ga0501072_0236174 Ga0501072_0236174_92_1435 437
3 3300049823 Ga0501044_0085715 Ga0501044_0085715_25_1368 437
4 3300046536 Ga0495587_0081448 Ga0495587_0081448_20_1351 441
5 3300014325 Ga0163163_10004379 Ga0163163_100043798 448
6 3300050508 nmdc:mga09592_229460_c1 nmdc:mga09592_229460_c1_100_1590 495
7 3300005617 Ga0068859_100049794 Ga0068859_1000497944 498
8 3300006931 Ga0097620_100049797 Ga0097620_1000497973 498
9 3300028381 Ga0268264_10041437 Ga0268264_100414372 498
10 3300046680 Ga0495646_0106128 Ga0495646_0106128_64_1566 498
11 3300025916 Ga0207663_10028581 Ga0207663_100285812 499
12 3300025916 Ga0207663_10038601 Ga0207663_100386012 505
13 3300005436 Ga0070713_100035749 Ga0070713_1000357492 506
14 3300005439 Ga0070711_100010558 Ga0070711_1000105583 506
15 3300028800 Ga0265338_10016701 Ga0265338_100167016 506
16 3300047319 Ga0495674_0203234 Ga0495674_0203234_26_1552 506
17 3300006237 Ga0097621_100093101 Ga0097621_1000931012 507
18 3300013296 Ga0157374_10074965 Ga0157374_100749653 509
19 3300006175 Ga0070712_100073980 Ga0070712_1000739802 516
20 3300009176 Ga0105242_10109190 Ga0105242_101091902 516
21 3300025934 Ga0207686_10046700 Ga0207686_100467002 516
22 3300005445 Ga0070708_100002693 Ga0070708_1000026935 517
23 3300005467 Ga0070706_100003186 Ga0070706_1000031868 517
24 3300005536 Ga0070697_100000215 Ga0070697_10000021527 517
25 3300009551 Ga0105238_10000501 Ga0105238_1000050116 517
26 3300010375 Ga0105239_10002493 Ga0105239_1000249316 517
27 3300031711 Ga0265314_10002451 Ga0265314_100024513 517
28 3300046472 Ga0495580_0051791 Ga0495580_0051791_1305_2882 517
29 3300046499 Ga0495594_0065897 Ga0495594_0065897_142_1701 517
30 3300046642 Ga0495634_0031435 Ga0495634_0031435_2034_3593 517
31 3300046674 Ga0495588_0071044 Ga0495588_0071044_163_1722 517
32 3300037853 Ga0436364_0304215 Ga0436364_0304215_12_1586 522
33 3300053085 Ga0495619_0094236 Ga0495619_0094236_12_1610 522
34 3300005436 Ga0070713_100060280 Ga0070713_1000602801 524
35 3300025928 Ga0207700_10047690 Ga0207700_100476901 524
36 3300031728 Ga0316578_10004118 Ga0316578_100041183 526
37 3300044712 Ga0453684_0041169 Ga0453684_0041169_1417_3045 526
38 3300006914 Ga0075436_100029174 Ga0075436_1000291742 528
39 3300009093 Ga0105240_10013598 Ga0105240_100135984 528
40 3300009098 Ga0105245_10000754 Ga0105245_100007542 528
41 3300009148 Ga0105243_10145511 Ga0105243_101455112 528
42 3300009174 Ga0105241_10004476 Ga0105241_100044765 528
43 3300009177 Ga0105248_10003926 Ga0105248_1000392615 528
44 3300009551 Ga0105238_10007557 Ga0105238_100075577 528
45 3300009551 Ga0105238_10014073 Ga0105238_100140732 528
46 3300009551 Ga0105238_10016962 Ga0105238_100169625 528
47 3300011119 Ga0105246_10008582 Ga0105246_100085826 528
48 3300026116 Ga0207674_10001346 Ga0207674_1000134623 528
49 3300050514 nmdc:mga08x19_798_c1 nmdc:mga08x19_798_c1_17285_18919 528
50 3300060353 Ga0501082_0000020 Ga0501082_0000020_21164_22756 528
51 3300009147 Ga0114129_10023072 Ga0114129_100230726 532
52 3300028800 Ga0265338_10002394 Ga0265338_1000239413 532
53 3300049569 Ga0501032_0024886 Ga0501032_0024886_1232_2929 532
54 3300049571 Ga0501034_0038968 Ga0501034_0038968_3098_4795 532
55 3300049575 Ga0501039_0004195 Ga0501039_0004195_774_2471 532
56 3300049580 Ga0501046_0013593 Ga0501046_0013593_3221_4918 532
57 3300049581 Ga0501047_0029953 Ga0501047_0029953_873_2570 532
58 3300049584 Ga0501068_0003583 Ga0501068_0003583_840_2537 532
59 3300049585 Ga0501069_0014465 Ga0501069_0014465_1355_3052 532
60 3300049823 Ga0501044_0063178 Ga0501044_0063178_39_1736 532
61 3300005331 Ga0070670_100050461 Ga0070670_1000504612 534
62 3300005340 Ga0070689_100081662 Ga0070689_1000816621 535
63 3300009147 Ga0114129_10013906 Ga0114129_100139065 535
64 3300009545 Ga0105237_10098974 Ga0105237_100989743 535
65 3300025936 Ga0207670_10099535 Ga0207670_100995352 535
66 3300037853 Ga0436364_0231727 Ga0436364_0231727_4601_6214 535
67 3300046517 Ga0495630_0006972 Ga0495630_0006972_116_1729 535
68 3300047471 Ga0495684_0017345 Ga0495684_0017345_891_2504 535
69 3300050511 nmdc:mga08y16_20523_c1 nmdc:mga08y16_20523_c1_2805_4451 535
70 iso_pu_bacteria 2617270889 2617914711 535
71 iso_pu_bacteria 2831426010 2831428320 535
72 iso_pu_bacteria 2848694841 2848698482 535
73 iso_pu_bacteria 2849660919 2849664261 535
74 iso_pu_bacteria 2886627955 2886629030 535
75 iso_pu_bacteria 2913912277 2913914623 535
76 iso_pu_bacteria 642555144 642604632 535
77 3300007076 Ga0075435_100006343 Ga0075435_1000063433 536
78 3300044712 Ga0453684_0027381 Ga0453684_0027381_2348_4090 536
79 3300049572 Ga0501036_0067667 Ga0501036_0067667_523_2220 536
80 3300050512 nmdc:mga0n895_40821_c1 nmdc:mga0n895_40821_c1_2332_3972 536
81 3300050513 nmdc:mga0rr50_11329_c1 nmdc:mga0rr50_11329_c1_1455_3095 536
82 3300050515 nmdc:mga0a205_88144_c1 nmdc:mga0a205_88144_c1_237_1877 536
83 3300005467 Ga0070706_100031277 Ga0070706_1000312774 537
84 3300005468 Ga0070707_100000129 Ga0070707_10000012929 537
85 3300005468 Ga0070707_100000947 Ga0070707_1000009478 537
86 3300005471 Ga0070698_100055851 Ga0070698_1000558514 537
87 3300005471 Ga0070698_100064735 Ga0070698_1000647354 537
88 3300005548 Ga0070665_100232555 Ga0070665_1002325552 537
89 3300009093 Ga0105240_10051569 Ga0105240_100515692 537
90 3300010375 Ga0105239_10020834 Ga0105239_100208344 537
91 3300025910 Ga0207684_10051837 Ga0207684_100518374 537
92 3300025913 Ga0207695_10047847 Ga0207695_100478473 537
93 3300025922 Ga0207646_10000012 Ga0207646_10000012206 537
94 3300025922 Ga0207646_10000046 Ga0207646_10000046123 537
95 3300028379 Ga0268266_10010036 Ga0268266_100100364 537
96 3300031242 Ga0265329_10008667 Ga0265329_100086673 537
97 3300031691 Ga0316579_10019636 Ga0316579_100196363 537
98 3300044673 Ga0453683_0008191 Ga0453683_0008191_487_2124 537
99 3300044712 Ga0453684_0000205 Ga0453684_0000205_228054_229706 537
100 3300044712 Ga0453684_0032355 Ga0453684_0032355_2031_3668 537
101 3300044712 Ga0453684_0337897 Ga0453684_0337897_19_1656 537
102 3300045051 Ga0451576_0241324 Ga0451576_0241324_89_1726 537
103 3300049823 Ga0501044_0028166 Ga0501044_0028166_3034_4731 537
104 3300005435 Ga0070714_100037396 Ga0070714_1000373963 538
105 3300005436 Ga0070713_100042071 Ga0070713_1000420712 538
106 3300005468 Ga0070707_100005109 Ga0070707_1000051099 538
107 3300005468 Ga0070707_100042689 Ga0070707_1000426892 538
108 3300006028 Ga0070717_10000622 Ga0070717_100006223 538
109 3300006852 Ga0075433_10000310 Ga0075433_1000031019 538
110 3300006871 Ga0075434_100000966 Ga0075434_10000096619 538
111 3300025910 Ga0207684_10026953 Ga0207684_100269531 538
112 3300025922 Ga0207646_10078582 Ga0207646_100785822 538
113 3300025939 Ga0207665_10015170 Ga0207665_100151704 538
114 3300031727 Ga0316576_10068544 Ga0316576_100685442 538
115 3300031733 Ga0316577_10041306 Ga0316577_100413062 538
116 3300031733 Ga0316577_10045363 Ga0316577_100453631 538
117 3300031733 Ga0316577_10060556 Ga0316577_100605561 538
118 3300036712 Ga0316584_0049638 Ga0316584_0049638_1051_2793 538
119 3300038726 Ga0400490_06663 Ga0400490_06663_31465_33117 538
120 3300038726 Ga0400490_07766 Ga0400490_07766_700_2343 538
121 3300038726 Ga0400490_08242 Ga0400490_08242_801_2450 538
122 3300038735 Ga0400485_07095 Ga0400485_07095_778_2421 538
123 3300038741 Ga0400488_01912 Ga0400488_01912_2950_4599 538
124 3300038741 Ga0400488_38307 Ga0400488_38307_2101_3747 538
125 3300038742 Ga0400486_16635 Ga0400486_16635_2712_4355 538
126 3300038742 Ga0400486_20766 Ga0400486_20766_28239_29888 538
127 3300038742 Ga0400486_27056 Ga0400486_27056_6787_8430 538
128 3300039062 Ga0400483_043696 Ga0400483_043696_1984_3624 538
129 3300039062 Ga0400483_145628 Ga0400483_145628_5454_7103 538
130 3300039062 Ga0400483_240381 Ga0400483_240381_5154_7004 538
131 3300039093 Ga0400489_14732 Ga0400489_14732_34227_36005 538
132 3300039093 Ga0400489_32976 Ga0400489_32976_1428_3071 538
133 3300039110 Ga0400487_03922 Ga0400487_03922_230_1876 538
134 3300039110 Ga0400487_59477 Ga0400487_59477_509_2158 538
135 3300042876 Ga0451577_0000157 Ga0451577_0000157_140862_142502 538
136 3300044673 Ga0453683_0025102 Ga0453683_0025102_172_1836 538
137 3300044712 Ga0453684_0000324 Ga0453684_0000324_164544_166184 538
138 3300045051 Ga0451576_0003464 Ga0451576_0003464_2695_4413 538
139 3300045051 Ga0451576_0021291 Ga0451576_0021291_1178_2818 538
140 3300045051 Ga0451576_0033374 Ga0451576_0033374_194_1858 538
141 3300046472 Ga0495580_0000349 Ga0495580_0000349_11579_13219 538
142 3300048915 Ga0496112_0067306 Ga0496112_0067306_1765_3420 538
143 3300050512 nmdc:mga0n895_5873_c1 nmdc:mga0n895_5873_c1_3185_4825 538
144 3300050513 nmdc:mga0rr50_2469_c1 nmdc:mga0rr50_2469_c1_5491_7131 538
145 3300050515 nmdc:mga0a205_520_c1 nmdc:mga0a205_520_c1_25485_27125 538
146 3300006028 Ga0070717_10041065 Ga0070717_100410654 539
147 iso_pu_bacteria 2913844669 2913851421 539
148 iso_pu_bacteria 2913939268 2913945195 539
149 3300031711 Ga0265314_10001766 Ga0265314_1000176613 540
150 3300031733 Ga0316577_10000636 Ga0316577_100006365 540
151 3300036712 Ga0316584_0000596 Ga0316584_0000596_16692_18356 540
152 3300042876 Ga0451577_0000313 Ga0451577_0000313_52172_53836 540
153 3300044712 Ga0453684_0000992 Ga0453684_0000992_38790_40454 540
154 3300046690 Ga0495624_0072257 Ga0495624_0072257_27_1685 541
155 3300049569 Ga0501032_0008415 Ga0501032_0008415_2798_4495 541
156 3300049571 Ga0501034_0005216 Ga0501034_0005216_10250_11947 541
157 3300049574 Ga0501038_0113746 Ga0501038_0113746_436_2133 541
158 3300049575 Ga0501039_0041404 Ga0501039_0041404_862_2559 541
159 3300049580 Ga0501046_0002495 Ga0501046_0002495_527_2224 541
160 3300049589 Ga0501073_0047194 Ga0501073_0047194_25_1722 541
161 3300049742 Ga0501080_0004813 Ga0501080_0004813_7901_9598 541
162 3300060353 Ga0501082_0065531 Ga0501082_0065531_1305_3002 541
163 3300005329 Ga0070683_100000041 Ga0070683_10000004145 542
164 3300005329 Ga0070683_100003485 Ga0070683_1000034854 542
165 3300005330 Ga0070690_100002754 Ga0070690_1000027548 542
166 3300005336 Ga0070680_100011166 Ga0070680_1000111664 542
167 3300005339 Ga0070660_100066140 Ga0070660_1000661402 542
168 3300005344 Ga0070661_100046557 Ga0070661_1000465572 542
169 3300005458 Ga0070681_10001296 Ga0070681_1000129618 542
170 3300005530 Ga0070679_100004541 Ga0070679_1000045414 542
171 3300005535 Ga0070684_100000029 Ga0070684_10000002960 542
172 3300005535 Ga0070684_100090846 Ga0070684_1000908462 542
173 3300005539 Ga0068853_100017153 Ga0068853_1000171534 542
174 3300005563 Ga0068855_100009306 Ga0068855_1000093065 542
175 3300005563 Ga0068855_100081652 Ga0068855_1000816523 542
176 3300005577 Ga0068857_100000258 Ga0068857_10000025827 542
177 3300005614 Ga0068856_100026067 Ga0068856_1000260674 542
178 3300005616 Ga0068852_100020317 Ga0068852_1000203173 542
179 3300005842 Ga0068858_100034578 Ga0068858_1000345782 542
180 3300005842 Ga0068858_100068726 Ga0068858_1000687262 542
181 3300006237 Ga0097621_100057030 Ga0097621_1000570302 542
182 3300009093 Ga0105240_10010414 Ga0105240_100104148 542
183 3300009093 Ga0105240_10016014 Ga0105240_100160147 542
184 3300009093 Ga0105240_10018794 Ga0105240_100187942 542
185 3300009098 Ga0105245_10001068 Ga0105245_1000106820 542
186 3300009098 Ga0105245_10016565 Ga0105245_100165652 542
187 3300009177 Ga0105248_10007502 Ga0105248_100075025 542
188 3300009545 Ga0105237_10010302 Ga0105237_100103028 542
189 3300009545 Ga0105237_10189082 Ga0105237_101890822 542
190 3300009551 Ga0105238_10015567 Ga0105238_100155672 542
191 3300009551 Ga0105238_10019109 Ga0105238_100191093 542
192 3300009553 Ga0105249_10003665 Ga0105249_100036657 542
193 3300011119 Ga0105246_10009440 Ga0105246_100094404 542
194 3300013104 Ga0157370_10007929 Ga0157370_100079296 542
195 3300013104 Ga0157370_10009793 Ga0157370_100097933 542
196 3300013104 Ga0157370_10111571 Ga0157370_101115712 542
197 3300013105 Ga0157369_10005007 Ga0157369_1000500713 542
198 3300013105 Ga0157369_10013273 Ga0157369_100132731 542
199 3300013105 Ga0157369_10020027 Ga0157369_100200275 542
200 3300013105 Ga0157369_10023126 Ga0157369_100231262 542
201 3300013105 Ga0157369_10098931 Ga0157369_100989312 542
202 3300013307 Ga0157372_10001007 Ga0157372_1000100719 542
203 3300013308 Ga0157375_10147477 Ga0157375_101474772 542
204 3300014325 Ga0163163_10009916 Ga0163163_100099166 542
205 3300014325 Ga0163163_10035080 Ga0163163_100350803 542
206 3300021388 Ga0213875_10027126 Ga0213875_100271262 542
207 3300025912 Ga0207707_10000919 Ga0207707_1000091918 542
208 3300025913 Ga0207695_10001615 Ga0207695_1000161517 542
209 3300025913 Ga0207695_10007350 Ga0207695_1000735010 542
210 3300025913 Ga0207695_10011965 Ga0207695_100119654 542
211 3300025914 Ga0207671_10066673 Ga0207671_100666732 542
212 3300025917 Ga0207660_10007720 Ga0207660_100077204 542
213 3300025919 Ga0207657_10021904 Ga0207657_100219042 542
214 3300025921 Ga0207652_10003735 Ga0207652_100037354 542
215 3300025924 Ga0207694_10001532 Ga0207694_1000153217 542
216 3300025924 Ga0207694_10006159 Ga0207694_100061597 542
217 3300025924 Ga0207694_10106192 Ga0207694_101061922 542
218 3300025927 Ga0207687_10000849 Ga0207687_100008496 542
219 3300025927 Ga0207687_10003798 Ga0207687_100037984 542
220 3300025927 Ga0207687_10006990 Ga0207687_100069905 542
221 3300025929 Ga0207664_10061534 Ga0207664_100615342 542
222 3300025941 Ga0207711_10003941 Ga0207711_100039415 542
223 3300025944 Ga0207661_10000040 Ga0207661_1000004045 542
224 3300025944 Ga0207661_10020775 Ga0207661_100207752 542
225 3300025944 Ga0207661_10051405 Ga0207661_100514052 542
226 3300025944 Ga0207661_10111089 Ga0207661_101110891 542
227 3300025949 Ga0207667_10003475 Ga0207667_1000347517 542
228 3300025949 Ga0207667_10022451 Ga0207667_100224513 542
229 3300025949 Ga0207667_10032728 Ga0207667_100327282 542
230 3300026035 Ga0207703_10049222 Ga0207703_100492223 542
231 3300026035 Ga0207703_10084451 Ga0207703_100844512 542
232 3300026078 Ga0207702_10119295 Ga0207702_101192952 542
233 3300026116 Ga0207674_10000035 Ga0207674_1000003563 542
234 3300026142 Ga0207698_10004118 Ga0207698_100041184 542
235 3300026142 Ga0207698_10031916 Ga0207698_100319163 542
236 3300031241 Ga0265325_10046997 Ga0265325_100469972 542
237 3300031344 Ga0265316_10008312 Ga0265316_100083123 542
238 3300031344 Ga0265316_10011238 Ga0265316_100112383 542
239 3300031344 Ga0265316_10024360 Ga0265316_100243602 542
240 3300031712 Ga0265342_10067695 Ga0265342_100676952 542
241 3300035086 Ga0373934_0001281 Ga0373934_0001281_929_2563 542
242 3300035117 Ga0373953_0008813 Ga0373953_0008813_871_2505 542
243 3300035118 Ga0373954_0003669 Ga0373954_0003669_3326_4960 542
244 3300035172 Ga0373955_0036930 Ga0373955_0036930_259_1893 542
245 3300035172 Ga0373955_0057901 Ga0373955_0057901_268_1902 542
246 3300035695 Ga0373927_0047855 Ga0373927_0047855_1084_2718 542
247 3300036401 Ga0373937_0012516 Ga0373937_0012516_542_2176 542
248 3300036401 Ga0373937_0111782 Ga0373937_0111782_192_1826 542
249 3300045051 Ga0451576_0126756 Ga0451576_0126756_53_1687 542
250 3300046454 Ga0495592_0047298 Ga0495592_0047298_1539_3173 542
251 3300046454 Ga0495592_0095772 Ga0495592_0095772_94_1728 542
252 3300046462 Ga0495651_0028553 Ga0495651_0028553_1349_2983 542
253 3300046462 Ga0495651_0107820 Ga0495651_0107820_172_1806 542
254 3300046472 Ga0495580_0000506 Ga0495580_0000506_10859_12493 542
255 3300046472 Ga0495580_0002637 Ga0495580_0002637_1741_3375 542
256 3300046516 Ga0495628_0057151 Ga0495628_0057151_815_2473 542
257 3300046536 Ga0495587_0004248 Ga0495587_0004248_5138_6772 542
258 3300046559 Ga0495667_0018866 Ga0495667_0018866_179_1813 542
259 3300046678 Ga0495599_0003107 Ga0495599_0003107_3342_4976 542
260 3300046689 Ga0495613_0118409 Ga0495613_0118409_207_1841 542
261 3300047317 Ga0495604_0008852 Ga0495604_0008852_4270_5904 542
262 3300047319 Ga0495674_0100850 Ga0495674_0100850_62_1696 542
263 3300047471 Ga0495684_0062730 Ga0495684_0062730_205_1839 542
264 3300048088 Ga0495602_0003694 Ga0495602_0003694_3860_5494 542
265 3300048088 Ga0495602_0109987 Ga0495602_0109987_487_2121 542
266 3300048918 Ga0496115_0080650 Ga0496115_0080650_967_2601 542
267 3300049569 Ga0501032_0013706 Ga0501032_0013706_1244_2905 542
268 3300049570 Ga0501033_0021247 Ga0501033_0021247_2980_4641 542
269 3300049571 Ga0501034_0030202 Ga0501034_0030202_3171_4832 542
270 3300049572 Ga0501036_0006207 Ga0501036_0006207_3864_5525 542
271 3300049573 Ga0501037_0001676 Ga0501037_0001676_4801_6462 542
272 3300049578 Ga0501042_0024787 Ga0501042_0024787_859_2520 542
273 3300049579 Ga0501043_0024628 Ga0501043_0024628_1781_3442 542
274 3300049580 Ga0501046_0001842 Ga0501046_0001842_4831_6492 542
275 3300049581 Ga0501047_0062673 Ga0501047_0062673_1542_3203 542
276 3300049584 Ga0501068_0001579 Ga0501068_0001579_6303_7964 542
277 3300049585 Ga0501069_0000718 Ga0501069_0000718_12371_14032 542
278 3300049589 Ga0501073_0011305 Ga0501073_0011305_4168_5829 542
279 3300049590 Ga0501074_0009003 Ga0501074_0009003_993_2654 542
280 3300049741 Ga0501079_0007353 Ga0501079_0007353_4826_6487 542
281 3300049822 Ga0501035_0052854 Ga0501035_0052854_878_2539 542
282 3300049823 Ga0501044_0022206 Ga0501044_0022206_1414_3075 542
283 3300049824 Ga0501045_0011006 Ga0501045_0011006_432_2093 542
284 3300060353 Ga0501082_0011056 Ga0501082_0011056_921_2582 542
285 3300005456 Ga0070678_100119484 Ga0070678_1001194842 543
286 3300045051 Ga0451576_0037517 Ga0451576_0037517_818_2536 543
287 3300046472 Ga0495580_0039051 Ga0495580_0039051_1038_2675 543
288 3300046678 Ga0495599_0002284 Ga0495599_0002284_1739_3376 543
289 3300049570 Ga0501033_0002456 Ga0501033_0002456_11853_13514 543
290 3300049570 Ga0501033_0003979 Ga0501033_0003979_8982_10643 543
291 3300049572 Ga0501036_0002351 Ga0501036_0002351_4603_6264 543
292 3300049573 Ga0501037_0006021 Ga0501037_0006021_4517_6178 543
293 3300049574 Ga0501038_0010776 Ga0501038_0010776_5639_7300 543
294 3300049579 Ga0501043_0049088 Ga0501043_0049088_593_2254 543
295 3300049582 Ga0501048_0018920 Ga0501048_0018920_2063_3724 543
296 3300049583 Ga0501067_0050387 Ga0501067_0050387_480_2141 543
297 3300049585 Ga0501069_0002944 Ga0501069_0002944_1114_2775 543
298 3300049586 Ga0501070_0003319 Ga0501070_0003319_5168_6829 543
299 3300049589 Ga0501073_0017403 Ga0501073_0017403_3285_4946 543
300 3300049589 Ga0501073_0045216 Ga0501073_0045216_1364_3025 543
301 3300049590 Ga0501074_0002287 Ga0501074_0002287_7285_8946 543
302 3300049742 Ga0501080_0117203 Ga0501080_0117203_372_2033 543
303 3300049744 Ga0501083_0021220 Ga0501083_0021220_400_2061 543
304 3300049822 Ga0501035_0002423 Ga0501035_0002423_4190_5851 543
305 3300054114 Ga0501084_0007873 Ga0501084_0007873_4901_6562 543
306 3300060353 Ga0501082_0001859 Ga0501082_0001859_4485_6146 543
307 3300005329 Ga0070683_100064949 Ga0070683_1000649492 544
308 3300005436 Ga0070713_100015825 Ga0070713_1000158256 544
309 3300005518 Ga0070699_100181526 Ga0070699_1001815261 544
310 3300009093 Ga0105240_10004037 Ga0105240_1000403725 544
311 3300009177 Ga0105248_10035321 Ga0105248_100353211 544
312 3300009545 Ga0105237_10005980 Ga0105237_100059809 544
313 3300010375 Ga0105239_10060157 Ga0105239_100601572 544
314 3300013296 Ga0157374_10126985 Ga0157374_101269852 544
315 3300025914 Ga0207671_10005560 Ga0207671_100055602 544
316 3300025941 Ga0207711_10035967 Ga0207711_100359674 544
317 3300046684 Ga0495669_0002783 Ga0495669_0002783_1850_3502 544
318 3300049572 Ga0501036_0022833 Ga0501036_0022833_3449_5134 544
319 3300053103 Ga0500555_002401 Ga0500555_002401_3659_5338 544
320 3300053153 Ga0500616_0000787 Ga0500616_0000787_3666_5345 544
321 3300053730 Ga0500645_000802 Ga0500645_000802_13212_14891 544
322 3300005354 Ga0070675_100000453 Ga0070675_1000004539 545
323 3300005367 Ga0070667_100032926 Ga0070667_1000329266 545
324 3300005471 Ga0070698_100105004 Ga0070698_1001050042 545
325 3300005842 Ga0068858_100144165 Ga0068858_1001441652 545
326 3300009147 Ga0114129_10012769 Ga0114129_100127699 545
327 3300014745 Ga0157377_10032374 Ga0157377_100323741 545
328 3300025926 Ga0207659_10000106 Ga0207659_100001061 545
329 3300049579 Ga0501043_0002980 Ga0501043_0002980_1785_3476 545
330 3300049581 Ga0501047_0001243 Ga0501047_0001243_12889_14580 545
331 3300049588 Ga0501072_0074765 Ga0501072_0074765_614_2305 545
332 3300049744 Ga0501083_0000834 Ga0501083_0000834_14589_16280 545
333 3300049744 Ga0501083_0010683 Ga0501083_0010683_1808_3499 545
334 3300054114 Ga0501084_0035692 Ga0501084_0035692_603_2294 545
335 3300044712 Ga0453684_0003182 Ga0453684_0003182_30282_31949 546
336 3300046517 Ga0495630_0010930 Ga0495630_0010930_149_1816 546
337 3300046536 Ga0495587_0028863 Ga0495587_0028863_849_2516 546
338 3300046543 Ga0495645_0030120 Ga0495645_0030120_69_1736 546
339 3300046689 Ga0495613_0000186 Ga0495613_0000186_26450_28117 546
340 3300047471 Ga0495684_0000099 Ga0495684_0000099_47526_49193 546
341 3300049574 Ga0501038_0065146 Ga0501038_0065146_470_2167 546
342 3300053085 Ga0495619_0001935 Ga0495619_0001935_6816_8483 546
343 3300005328 Ga0070676_10010608 Ga0070676_100106084 547
344 3300005330 Ga0070690_100014702 Ga0070690_1000147024 547
345 3300005347 Ga0070668_100038865 Ga0070668_1000388652 547
346 3300005353 Ga0070669_100003153 Ga0070669_1000031539 547
347 3300005356 Ga0070674_100024593 Ga0070674_1000245933 547
348 3300005440 Ga0070705_100003696 Ga0070705_1000036964 547
349 3300005459 Ga0068867_100033147 Ga0068867_1000331474 547
350 3300005471 Ga0070698_100092790 Ga0070698_1000927903 547
351 3300005518 Ga0070699_100154284 Ga0070699_1001542842 547
352 3300005544 Ga0070686_100001994 Ga0070686_1000019943 547
353 3300005545 Ga0070695_100006421 Ga0070695_1000064216 547
354 3300005546 Ga0070696_100044569 Ga0070696_1000445692 547
355 3300005549 Ga0070704_100027336 Ga0070704_1000273362 547
356 3300005578 Ga0068854_100001865 Ga0068854_1000018656 547
357 3300005615 Ga0070702_100026023 Ga0070702_1000260233 547
358 3300005718 Ga0068866_10017338 Ga0068866_100173383 547
359 3300005719 Ga0068861_100016441 Ga0068861_1000164412 547
360 3300005844 Ga0068862_100082995 Ga0068862_1000829952 547
361 3300005985 Ga0081539_10002859 Ga0081539_100028597 547
362 3300006237 Ga0097621_100020407 Ga0097621_1000204072 547
363 3300006871 Ga0075434_100000326 Ga0075434_10000032635 547
364 3300006871 Ga0075434_100006572 Ga0075434_1000065724 547
365 3300006871 Ga0075434_100072350 Ga0075434_1000723503 547
366 3300006914 Ga0075436_100002847 Ga0075436_1000028478 547
367 3300007076 Ga0075435_100000020 Ga0075435_10000002053 547
368 3300007076 Ga0075435_100001632 Ga0075435_1000016327 547
369 3300007076 Ga0075435_100089695 Ga0075435_1000896952 547
370 3300009093 Ga0105240_10107795 Ga0105240_101077952 547
371 3300009147 Ga0114129_10156529 Ga0114129_101565292 547
372 3300009148 Ga0105243_10034082 Ga0105243_100340822 547
373 3300009176 Ga0105242_10001588 Ga0105242_1000158813 547
374 3300009177 Ga0105248_10036629 Ga0105248_100366294 547
375 3300014325 Ga0163163_10078769 Ga0163163_100787692 547
376 3300014326 Ga0157380_10014366 Ga0157380_100143666 547
377 3300014969 Ga0157376_10042491 Ga0157376_100424912 547
378 3300025907 Ga0207645_10003184 Ga0207645_1000318410 547
379 3300025913 Ga0207695_10081330 Ga0207695_100813303 547
380 3300025935 Ga0207709_10040555 Ga0207709_100405552 547
381 3300025937 Ga0207669_10014742 Ga0207669_100147422 547
382 3300025938 Ga0207704_10001950 Ga0207704_100019505 547
383 3300025941 Ga0207711_10074096 Ga0207711_100740963 547
384 3300025941 Ga0207711_10079558 Ga0207711_100795583 547
385 3300025981 Ga0207640_10021448 Ga0207640_100214482 547
386 3300026075 Ga0207708_10011209 Ga0207708_100112092 547
387 3300026078 Ga0207702_10029858 Ga0207702_100298584 547
388 3300026089 Ga0207648_10012617 Ga0207648_100126176 547
389 3300026089 Ga0207648_10039599 Ga0207648_100395994 547
390 3300026118 Ga0207675_100015864 Ga0207675_1000158649 547
391 3300026118 Ga0207675_100026946 Ga0207675_1000269462 547
392 3300027907 Ga0207428_10004967 Ga0207428_100049679 547
393 3300034816 Ga0373930_0001110 Ga0373930_0001110_1421_3064 547
394 3300034817 Ga0373948_0001264 Ga0373948_0001264_1309_2952 547
395 3300035085 Ga0373929_0000371 Ga0373929_0000371_3970_5613 547
396 3300035090 Ga0373949_0000394 Ga0373949_0000394_10301_11944 547
397 3300035091 Ga0373951_0004663 Ga0373951_0004663_1014_2657 547
398 3300035092 Ga0373952_0000554 Ga0373952_0000554_532_2175 547
399 3300035112 Ga0373932_0005619 Ga0373932_0005619_1156_2799 547
400 3300035115 Ga0373941_0001988 Ga0373941_0001988_1756_3399 547
401 3300035170 Ga0373943_0040884 Ga0373943_0040884_587_2230 547
402 3300035207 Ga0373942_0000347 Ga0373942_0000347_4864_6507 547
403 3300035241 Ga0373961_0001167 Ga0373961_0001167_4909_6552 547
404 3300045051 Ga0451576_0009194 Ga0451576_0009194_7335_8978 547
405 3300046455 Ga0495603_0053257 Ga0495603_0053257_630_2273 547
406 3300049690 Ga0501261_002301 Ga0501261_002301_168_1898 547
407 3300050512 nmdc:mga0n895_38672_c1 nmdc:mga0n895_38672_c1_2204_3847 547
408 3300050512 nmdc:mga0n895_80_c1 nmdc:mga0n895_80_c1_27225_28868 547
409 3300050513 nmdc:mga0rr50_35_c1 nmdc:mga0rr50_35_c1_35536_37179 547
410 3300050514 nmdc:mga08x19_64_c1 nmdc:mga08x19_64_c1_21179_22822 547
411 3300005290 Ga0065712_10006010 Ga0065712_100060102 548
412 3300005339 Ga0070660_100027507 Ga0070660_1000275072 548
413 3300005355 Ga0070671_100012531 Ga0070671_1000125313 548
414 3300005365 Ga0070688_100003250 Ga0070688_1000032505 548
415 3300005367 Ga0070667_100004658 Ga0070667_1000046589 548
416 3300005441 Ga0070700_100099182 Ga0070700_1000991822 548
417 3300005518 Ga0070699_100004292 Ga0070699_1000042925 548
418 3300005543 Ga0070672_100138898 Ga0070672_1001388982 548
419 3300005842 Ga0068858_100001969 Ga0068858_1000019695 548
420 3300005843 Ga0068860_100079364 Ga0068860_1000793642 548
421 3300006237 Ga0097621_100012115 Ga0097621_1000121155 548
422 3300006358 Ga0068871_100001883 Ga0068871_10000188315 548
423 3300006852 Ga0075433_10060373 Ga0075433_100603732 548
424 3300006914 Ga0075436_100003971 Ga0075436_1000039712 548
425 3300007076 Ga0075435_100025399 Ga0075435_1000253993 548
426 3300009147 Ga0114129_10020263 Ga0114129_100202637 548
427 3300009147 Ga0114129_10023484 Ga0114129_100234843 548
428 3300009147 Ga0114129_10025400 Ga0114129_100254006 548
429 3300009147 Ga0114129_10025859 Ga0114129_100258592 548
430 3300009177 Ga0105248_10064650 Ga0105248_100646504 548
431 3300009551 Ga0105238_10024586 Ga0105238_100245864 548
432 3300013296 Ga0157374_10043802 Ga0157374_100438024 548
433 3300014968 Ga0157379_10019180 Ga0157379_100191805 548
434 3300014969 Ga0157376_10132899 Ga0157376_101328991 548
435 3300025912 Ga0207707_10021120 Ga0207707_100211205 548
436 3300025917 Ga0207660_10151673 Ga0207660_101516731 548
437 3300025919 Ga0207657_10053005 Ga0207657_100530053 548
438 3300025923 Ga0207681_10053578 Ga0207681_100535782 548
439 3300025931 Ga0207644_10034834 Ga0207644_100348342 548
440 3300025986 Ga0207658_10028715 Ga0207658_100287153 548
441 3300026088 Ga0207641_10000875 Ga0207641_1000087523 548
442 3300026089 Ga0207648_10073615 Ga0207648_100736152 548
443 3300028381 Ga0268264_10059144 Ga0268264_100591442 548
444 3300048913 Ga0496110_0101850 Ga0496110_0101850_795_2441 548
445 3300048915 Ga0496112_0091837 Ga0496112_0091837_89_1762 548
446 3300050507 nmdc:mga05p37_114780_c1 nmdc:mga05p37_114780_c1_1411_3057 548
447 3300050507 nmdc:mga05p37_32975_c1 nmdc:mga05p37_32975_c1_3629_5275 548
448 3300050507 nmdc:mga05p37_87908_c1 nmdc:mga05p37_87908_c1_453_2099 548
449 3300050513 nmdc:mga0rr50_53951_c1 nmdc:mga0rr50_53951_c1_582_2228 548
450 3300050514 nmdc:mga08x19_3873_c1 nmdc:mga08x19_3873_c1_4485_6137 548
451 3300050515 nmdc:mga0a205_8057_c1 nmdc:mga0a205_8057_c1_1194_2840 548

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02540

NAD_synthase

NAD synthase

340

589

0.96

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

71

326

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fiu-assembly2.cif.gz_D structure of nmn synthetase from francisella tularensis 0.9122 269 520
3p52-assembly1.cif.gz_A nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.8972 269 519
3p52-assembly1.cif.gz_B nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.8923 269 519
5ny2-assembly1.cif.gz_A a c145a mutant of nesterenkonia an1 amidase from the nitrilase superfamily 0.8866 1 254
2e18-assembly1.cif.gz_B crystal structure of project ph0182 from pyrococcus horikoshii ot3 0.8849 260 520
ID Description Score Start End Superfamily
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9301 268 457 3.40.50.620
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9203 268 457 3.40.50.620
3n05B03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9136 475 546 1.10.10.1510
3fiuC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9103 269 520 3.40.50.620
af_Q58747_4_258_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8965 267 520 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A534NNB0-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9833 271 405 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-Q02BE0-F1-model_v4 Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) 0.9767 1 546 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A2I0P0F2-F1-model_v4 Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) 0.9758 1 548 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A842KDF8-F1-model_v4 deleted 0.9751 1 546
AF-Q02BE0-F1-model_v4 Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) 0.9749 1 546 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435

Feature Viewer

pLDDT pTM Quality
90.18 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map