F446840

General Info

Members Datasets Scaffolds Average Seq Length
451 278 902 329

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0058810|Ga0453684_0058810_2620_3804
Length 394
Sequence MFSNFNISSILFLLILCKGKAHFKLLSTSKITIRNLGTKTSNSYKDPWYFSSQLCSIIFYPFKLLNYIIMKTRKLGNRGLEVSEIGLGCMGMSFGYGVIADKKQSIHLIRKAVELGVTFFDTAEVYGPYINEELVGEALEPFKSQVVIATKFGFNIGGEGLNSRPERIRKVAEDSLKRLKIDSIDLFYQHRVDPNVPIEDVAGTIKELIQEGKVKHFGLSEAGVNIIRRAHAVCPVTALQSEYSLWWREPEEEILPTLEELGIGFVPFSPLGKGFLTGKMTENTTFDSKDFRSTVPRLSPENIKANMVFVDLVKSVAQRKNVTPAQVAIAWVLAQKPWIVPIPGTRKIERLHENLGAASFELSANELLEIETAAAKIQAVGERYSGGSAKLINR

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
181 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
236 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
254 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
255 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
256 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
259 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
260 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
261 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
262 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
263 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
264 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
265 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
266 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
267 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
268 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
269 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
270 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
271 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
272 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
273 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
274 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
275 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
276 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
277 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
278 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 0
Isolates 3.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 1.55
Rhizoplane 3.99
Rhizosphere 80.27
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0058810 3300044712 Bacteria 4962
2 JGI24035J26624_1000182 3300002126 Bacteria 5852
3 JGI25154J39366_1000007 3300002738 Bacteria 335932
4 JGI25152J39213_1000012 3300002773 Bacteria 129486
5 JGI25150J39212_1000108 3300002774 Bacteria 48068
6 JGI25159J45721_1001321 3300002987 Bacteria 10461
7 JGI25151J46595_10000084 3300003187 Bacteria 129555
8 JGI25153J46596_10000063 3300003215 Bacteria 129500
9 JGI25153J46596_10000504 3300003215 Bacteria 24851
10 rootH1_10059383 3300003316 Bacteria 9660
11 JGI25160J50197_1000108 3300003354 Bacteria 77944
12 JGI25160J50197_1014563 3300003354 Bacteria 2625
13 JGI25161J50226_1000112 3300003374 Bacteria 63152
14 Ga0055531_10000258 3300003794 Bacteria 56433
15 Ga0055531_10021123 3300003794 Bacteria 2541
16 Ga0055543_1000080 3300004625 Bacteria 84865
17 Ga0065165_1003205 3300005262 Bacteria 11926
18 Ga0065165_1005499 3300005262 Bacteria 7086
19 Ga0065712_10013062 3300005290 Bacteria 3262
20 Ga0065712_10090454 3300005290 Bacteria 2420
21 Ga0065715_10139766 3300005293 Bacteria 1857
22 Ga0070658_10197124 3300005327 Bacteria 1698
23 Ga0070676_10092563 3300005328 Bacteria 1854
24 Ga0070683_100089623 3300005329 Bacteria 2887
25 Ga0070683_100091726 3300005329 Bacteria 2853
26 Ga0070690_100067714 3300005330 Bacteria 2314
27 Ga0068869_100135422 3300005334 Bacteria 1897
28 Ga0070680_100005804 3300005336 Bacteria 9368
29 Ga0070682_100001309 3300005337 Bacteria 14088
30 Ga0070682_100057607 3300005337 Bacteria 2448
31 Ga0070660_100007350 3300005339 Bacteria 7674
32 Ga0070660_100090123 3300005339 Bacteria 2417
33 Ga0070689_100000395 3300005340 Bacteria 25591
34 Ga0070689_100193329 3300005340 Bacteria 1657
35 Ga0070691_10001805 3300005341 Bacteria 9324
36 Ga0070687_100009565 3300005343 Bacteria 4160
37 Ga0070675_100000598 3300005354 Bacteria 24769
38 Ga0070675_100440715 3300005354 Bacteria 1167
39 Ga0070671_100161625 3300005355 Bacteria 1893
40 Ga0070671_100249797 3300005355 Bacteria 1507
41 Ga0070673_100081940 3300005364 Bacteria 2617
42 Ga0070688_100001011 3300005365 Bacteria 14134
43 Ga0070688_100040116 3300005365 Bacteria 2867
44 Ga0070659_100002460 3300005366 Bacteria 13169
45 Ga0070659_100107280 3300005366 Bacteria 2252
46 Ga0070709_10037067 3300005434 Bacteria 2975
47 Ga0070714_100035932 3300005435 Bacteria 4153
48 Ga0070714_100122485 3300005435 Bacteria 2315
49 Ga0070713_100004894 3300005436 Bacteria 9088
50 Ga0070713_100038010 3300005436 Bacteria 3896
51 Ga0070713_100069577 3300005436 Bacteria 2968
52 Ga0070713_100237197 3300005436 Bacteria 1660
53 Ga0070701_10067717 3300005438 Bacteria 1900
54 Ga0070700_100219417 3300005441 Bacteria 1346
55 Ga0070678_100048586 3300005456 Bacteria 3057
56 Ga0070681_10007286 3300005458 Bacteria 10798
57 Ga0070681_10067996 3300005458 Bacteria 3530
58 Ga0070681_10209261 3300005458 Bacteria 1867
59 Ga0070685_10115488 3300005466 Bacteria 1660
60 Ga0070707_100060590 3300005468 Bacteria 3629
61 Ga0070698_100031406 3300005471 Bacteria 5506
62 Ga0070679_100009754 3300005530 Bacteria 9083
63 Ga0070679_100012730 3300005530 Bacteria 8044
64 Ga0070684_100001143 3300005535 Bacteria 19068
65 Ga0070684_100112887 3300005535 Bacteria 2438
66 Ga0070684_100183921 3300005535 Bacteria 1900
67 Ga0068853_100042264 3300005539 Bacteria 3896
68 Ga0068853_100121456 3300005539 Bacteria 2331
69 Ga0068853_100143742 3300005539 Bacteria 2142
70 Ga0070695_100298259 3300005545 Bacteria 1190
71 Ga0070693_100002567 3300005547 Bacteria 8373
72 Ga0070693_100002819 3300005547 Bacteria 7998
73 Ga0070665_100023809 3300005548 Bacteria 6169
74 Ga0070665_100025651 3300005548 Bacteria 5937
75 Ga0070704_100003718 3300005549 Bacteria 8790
76 Ga0068855_100026723 3300005563 Bacteria 6906
77 Ga0068855_100194682 3300005563 Bacteria 2284
78 Ga0068855_100226334 3300005563 Bacteria 2096
79 Ga0068855_100293236 3300005563 Bacteria 1803
80 Ga0070664_100101912 3300005564 Bacteria 2497
81 Ga0068856_100005397 3300005614 Bacteria 12606
82 Ga0068856_100033113 3300005614 Bacteria 5060
83 Ga0068856_100041068 3300005614 Bacteria 4545
84 Ga0068856_100092095 3300005614 Bacteria 3016
85 Ga0068859_100018682 3300005617 Bacteria 6966
86 Ga0068864_100166805 3300005618 Bacteria 2005
87 Ga0068864_100248215 3300005618 Bacteria 1651
88 Ga0068861_100298442 3300005719 Bacteria 1394
89 Ga0068851_10008080 3300005834 Bacteria 4855
90 Ga0068863_100004030 3300005841 Bacteria 14504
91 Ga0068858_100021090 3300005842 Bacteria 6086
92 Ga0081455_10005221 3300005937 Bacteria 14288
93 Ga0070717_10026603 3300006028 Bacteria 4616
94 Ga0070717_10308616 3300006028 Bacteria 1408
95 Ga0075363_100033464 3300006048 Bacteria 2676
96 Ga0070715_10020616 3300006163 Bacteria 2545
97 Ga0070712_100196948 3300006175 Bacteria 1580
98 Ga0097621_100005210 3300006237 Bacteria 9138
99 Ga0097621_100228215 3300006237 Bacteria 1625
100 Ga0068871_100022918 3300006358 Bacteria 4820
101 Ga0075428_100020245 3300006844 Bacteria 7368
102 Ga0075433_10047435 3300006852 Bacteria 3736
103 Ga0075433_10401057 3300006852 Bacteria 1210
104 Ga0075434_100182235 3300006871 Bacteria 2120
105 Ga0075434_100187003 3300006871 Bacteria 2092
106 Ga0075434_100476712 3300006871 Bacteria 1269
107 Ga0075429_100057855 3300006880 Unclassified 3376
108 Ga0075429_100095632 3300006880 Bacteria 2590
109 Ga0068865_100123337 3300006881 Unclassified 1930
110 Ga0097620_100018682 3300006931 Bacteria 6966
111 Ga0105240_10010708 3300009093 Bacteria 12869
112 Ga0105240_10066303 3300009093 Bacteria 4479
113 Ga0105240_10245111 3300009093 Bacteria 2075
114 Ga0111539_10004178 3300009094 Bacteria 18949
115 Ga0114129_10060453 3300009147 Bacteria 5298
116 Ga0114129_10117163 3300009147 Bacteria 3671
117 Ga0114129_10302457 3300009147 Bacteria 2131
118 Ga0114129_10674816 3300009147 Bacteria 1331
119 Ga0105243_10176511 3300009148 Bacteria 1854
120 Ga0105241_10004586 3300009174 Bacteria 10223
121 Ga0105241_10132035 3300009174 Bacteria 2023
122 Ga0105248_10003006 3300009177 Bacteria 18710
123 Ga0105237_10138874 3300009545 Bacteria 2424
124 Ga0105249_10015138 3300009553 Bacteria 6825
125 Ga0105249_10067682 3300009553 Bacteria 3291
126 Ga0105239_10016619 3300010375 Bacteria 8136
127 Ga0105239_10166799 3300010375 Bacteria 2463
128 Ga0157373_10223755 3300013100 Bacteria 1328
129 Ga0157371_10000021 3300013102 Bacteria 301017
130 Ga0157371_10172343 3300013102 Bacteria 1547
131 Ga0157370_10001122 3300013104 Bacteria 33453
132 Ga0157369_10062400 3300013105 Bacteria 4016
133 Ga0157369_10184270 3300013105 Bacteria 2196
134 Ga0157374_10040148 3300013296 Bacteria 4309
135 Ga0157374_10049055 3300013296 Bacteria 3920
136 Ga0157374_10075697 3300013296 Bacteria 3181
137 Ga0157374_10119805 3300013296 Bacteria 2539
138 Ga0157374_10167111 3300013296 Bacteria 2144
139 Ga0157378_10086599 3300013297 Bacteria 2840
140 Ga0157378_10204102 3300013297 Bacteria 1871
141 Ga0157372_10117077 3300013307 Bacteria 3056
142 Ga0157372_10128720 3300013307 Bacteria 2911
143 Ga0157372_10213715 3300013307 Bacteria 2235
144 Ga0157372_10299568 3300013307 Bacteria 1870
145 Ga0157375_10008469 3300013308 Bacteria 9009
146 Ga0157375_10067063 3300013308 Bacteria 3585
147 Ga0163163_10204678 3300014325 Bacteria 2022
148 Ga0157380_10058727 3300014326 Bacteria 3067
149 Ga0157379_10000854 3300014968 Bacteria 24699
150 Ga0157379_10103347 3300014968 Bacteria 2557
151 Ga0157376_10030374 3300014969 Bacteria 4315
152 Ga0157376_10072601 3300014969 Bacteria 2928
153 Ga0182005_1000120 3300015265 Bacteria 57067
154 Ga0213872_10037602 3300021361 Bacteria 2210
155 Ga0209436_103258 3300025208 Bacteria 4388
156 Ga0207425_1000011 3300025245 Bacteria 550735
157 Ga0209646_1000002 3300025246 Bacteria 1425781
158 Ga0209026_1000086 3300025250 Bacteria 185551
159 Ga0209148_1009507 3300025254 Bacteria 1890
160 Ga0209129_1000031 3300025258 Bacteria 383039
161 Ga0207666_1008841 3300025271 Bacteria 1352
162 Ga0209130_1000108 3300025284 Bacteria 133733
163 Ga0209025_1000012 3300025294 Bacteria 924362
164 Ga0209758_1000018 3300025297 Bacteria 753320
165 Ga0209758_1000383 3300025297 Bacteria 76487
166 Ga0209758_1001590 3300025297 Bacteria 25985
167 Ga0207426_1000082 3300025302 Bacteria 298939
168 Ga0207426_1000419 3300025302 Bacteria 69963
169 Ga0207426_1003236 3300025302 Bacteria 9134
170 Ga0209257_1000008 3300025304 Bacteria 1294570
171 Ga0207697_10000204 3300025315 Bacteria 31796
172 Ga0207697_10002759 3300025315 Bacteria 8964
173 Ga0207697_10002922 3300025315 Bacteria 8648
174 Ga0207697_10014868 3300025315 Bacteria 3223
175 Ga0207656_10000301 3300025321 Bacteria 17112
176 Ga0207647_10043212 3300025904 Bacteria 2820
177 Ga0207685_10069987 3300025905 Bacteria 1419
178 Ga0207699_10036829 3300025906 Bacteria 2792
179 Ga0207699_10092568 3300025906 Bacteria 1900
180 Ga0207643_10003323 3300025908 Bacteria 8670
181 Ga0207684_10021783 3300025910 Bacteria 5472
182 Ga0207654_10003637 3300025911 Bacteria 7776
183 Ga0207707_10000738 3300025912 Bacteria 32353
184 Ga0207707_10086485 3300025912 Bacteria 2739
185 Ga0207707_10149277 3300025912 Bacteria 2044
186 Ga0207695_10012683 3300025913 Bacteria 10093
187 Ga0207695_10253293 3300025913 Bacteria 1659
188 Ga0207693_10068209 3300025915 Bacteria 2784
189 Ga0207663_10079698 3300025916 Bacteria 2139
190 Ga0207660_10020093 3300025917 Bacteria 4478
191 Ga0207660_10046957 3300025917 Bacteria 3051
192 Ga0207662_10114238 3300025918 Bacteria 1687
193 Ga0207657_10125330 3300025919 Bacteria 2110
194 Ga0207657_10137223 3300025919 Bacteria 2000
195 Ga0207657_10243340 3300025919 Bacteria 1436
196 Ga0207652_10009851 3300025921 Bacteria 7689
197 Ga0207652_10122942 3300025921 Bacteria 2310
198 Ga0207650_10006960 3300025925 Bacteria 7711
199 Ga0207659_10021256 3300025926 Bacteria 4304
200 Ga0207659_10178516 3300025926 Bacteria 1680
201 Ga0207700_10004205 3300025928 Bacteria 8453
202 Ga0207700_10005585 3300025928 Bacteria 7548
203 Ga0207700_10013653 3300025928 Bacteria 5294
204 Ga0207664_10072402 3300025929 Bacteria 2778
205 Ga0207644_10031286 3300025931 Bacteria 3707
206 Ga0207690_10030837 3300025932 Bacteria 3425
207 Ga0207665_10071290 3300025939 Bacteria 2372
208 Ga0207691_10035077 3300025940 Bacteria 4661
209 Ga0207711_10324859 3300025941 Bacteria 1422
210 Ga0207689_10155225 3300025942 Bacteria 1887
211 Ga0207661_10333853 3300025944 Bacteria 1365
212 Ga0207667_10039128 3300025949 Bacteria 5056
213 Ga0207667_10069337 3300025949 Bacteria 3670
214 Ga0207667_10176661 3300025949 Bacteria 2193
215 Ga0207667_10243784 3300025949 Bacteria 1839
216 Ga0207667_10306589 3300025949 Bacteria 1622
217 Ga0207667_10363359 3300025949 Bacteria 1476
218 Ga0207651_10250330 3300025960 Bacteria 1449
219 Ga0207712_10013239 3300025961 Bacteria 5286
220 Ga0207658_10466835 3300025986 Bacteria 1120
221 Ga0207703_10028426 3300026035 Bacteria 4408
222 Ga0207639_10030539 3300026041 Bacteria 3952
223 Ga0207639_10067542 3300026041 Bacteria 2782
224 Ga0207639_10115116 3300026041 Bacteria 2198
225 Ga0207702_10022775 3300026078 Bacteria 5196
226 Ga0207702_10029448 3300026078 Bacteria 4569
227 Ga0207641_10069915 3300026088 Bacteria 3016
228 Ga0207641_10496601 3300026088 Bacteria 1184
229 Ga0207648_10053798 3300026089 Bacteria 3518
230 Ga0207676_10002901 3300026095 Bacteria 12223
231 Ga0207683_10038163 3300026121 Bacteria 4184
232 Ga0207683_10111207 3300026121 Bacteria 2453
233 Ga0207698_10198264 3300026142 Bacteria 1795
234 Ga0209281_1000043 3300027111 Bacteria 341543
235 Ga0268266_10010978 3300028379 Bacteria 7881
236 Ga0265334_10038721 3300028573 Bacteria 1874
237 Ga0265323_10000043 3300028653 Bacteria 69334
238 Ga0265323_10012113 3300028653 Bacteria 3464
239 Ga0265323_10017070 3300028653 Bacteria 2825
240 Ga0307515_10202776 3300028794 Bacteria 1854
241 Ga0265338_10001725 3300028800 Bacteria 34604
242 Ga0307511_10021213 3300030521 Bacteria 6128
243 Ga0265330_10023505 3300031235 Bacteria 2799
244 Ga0265330_10082065 3300031235 Bacteria 1388
245 Ga0265332_10006816 3300031238 Bacteria 5177
246 Ga0265332_10017583 3300031238 Bacteria 3154
247 Ga0265325_10000469 3300031241 Bacteria 29327
248 Ga0265339_10000528 3300031249 Bacteria 29903
249 Ga0265339_10019404 3300031249 Bacteria 3992
250 Ga0265331_10000014 3300031250 Bacteria 294002
251 Ga0265331_10016835 3300031250 Bacteria 3828
252 Ga0265327_10000013 3300031251 Bacteria 519549
253 Ga0265327_10001052 3300031251 Bacteria 38599
254 Ga0265316_10001220 3300031344 Bacteria 27686
255 Ga0265316_10001969 3300031344 Bacteria 21605
256 Ga0265316_10008412 3300031344 Bacteria 9581
257 Ga0265316_10019096 3300031344 Bacteria 5872
258 Ga0307513_10104486 3300031456 Bacteria 2846
259 Ga0265313_10000391 3300031595 Bacteria 47272
260 Ga0265314_10000164 3300031711 Bacteria 101134
261 Ga0265342_10000432 3300031712 Bacteria 45867
262 Ga0265342_10003727 3300031712 Bacteria 12329
263 Ga0265342_10005198 3300031712 Bacteria 10001
264 Ga0265342_10013392 3300031712 Bacteria 5505
265 Ga0265342_10043877 3300031712 Bacteria 2697
266 Ga0307412_10105988 3300031911 Bacteria 1998
267 Ga0307415_100044666 3300032126 Bacteria 2964
268 Ga0373955_0266121 3300035172 Bacteria 1030
269 Ga0373935_0033176 3300035692 Bacteria 3212
270 Ga0316582_0197933 3300036647 Bacteria 1370
271 Ga0316584_0190818 3300036712 Bacteria 1515
272 Ga0395905_0000873 3300037471 Bacteria 39333
273 Ga0395905_0058264 3300037471 Bacteria 3612
274 Ga0395905_0146736 3300037471 Bacteria 2220
275 Ga0436364_0326496 3300037853 Bacteria 1046
276 Ga0436361_0145631 3300039447 Bacteria 18777
277 Ga0436361_0650330 3300039447 Bacteria 20279
278 Ga0439445_0039214 3300042004 Bacteria 1255
279 Ga0451577_0059090 3300042876 Bacteria 3419
280 Ga0451577_0079623 3300042876 Bacteria 2921
281 Ga0451577_0124258 3300042876 Bacteria 2312
282 Ga0451577_0124647 3300042876 Bacteria 2308
283 Ga0451577_0344446 3300042876 Bacteria 1352
284 Ga0453683_0005052 3300044673 Bacteria 9263
285 Ga0453683_0026143 3300044673 Bacteria 3707
286 Ga0453683_0215615 3300044673 Bacteria 1220
287 Ga0466961_0244943 3300044693 Bacteria 1101
288 Ga0453684_0000256 3300044712 Bacteria 228862
289 Ga0453684_0002477 3300044712 Bacteria 44621
290 Ga0453684_0005517 3300044712 Bacteria 24968
291 Ga0453684_0009549 3300044712 Bacteria 16937
292 Ga0453684_0017610 3300044712 Bacteria 11049
293 Ga0453684_0038978 3300044712 Bacteria 6482
294 Ga0453684_0045112 3300044712 Bacteria 5885
295 Ga0453684_0080732 3300044712 Bacteria 4059
296 Ga0453684_0164787 3300044712 Bacteria 2618
297 Ga0453684_0165302 3300044712 Bacteria 2613
298 Ga0453684_0229486 3300044712 Bacteria 2144
299 Ga0453684_0275059 3300044712 Bacteria 1923
300 Ga0466959_0000718 3300045049 Bacteria 19330
301 Ga0451576_0013428 3300045051 Bacteria 9164
302 Ga0451576_0050927 3300045051 Bacteria 4342
303 Ga0451576_0081097 3300045051 Bacteria 3374
304 Ga0451576_0126404 3300045051 Bacteria 2664
305 Ga0451576_0149186 3300045051 Bacteria 2438
306 Ga0451576_0168191 3300045051 Bacteria 2288
307 Ga0451576_0534478 3300045051 Bacteria 1232
308 Ga0466967_0211965 3300045976 Bacteria 1837
309 Ga0495617_039199 3300046452 Bacteria 1584
310 Ga0495627_001551 3300046453 Bacteria 13100
311 Ga0495590_0020612 3300046457 Bacteria 2342
312 Ga0495591_003435 3300046458 Bacteria 8185
313 Ga0495638_0113685 3300046460 Bacteria 1606
314 Ga0495638_0124926 3300046460 Bacteria 1517
315 Ga0495650_0000006 3300046471 Bacteria 721347
316 Ga0495650_0000380 3300046471 Bacteria 76955
317 Ga0495650_0002433 3300046471 Bacteria 15084
318 Ga0495605_0116864 3300046474 Bacteria 1212
319 Ga0495585_0033339 3300046492 Bacteria 2915
320 Ga0495596_0002034 3300046500 Bacteria 11104
321 Ga0495596_0052393 3300046500 Bacteria 1597
322 Ga0495607_0028078 3300046501 Bacteria 3475
323 Ga0495607_0120339 3300046501 Bacteria 1379
324 Ga0495583_0000453 3300046506 Bacteria 61239
325 Ga0495583_0029285 3300046506 Bacteria 2696
326 Ga0495606_0001315 3300046507 Bacteria 34120
327 Ga0495606_0021908 3300046507 Bacteria 4673
328 Ga0495610_0000022 3300046512 Bacteria 317107
329 Ga0495610_0000131 3300046512 Bacteria 82558
330 Ga0495620_0000620 3300046515 Bacteria 22120
331 Ga0495620_0016344 3300046515 Bacteria 3726
332 Ga0495630_0307012 3300046517 Bacteria 1212
333 Ga0495632_0002664 3300046519 Bacteria 13387
334 Ga0495637_0086969 3300046520 Bacteria 1238
335 Ga0495643_0000004 3300046522 Bacteria 519944
336 Ga0495643_0007831 3300046522 Bacteria 6830
337 Ga0495644_0005025 3300046523 Bacteria 5173
338 Ga0495648_0000145 3300046524 Bacteria 84829
339 Ga0495648_0027044 3300046524 Bacteria 3849
340 Ga0495648_0029764 3300046524 Bacteria 3619
341 Ga0495648_0055658 3300046524 Bacteria 2384
342 Ga0495642_0003666 3300046528 Bacteria 6031
343 Ga0495642_0007399 3300046528 Bacteria 4209
344 Ga0495642_0042174 3300046528 Bacteria 1858
345 Ga0495654_0000183 3300046530 Bacteria 61398
346 Ga0495609_0004104 3300046538 Bacteria 8104
347 Ga0495633_0028906 3300046558 Bacteria 2698
348 Ga0495668_0059419 3300046616 Bacteria 2110
349 Ga0495611_0024452 3300046648 Bacteria 2628
350 Ga0495625_0004815 3300046660 Bacteria 12619
351 Ga0495625_0082381 3300046660 Bacteria 2238
352 Ga0495625_0165078 3300046660 Bacteria 1481
353 Ga0495661_0015547 3300046665 Bacteria 5078
354 Ga0495661_0018593 3300046665 Bacteria 4566
355 Ga0495661_0114658 3300046665 Bacteria 1497
356 Ga0495658_0041064 3300046683 Bacteria 2575
357 Ga0495669_0021194 3300046684 Bacteria 2818
358 Ga0495671_0001370 3300046692 Bacteria 16536
359 Ga0495671_0002853 3300046692 Bacteria 10813
360 Ga0495671_0031313 3300046692 Bacteria 2720
361 Ga0495649_0003534 3300046694 Bacteria 10508
362 Ga0495649_0008810 3300046694 Bacteria 6046
363 Ga0495649_0040989 3300046694 Bacteria 2533
364 Ga0495649_0071370 3300046694 Bacteria 1861
365 Ga0495589_0006584 3300046794 Bacteria 6122
366 Ga0495660_0000058 3300046810 Bacteria 133170
367 Ga0495660_0017895 3300046810 Bacteria 4076
368 Ga0495660_0020035 3300046810 Bacteria 3836
369 Ga0495581_0074118 3300047315 Bacteria 1970
370 Ga0495672_0000106 3300047320 Bacteria 132815
371 Ga0495672_0008421 3300047320 Bacteria 7614
372 Ga0495673_0000371 3300047469 Bacteria 53983
373 Ga0495673_0016572 3300047469 Bacteria 3765
374 Ga0495673_0095969 3300047469 Bacteria 1205
375 Ga0495681_0000209 3300047470 Bacteria 48667
376 Ga0495681_0036306 3300047470 Bacteria 2438
377 Ga0495686_0002726 3300047472 Bacteria 16152
378 Ga0495626_0002490 3300048091 Bacteria 12732
379 Ga0496104_0015254 3300048907 Bacteria 6958
380 Ga0496104_0199874 3300048907 Bacteria 1911
381 Ga0496104_0303099 3300048907 Bacteria 1510
382 Ga0496104_0410505 3300048907 Bacteria 1266
383 Ga0496105_0126089 3300048908 Bacteria 2111
384 Ga0496108_0190359 3300048911 Bacteria 1778
385 Ga0496109_0295868 3300048912 Bacteria 1526
386 Ga0496109_0300620 3300048912 Bacteria 1513
387 Ga0496109_0420828 3300048912 Bacteria 1262
388 Ga0496109_0516305 3300048912 Bacteria 1128
389 Ga0496110_0142322 3300048913 Bacteria 2168
390 Ga0496112_0098474 3300048915 Bacteria 2894
391 Ga0496114_0347423 3300048917 Bacteria 1312
392 Ga0496115_0193108 3300048918 Bacteria 1682
393 Ga0496115_0345993 3300048918 Bacteria 1213
394 Ga0496118_0183902 3300048921 Bacteria 1259
395 Ga0496120_0067224 3300048923 Bacteria 1981
396 Ga0496121_0000010 3300048924 Bacteria 793488
397 Ga0496121_0022227 3300048924 Bacteria 6168
398 Ga0496122_0109462 3300048925 Bacteria 1818
399 Ga0496123_0020681 3300048926 Bacteria 5141
400 Ga0496125_0054500 3300048928 Bacteria 3267
401 Ga0496126_0001017 3300048929 Bacteria 47604
402 Ga0495678_000088 3300049459 Bacteria 115071
403 Ga0495678_012805 3300049459 Bacteria 3961
404 Ga0495682_0000033 3300049460 Bacteria 132733
405 Ga0501067_0067406 3300049583 Bacteria 1981
406 Ga0501070_0004460 3300049586 Bacteria 12024
407 Ga0501073_0133430 3300049589 Bacteria 1721
408 Ga0501074_0005710 3300049590 Bacteria 8970
409 Ga0501080_0009792 3300049742 Bacteria 8757
410 Ga0501241_004031 3300049758 Bacteria 2764
411 Ga0501035_0064644 3300049822 Bacteria 3251
412 nmdc:mga0yw44_9321_c1 3300050492 Bacteria 4954
413 nmdc:mga05p37_112256_c1 3300050507 Bacteria 3352
414 nmdc:mga05p37_249222_c1 3300050507 Bacteria 2131
415 nmdc:mga09592_301311_c1 3300050508 Bacteria 1390
416 nmdc:mga08y16_16266_c1 3300050511 Bacteria 7821
417 nmdc:mga0n895_130861_c1 3300050512 Bacteria 2534
418 nmdc:mga0n895_167807_c1 3300050512 Bacteria 2227
419 nmdc:mga0a205_1447_c1 3300050515 Bacteria 20218
420 nmdc:mga0a205_394068_c1 3300050515 Bacteria 1249
421 Ga0495619_0229254 3300053085 Bacteria 1287
422 Ga0500556_0001001 3300053104 Bacteria 14912
423 Ga0500556_0056929 3300053104 Bacteria 1429
424 Ga0500595_000049 3300053119 Bacteria 88728
425 Ga0500618_000096 3300053125 Bacteria 72003
426 Ga0500618_001355 3300053125 Bacteria 11160
427 Ga0500621_000013 3300053126 Bacteria 132878
428 Ga0500652_091583 3300053131 Bacteria 1270
429 Ga0500564_000058 3300053138 Bacteria 29614
430 Ga0500568_0012405 3300053139 Bacteria 3923
431 Ga0500577_0068228 3300053142 Bacteria 1388
432 Ga0500622_0000209 3300053156 Bacteria 61889
433 Ga0500624_000165 3300053157 Bacteria 26716
434 2511127642 2510917021 Bacteria 5705459
435 2524458479 2524023209 Bacteria 6679728
436 2599718794 2599185236 Bacteria 6875203
437 2600194366 2599185352 Bacteria 7228948
438 2600376687 2600254933 Bacteria 4750527
439 2644242708 2643221643 Bacteria 5749658
440 2809124367 2808606414 Bacteria 4917181
441 2819578294 2818991442 Bacteria 8318214
442 2819685883 2818991461 Bacteria 7026071
443 2821138751 2821136567 Bacteria 8080116
444 2838739683 2838736955 Bacteria 5760694
445 2841844193 2841840854 Bacteria 5761912
446 2842143914 2842140634 Bacteria 5759631
447 2842300264 2842298080 Bacteria 6123127
448 2842361218 2842357229 Bacteria 6485165
449 2852391707 2852387548 Bacteria 8025568
450 2904472668 2904467357 Bacteria 8057758
451 2929239475 2929239360 Bacteria 7745570
452 Ga0453684_0058810
453 JGI24035J26624_1000182
454 JGI25154J39366_1000007
455 JGI25152J39213_1000012
456 JGI25150J39212_1000108
457 JGI25159J45721_1001321
458 JGI25151J46595_10000084
459 JGI25153J46596_10000063
460 JGI25153J46596_10000504
461 rootH1_10059383
462 JGI25160J50197_1000108
463 JGI25160J50197_1014563
464 JGI25161J50226_1000112
465 Ga0055531_10000258
466 Ga0055531_10021123
467 Ga0055543_1000080
468 Ga0065165_1003205
469 Ga0065165_1005499
470 Ga0065712_10013062
471 Ga0065712_10090454
472 Ga0065715_10139766
473 Ga0070658_10197124
474 Ga0070676_10092563
475 Ga0070683_100089623
476 Ga0070683_100091726
477 Ga0070690_100067714
478 Ga0068869_100135422
479 Ga0070680_100005804
480 Ga0070682_100001309
481 Ga0070682_100057607
482 Ga0070660_100007350
483 Ga0070660_100090123
484 Ga0070689_100000395
485 Ga0070689_100193329
486 Ga0070691_10001805
487 Ga0070687_100009565
488 Ga0070675_100000598
489 Ga0070675_100440715
490 Ga0070671_100161625
491 Ga0070671_100249797
492 Ga0070673_100081940
493 Ga0070688_100001011
494 Ga0070688_100040116
495 Ga0070659_100002460
496 Ga0070659_100107280
497 Ga0070709_10037067
498 Ga0070714_100035932
499 Ga0070714_100122485
500 Ga0070713_100004894
501 Ga0070713_100038010
502 Ga0070713_100069577
503 Ga0070713_100237197
504 Ga0070701_10067717
505 Ga0070700_100219417
506 Ga0070678_100048586
507 Ga0070681_10007286
508 Ga0070681_10067996
509 Ga0070681_10209261
510 Ga0070685_10115488
511 Ga0070707_100060590
512 Ga0070698_100031406
513 Ga0070679_100009754
514 Ga0070679_100012730
515 Ga0070684_100001143
516 Ga0070684_100112887
517 Ga0070684_100183921
518 Ga0068853_100042264
519 Ga0068853_100121456
520 Ga0068853_100143742
521 Ga0070695_100298259
522 Ga0070693_100002567
523 Ga0070693_100002819
524 Ga0070665_100023809
525 Ga0070665_100025651
526 Ga0070704_100003718
527 Ga0068855_100026723
528 Ga0068855_100194682
529 Ga0068855_100226334
530 Ga0068855_100293236
531 Ga0070664_100101912
532 Ga0068856_100005397
533 Ga0068856_100033113
534 Ga0068856_100041068
535 Ga0068856_100092095
536 Ga0068859_100018682
537 Ga0068864_100166805
538 Ga0068864_100248215
539 Ga0068861_100298442
540 Ga0068851_10008080
541 Ga0068863_100004030
542 Ga0068858_100021090
543 Ga0081455_10005221
544 Ga0070717_10026603
545 Ga0070717_10308616
546 Ga0075363_100033464
547 Ga0070715_10020616
548 Ga0070712_100196948
549 Ga0097621_100005210
550 Ga0097621_100228215
551 Ga0068871_100022918
552 Ga0075428_100020245
553 Ga0075433_10047435
554 Ga0075433_10401057
555 Ga0075434_100182235
556 Ga0075434_100187003
557 Ga0075434_100476712
558 Ga0075429_100057855
559 Ga0075429_100095632
560 Ga0068865_100123337
561 Ga0097620_100018682
562 Ga0105240_10010708
563 Ga0105240_10066303
564 Ga0105240_10245111
565 Ga0111539_10004178
566 Ga0114129_10060453
567 Ga0114129_10117163
568 Ga0114129_10302457
569 Ga0114129_10674816
570 Ga0105243_10176511
571 Ga0105241_10004586
572 Ga0105241_10132035
573 Ga0105248_10003006
574 Ga0105237_10138874
575 Ga0105249_10015138
576 Ga0105249_10067682
577 Ga0105239_10016619
578 Ga0105239_10166799
579 Ga0157373_10223755
580 Ga0157371_10000021
581 Ga0157371_10172343
582 Ga0157370_10001122
583 Ga0157369_10062400
584 Ga0157369_10184270
585 Ga0157374_10040148
586 Ga0157374_10049055
587 Ga0157374_10075697
588 Ga0157374_10119805
589 Ga0157374_10167111
590 Ga0157378_10086599
591 Ga0157378_10204102
592 Ga0157372_10117077
593 Ga0157372_10128720
594 Ga0157372_10213715
595 Ga0157372_10299568
596 Ga0157375_10008469
597 Ga0157375_10067063
598 Ga0163163_10204678
599 Ga0157380_10058727
600 Ga0157379_10000854
601 Ga0157379_10103347
602 Ga0157376_10030374
603 Ga0157376_10072601
604 Ga0182005_1000120
605 Ga0213872_10037602
606 Ga0209436_103258
607 Ga0207425_1000011
608 Ga0209646_1000002
609 Ga0209026_1000086
610 Ga0209148_1009507
611 Ga0209129_1000031
612 Ga0207666_1008841
613 Ga0209130_1000108
614 Ga0209025_1000012
615 Ga0209758_1000018
616 Ga0209758_1000383
617 Ga0209758_1001590
618 Ga0207426_1000082
619 Ga0207426_1000419
620 Ga0207426_1003236
621 Ga0209257_1000008
622 Ga0207697_10000204
623 Ga0207697_10002759
624 Ga0207697_10002922
625 Ga0207697_10014868
626 Ga0207656_10000301
627 Ga0207647_10043212
628 Ga0207685_10069987
629 Ga0207699_10036829
630 Ga0207699_10092568
631 Ga0207643_10003323
632 Ga0207684_10021783
633 Ga0207654_10003637
634 Ga0207707_10000738
635 Ga0207707_10086485
636 Ga0207707_10149277
637 Ga0207695_10012683
638 Ga0207695_10253293
639 Ga0207693_10068209
640 Ga0207663_10079698
641 Ga0207660_10020093
642 Ga0207660_10046957
643 Ga0207662_10114238
644 Ga0207657_10125330
645 Ga0207657_10137223
646 Ga0207657_10243340
647 Ga0207652_10009851
648 Ga0207652_10122942
649 Ga0207650_10006960
650 Ga0207659_10021256
651 Ga0207659_10178516
652 Ga0207700_10004205
653 Ga0207700_10005585
654 Ga0207700_10013653
655 Ga0207664_10072402
656 Ga0207644_10031286
657 Ga0207690_10030837
658 Ga0207665_10071290
659 Ga0207691_10035077
660 Ga0207711_10324859
661 Ga0207689_10155225
662 Ga0207661_10333853
663 Ga0207667_10039128
664 Ga0207667_10069337
665 Ga0207667_10176661
666 Ga0207667_10243784
667 Ga0207667_10306589
668 Ga0207667_10363359
669 Ga0207651_10250330
670 Ga0207712_10013239
671 Ga0207658_10466835
672 Ga0207703_10028426
673 Ga0207639_10030539
674 Ga0207639_10067542
675 Ga0207639_10115116
676 Ga0207702_10022775
677 Ga0207702_10029448
678 Ga0207641_10069915
679 Ga0207641_10496601
680 Ga0207648_10053798
681 Ga0207676_10002901
682 Ga0207683_10038163
683 Ga0207683_10111207
684 Ga0207698_10198264
685 Ga0209281_1000043
686 Ga0268266_10010978
687 Ga0265334_10038721
688 Ga0265323_10000043
689 Ga0265323_10012113
690 Ga0265323_10017070
691 Ga0307515_10202776
692 Ga0265338_10001725
693 Ga0307511_10021213
694 Ga0265330_10023505
695 Ga0265330_10082065
696 Ga0265332_10006816
697 Ga0265332_10017583
698 Ga0265325_10000469
699 Ga0265339_10000528
700 Ga0265339_10019404
701 Ga0265331_10000014
702 Ga0265331_10016835
703 Ga0265327_10000013
704 Ga0265327_10001052
705 Ga0265316_10001220
706 Ga0265316_10001969
707 Ga0265316_10008412
708 Ga0265316_10019096
709 Ga0307513_10104486
710 Ga0265313_10000391
711 Ga0265314_10000164
712 Ga0265342_10000432
713 Ga0265342_10003727
714 Ga0265342_10005198
715 Ga0265342_10013392
716 Ga0265342_10043877
717 Ga0307412_10105988
718 Ga0307415_100044666
719 Ga0373955_0266121
720 Ga0373935_0033176
721 Ga0316582_0197933
722 Ga0316584_0190818
723 Ga0395905_0000873
724 Ga0395905_0058264
725 Ga0395905_0146736
726 Ga0436364_0326496
727 Ga0436361_0145631
728 Ga0436361_0650330
729 Ga0439445_0039214
730 Ga0451577_0059090
731 Ga0451577_0079623
732 Ga0451577_0124258
733 Ga0451577_0124647
734 Ga0451577_0344446
735 Ga0453683_0005052
736 Ga0453683_0026143
737 Ga0453683_0215615
738 Ga0466961_0244943
739 Ga0453684_0000256
740 Ga0453684_0002477
741 Ga0453684_0005517
742 Ga0453684_0009549
743 Ga0453684_0017610
744 Ga0453684_0038978
745 Ga0453684_0045112
746 Ga0453684_0080732
747 Ga0453684_0164787
748 Ga0453684_0165302
749 Ga0453684_0229486
750 Ga0453684_0275059
751 Ga0466959_0000718
752 Ga0451576_0013428
753 Ga0451576_0050927
754 Ga0451576_0081097
755 Ga0451576_0126404
756 Ga0451576_0149186
757 Ga0451576_0168191
758 Ga0451576_0534478
759 Ga0466967_0211965
760 Ga0495617_039199
761 Ga0495627_001551
762 Ga0495590_0020612
763 Ga0495591_003435
764 Ga0495638_0113685
765 Ga0495638_0124926
766 Ga0495650_0000006
767 Ga0495650_0000380
768 Ga0495650_0002433
769 Ga0495605_0116864
770 Ga0495585_0033339
771 Ga0495596_0002034
772 Ga0495596_0052393
773 Ga0495607_0028078
774 Ga0495607_0120339
775 Ga0495583_0000453
776 Ga0495583_0029285
777 Ga0495606_0001315
778 Ga0495606_0021908
779 Ga0495610_0000022
780 Ga0495610_0000131
781 Ga0495620_0000620
782 Ga0495620_0016344
783 Ga0495630_0307012
784 Ga0495632_0002664
785 Ga0495637_0086969
786 Ga0495643_0000004
787 Ga0495643_0007831
788 Ga0495644_0005025
789 Ga0495648_0000145
790 Ga0495648_0027044
791 Ga0495648_0029764
792 Ga0495648_0055658
793 Ga0495642_0003666
794 Ga0495642_0007399
795 Ga0495642_0042174
796 Ga0495654_0000183
797 Ga0495609_0004104
798 Ga0495633_0028906
799 Ga0495668_0059419
800 Ga0495611_0024452
801 Ga0495625_0004815
802 Ga0495625_0082381
803 Ga0495625_0165078
804 Ga0495661_0015547
805 Ga0495661_0018593
806 Ga0495661_0114658
807 Ga0495658_0041064
808 Ga0495669_0021194
809 Ga0495671_0001370
810 Ga0495671_0002853
811 Ga0495671_0031313
812 Ga0495649_0003534
813 Ga0495649_0008810
814 Ga0495649_0040989
815 Ga0495649_0071370
816 Ga0495589_0006584
817 Ga0495660_0000058
818 Ga0495660_0017895
819 Ga0495660_0020035
820 Ga0495581_0074118
821 Ga0495672_0000106
822 Ga0495672_0008421
823 Ga0495673_0000371
824 Ga0495673_0016572
825 Ga0495673_0095969
826 Ga0495681_0000209
827 Ga0495681_0036306
828 Ga0495686_0002726
829 Ga0495626_0002490
830 Ga0496104_0015254
831 Ga0496104_0199874
832 Ga0496104_0303099
833 Ga0496104_0410505
834 Ga0496105_0126089
835 Ga0496108_0190359
836 Ga0496109_0295868
837 Ga0496109_0300620
838 Ga0496109_0420828
839 Ga0496109_0516305
840 Ga0496110_0142322
841 Ga0496112_0098474
842 Ga0496114_0347423
843 Ga0496115_0193108
844 Ga0496115_0345993
845 Ga0496118_0183902
846 Ga0496120_0067224
847 Ga0496121_0000010
848 Ga0496121_0022227
849 Ga0496122_0109462
850 Ga0496123_0020681
851 Ga0496125_0054500
852 Ga0496126_0001017
853 Ga0495678_000088
854 Ga0495678_012805
855 Ga0495682_0000033
856 Ga0501067_0067406
857 Ga0501070_0004460
858 Ga0501073_0133430
859 Ga0501074_0005710
860 Ga0501080_0009792
861 Ga0501241_004031
862 Ga0501035_0064644
863 nmdc:mga0yw44_9321_c1
864 nmdc:mga05p37_112256_c1
865 nmdc:mga05p37_249222_c1
866 nmdc:mga09592_301311_c1
867 nmdc:mga08y16_16266_c1
868 nmdc:mga0n895_130861_c1
869 nmdc:mga0n895_167807_c1
870 nmdc:mga0a205_1447_c1
871 nmdc:mga0a205_394068_c1
872 Ga0495619_0229254
873 Ga0500556_0001001
874 Ga0500556_0056929
875 Ga0500595_000049
876 Ga0500618_000096
877 Ga0500618_001355
878 Ga0500621_000013
879 Ga0500652_091583
880 Ga0500564_000058
881 Ga0500568_0012405
882 Ga0500577_0068228
883 Ga0500622_0000209
884 Ga0500624_000165
885 2511127642
886 2524458479
887 2599718794
888 2600194366
889 2600376687
890 2644242708
891 2809124367
892 2819578294
893 2819685883
894 2821138751
895 2838739683
896 2841844193
897 2842143914
898 2842300264
899 2842361218
900 2852391707
901 2904472668
902 2929239475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

84

375

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9378 1 313
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.925 1 321
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9244 2 310
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9207 3 306
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9153 1 321
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.963 1 328 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9615 13 321 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.952 2 257 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9419 1 226 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.941 74 328 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2V5YE55-F1-model_v4 Aldo/keto reductase 0.9976 1 330 GO:0004033
GO:0005737
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 0.9956 124 207 GO:0004033
GO:0005737
AF-A0A2V5YE55-F1-model_v4 Aldo/keto reductase 0.9946 1 330 GO:0004033
GO:0005737
AF-A0A2V8YW19-F1-model_v4 Aldo/keto reductase 0.9927 99 330 GO:0004033
GO:0005737
AF-A0A1I2DYD0-F1-model_v4 Predicted oxidoreductase 0.9897 1 330 GO:0004033
GO:0005737

Map